Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001077 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001077
Unique NameTCONS_00001077
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3726

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001077 ID=TCONS_00001077|Name=TCONS_00001077|organism=Clytia hemisphaerica|type=transcript|length=3726bp
cttccattttcaaaccaaaaatgttttctcttttttttcgttttcatctt
ccctatcttcatttttctcctgGCGTGTTTTCTGACAGCTTCCATGCTTG
TTTGTGACATCCCCGATATATTCTTTCCATGGCAACCGCATGTCAAAATA
CATTTCACGCATGCtcattcattaaaaaaaatatgttcttTAAAGACAAA
AGATGGATCGATGCATTTCTTATTTCTTGATAGCTAACGCAGACGAGTTA
GATAAAAAAACCAATTTGGCTTGTCTATGAAAGTCTATGAAAATAAGTCA
TTAATATGGATGCAAGAGGGCTTAAATCATTTTTTCTAGTGCTCAAAata
gataataaaaaaaaatgatctAAAAACGAGTAACAAAAAGGATCAATAGA
GCGTTGCTAAGGTTGCAGTTTCCTTTATCCTTCAAAATAGTTGATGGAAT
GGGATTCCATCATCAACTTTTGATTTCCTTCTTTCGGTAAATACATCATC
ATGTTCAAAGAGCTTCAATAGTTCTGTCAGAAATAACCTTCTTGATGATA
ATTTCTTTAGTCAATAATTTCTTCGACCCAAACTTTTGAAGAAACCAATT
CACCACTCTGAAAGAAAATTCTATCTGTGGATGAACGAGTTTTAAAAGGA
ATAATGGTTGCATGTGGCTTCCATAAAACGATCTTTCGATAGATTCGATA
TCCCTTTCATCGACTTTGAAAACACGTTTAGTAGAAATGTGAGCATTTTG
GCAATATTGTGGCAATTCATTTCGAAGATTTTGGACATGTTGAATATAAG
ATTCCCTCGTTTCACCGTCATCGAAttctatttcaattttcaattcacCT
TCGACCATGTTTTTCATCTGTGGTTCCAGTTCGACTGAATATTGGTCAGT
TAGATCTATCCAATGTCGGTACTCGAATTCTTTCTGTTCTCTCAAAATGA
TTTGTTGTTTTGCGCAGCNGTGGTTCCAATTCGACTGAATATTGGTCAGT
TAGATCTATCCAATGTCGGTACTCGAATTCTTTCTGTTCTCTCCAAATGA
TTTGTTGTTTTGCGCAGCACGAAGAACGAGGCTCAGTGACTTTACAAATT
GTAATGACTTGTGGTTTCAAAGCagctagttctttcattttcgcATTCAA
ATCTTCTTTTCGCTTTCTGTACCGACGACAACCCAAAATGAACGGTACAA
TGGTTATATGAATGACCGAGCCAACTACCATATAATATGTCTTGCTGAAG
TTGTGCGATGGTAAAgcgaatatcaaccaaccaaatgcatAGACTGAAAT
ATTAAAAGAAGATTTGGTTTGTATTACGGTACTATAATGTAGTGTATAGT
GTATTATTATTCCTACCGATAaacattgatgactttttcaaGACTGTCAA
TGAACGAGCAACCTAAGTAACCGATGTCATTTTGAGAGATCGACTTTCCA
ACGTTTACTTACCGATGTTGCACCTGTCTGCATTGTTGCCCTTTACGTTA
AAGATCCTGTTGATATTTTCTTAAAGACCGGCTTGACAGTTGATTTGTTA
ACTTTAAATTAAAATCACAATAAATATTCTTGGCAAAAAGTATTTCATGA
AATTGATACTACTTACGAAAATAGTACAATCTCCAATGGTACCATTTGCC
ACGTCGTTTTCTACACCATGGGTGTAGCCATATCATCATTGGGTAAAAGT
AAAGGAAgaatatttgcaaaaaaattaagatataaAAACCTATCTCCTCT
ACCAGCTCTACCTCCATCATCGACTCGATCTTTCTTCGATTTGTATACTA
CTGTTTCTGTTAGAAGGCATCTTACACTTCCGTCTTTGACATGAAACTGT
TTTTATCCTATTTGCTTATATATTTGTCAAACCAATTGTCTACGTGTATG
ATTCGTCAACAAAAGGTTTTACAGAAATAAAATGTTATCATACAATAGAA
TATATAATGATAAATTATGTTGTTTTAATCAAAGTGCGTTTTGTCTCTCT
TGACTCTcgtacatttttttttatatttctcacTTCAGAACTGTcgtaaa
aaatcaaccaaatctGAAAAATCGTTAGAGTAACAGAGTGAACTGAATTT
ATCTTTTTAGCAACGTCAAAACAGTGAAGAATCGGACGTATTAACGCGTG
AACGTTTGTGTTGTGGCTTGTCTTTATTTGAGGTCGTATTACGTCGTATC
CAGTCCTTCTTGACGGATGACGCTTGGAAAGAACCGACGCCGGCAAACGG
TGTGATGAGCATTGAAGAATGTCGAGAATTCCATCGATTGTGGAGCGCTA
TACAGTTCATTTATTGCAAACCTCTGGGAGAACATGAAATCACCGTTGAG
GAAActtttggtgaaagtttgaattGGGCAGGAATCACATTGATTATGCT
ATTACGTCAAGAACATCGTTTCGAAGCTTTGGATTTCTGTAATCACATTC
TACGAGTGCAAGAAATCGACTCTCGACAAGAAGTCGTGGCTGGCGTGgAT
TTGAAACGTTTGATTCGTCGCATCAAAGAATATCAAACGATCAACAAGCA
CATTATGGCCGTGTTGAAACGTTATTTGAAGTCTGGTGATTCTTCGTCAG
TAGAGCAAGTGCGTTGCTTTCAACCTCCCATACATCAAGCCTTCATGTCA
TCCGTCTGATGAGAAACACAGGAATGAGCTTGTTATGATTTCATAAGTGA
TAGAAAGTTAGGTCAAACCTGTAACAGGTTGCTTGCTGGTCCAAAATATG
CGGGACGCTGCTTCAGTCAGCTTCACGCATGTAAAATACAGGTTAAGCTT
TGCAGGACAATAAGGTTCAAGGACCCTGGATATGGTTGTCCATCATAAGG
AACATATAAATTAATTTGTACTATAGACAATtgaatttcatgaatttttt
cctcgtttttcactacgttttttattttgatttttttgatttaataattt
aaaattctGTTTTTTGTATTGCCATTTATTCGCATTTCGTTTTCAGCTGC
ACTGTCTGTTTTTTCACCGCCACCTTTTTGTACCAGTCCACGATTTCTAC
TCATTTCGCGTATCTAATATTTGGAACTTAATGTTTTTAAAGCACTGTTG
TCGATTTTAGCCCAACTTTTGCACACGTCATCAGACGGTTTCTCTTGGAA
ACAAAGGTAATTTATTTTAACGAATATCAAGATgtagattttatcttttt
tttccttttgttaCTCTAAGTTTTATATATGAAATTACAATTTAAAATCA
TCTATTAATTTTCGACTTCTAATTTGAGCACAAAGAATCGAAAATCGCCC
AACTTTTCAGAtcgaagtttttaaaaattgatttggaAGGATCCATTTTT
GTTGGTCGGATTTTGACAACTGTTATCACTAACCGATATTACAGTCGact
ctctctttaattcgacgttctaatACTTCGTACCCTTattcttgaaaatc
gaattgcaGGGCGTCAACTGTATTCGAATTTTCGATCATAAAAGTGCACC
ACCCTCACAATCACCACCATATTTGTtcatttgtatatttttatatgttt
tataAAACAAGTACTGCTACTATTATTGTTATTGTGACCTACTATTTCTC
CCTACTATCATATCTTGCCTAATATTGAGTTTAGGTCATAGTTTTACAGA
ATTAGAAAATAGAAAGGTCAGATTATATCTCATCTTTTTGCATAGGGGAA
ATATAGAATATCATCTTGTAAAAATT
Run BLAST on NCBI

protein sequence of TCONS_00001077-protein

>TCONS_00001077-protein ID=TCONS_00001077-protein|Name=TCONS_00001077-protein|organism=Clytia hemisphaerica|type=polypeptide|length=134bp
MSIEECREFHRLWSAIQFIYCKPLGEHEITVEETFGESLNWAGITLIMLL
RQEHRFEALDFCNHILRVQEIDSRQEVVAGVDLKRLIRRIKEYQTINKHI
MAVLKRYLKSGDSSSVEQVRCFQPPIHQAFMSSV
Run BLAST on NCBI

transcript from alignment at sc0000007:1405146..1409277+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001077 ID=TCONS_00001077|Name=TCONS_00001077|organism=Clytia hemisphaerica|type=transcript|length=4132bp|location=Sequence derived from alignment at sc0000007:1405146..1409277+ (Clytia hemisphaerica)
cttccattttcaaaccaaaaatgttttctcttttttttcgttttcatctt ccctatcttcatttttctcctgGCGTGTTTTCTGACAGCTTCCATGCTTG TTTGTGACATCCCCGATATATTCTTTCCATGGCAACCGCATGTCAAAATA CATTTCACGCATGCtcattcattaaaaaaaatatgttcttTAAAGACAAA AGATGGATCGATGCATTTCTTATTTCTTGATAGCTAACGCAGACGAGTTA GATAAAAAAACCAATTTGGCTTGTCTATGAAAGTCTATGAAAATAAGTCA TTAATATGGATGCAAGAGGGCTTAAATCATTTTTTCTAGTGCTCAAAata gataataaaaaaaaatgatctAAAAACGAGTAACAAAAAGGATCAATAGA GCGTTGCTAAGGTTGCAGTTTCCTTTATCCTTCAAAATAGTTGATGGAAT GGGATTCCATCATCAACTTTTGATTTCCTTCTTTCGGTAAATACATCATC ATGTTCAAAGAGCTTCANGGATTCCATCATCAACTTTTGGTTACCTTCTT TCGGTAAATACATCATGTTCAAAGAGCTTCAATAGTTCTGTCAGAAATAA CCTTCTTGATGATAATTTCTTTAGTCAATAATTTCTTCGACCCAAACTTT TGAAGAAACCAATTCACCACTCTGAAAGAAAATTCTATCTGTGGATGAAC GAGTTTTAAAAGGAATAATGGTTGCATGTGGCTTCCATAAAACGATCTTT CGATAGATTCGATATCCCTTTCATCGACTTTGAAAACACGTTTAGTAGAA ATGTGAGCATTTTGGCAATATTGTGGCAATTCATTTCGAAGATTTTGGAC ATGTTGAATATAAGATTCCCTCGTTTCACCGTCATCGAAttctatttcaa ttttcaattcacCTTCGACCATGTTTTTCATCTGTGGTTCCAGTTCGACT GAATATTGGTCAGTTAGATCTATCCAATGTCGGTACTCGAATTCTTTCTG TTCTCTCAAAATGATTTGTTGTTTTGCGCAGCNGTGGTTCCAATTCGACT GAATATTGGTCAGTTAGATCTATCCAATGTCGGTACTCGAATTCTTTCTG TTCTCTCCAAATGATTTGTTGTTTTGCGCAGCACGAAGAACGAGGCTCAG TGACTTTACAAATTGTAATGACTTGTGGTTTCAAAGCagctagttctttc attttcgcATTCAAATCTTCTTTTCGCTTTCTGTACCGACGACAACCCAA AATGAACGGTACAATGGTTATATGAATGACCGAGCCAACTACCATATAAT ATGTCTTGCTGAAGTTGTGCGATGGTAAAgcgaatatcaaccaaccaaat gcatAGACTGAAATATTAAAAGAAGATTTGGTTTGTATTACGGTACTATA ATGTAGTGTATAGTGTATTATTATTCCTACCGATAaacattgatgacttt ttcaaGACTGTCAATGAACGAGCAACCTAAGTAACCGATGTCATTTTGAG AGATCGACTTTCCAACGTTTACTTACCGATGTTGCACCTGTCTGCATTGT TGCCCTTTACGTTAAAGATCCTGTTGATATTTTCTTAAAGACCGGCTTGA CAGTTGATTTGTTAACTTTAAATTAAAATCACAATAAATATTCTTGGCAA AAAGTATTTCATGAAATTGATACTACTTACGAAAATAGTACAATCTCCAA TGGTACCATTTGCCACGTCGTTTTCTACACCATGGGTGTAGCCATATCAT CATTGGGTAAAAGTAAAGGAAgaatatttgcaaaaaaattaagatataaA AACCTATCTCCTCTACCAGCTCTACCTCCATCATCGACTCGATCTTTCTT CGATTTGTATACTACTGTTTCTGTTAGAAGGCATCTTACACTTCCGTCTT TGACATGAAACTGTTTTTATCCTATTTGCTTATATATTTGTCAAACCAAT TGTCTACGTGTATGATTCGTCAACAAAAGGTTTTACAGAAATAAAATGTT ATCATACAATAGAATATATAATGATAAATTATGTTGTTTTAATCAAAGTG CGTTTTGTCTCTCTTGACTCTcgtacatttttttttatatttctcacTTC AGAACTGTcgtaaaaaatcaaccaaatctGAAAAATCGTTAGAGTAACAG AGTGAACTGAATTTATCTTTTTAGCAACGTCAAAACAGTGAAGAATCGGA CGTATTAACGCGTGAACGTTTGTGTTGTGGCTTGTCTTTATTTGAGGTCG TATTACGTCGTATCCAGTCCTTCTTGACGGATGACGCTTGGAAAGAACCG ACGCCGGCAAACGGTGTGATGAGCATTGAAGAATGTCGAGAATTCCATCG ATTGTGGAGCGCTATACAGTTCATTTATTGCAAACCTCTGGGAGAACATG AAATCACCGTTGAGTAAGTTGAACGGTGTTTCTATTATTGTTCATACAAA ATTATCAGTTAAAGATCTTACTTAATATGAgcttttttaccataaaaatc tttttactgACCAGATTTAAAATGATGTTATTTCATTCAGGGAAActttt ggtgaaagtttgaattGGGCAGGAATCACATTGATTATGCTATTACGTCA AGAACATCGTTTCGAAGCTTTGGATTTCTGTAATCACATTCTACGAGTGC AAGAAATCGACTCTCGACAAGAAGTCGTGGCTGGCGTGGTAAGAAtactt ctcaattttttttcgtttcaacTCAAGACGTATGGATTCGTCCTCCTGCA AATGAACTTAATaatatgaatttttgatttccttGAGACATGAGCATTAT AATTCAACGGAATATTTGTAAAATCGTACCATAAGAAAGTCTGATTTACT AGAAGCGCCACCGCCTTTTtgtaatgaaaaatattttttcttctttttga caggATTTGAAACGTTTGATTCGTCGCATCAAAGAATATCAAACGATCAA CAAGCACATTATGGCCGTGTTGAAACGTTATTTGAAGTCTGGTGATTCTT CGTCAGTAGAGCAAGTGCGTTGCTTTCAACCTCCCATACATCAAGCCTTC ATGTCATCCGTCTGATGAGAAACACAGGAATGAGCTTGTTATGATTTCAT AAGTGATAGAAAGTTAGGTCAAACCTGTAACAGGTTGCTTGCTGGTCCAA AATATGCGGGACGCTGCTTCAGTCAGCTTCACGCATGTAAAATACAGGTT AAGCTTTGCAGGACAATAAGGTTCAAGGACCCTGGATATGGTTGTCCATC ATAAGGAACATATAAATTAATTTGTACTATAGACAATtgaatttcatgaa ttttttcctcgtttttcactacgttttttattttgatttttttgatttaa taatttaaaattctGTTTTTTGTATTGCCATTTATTCGCATTTCGTTTTC AGCTGCACTGTCTGTTTTTTCACCGCCACCTTTTTGTACCAGTCCACGAT TTCTACTCATTTCGCGTATCTAATATTTGGAACTTAATGTTTTTAAAGCA CTGTTGTCGATTTTAGCCCAACTTTTGCACACGTCATCAGACGGTTTCTC TTGGAAACAAAGGTAATTTATTTTAACGAATATCAAGATgtagattttat cttttttttccttttgttaCTCTAAGTTTTATATATGAAATTACAATTTA AAATCATCTATTAATTTTCGACTTCTAATTTGAGCACAAAGAATCGAAAA TCGCCCAACTTTTCAGAtcgaagtttttaaaaattgatttggaAGGATCC ATTTTTGTTGGTCGGATTTTGACAACTGTTATCACTAACCGATATTACAG TCGactctctctttaattcgacgttctaatACTTCGTACCCTTattcttg aaaatcgaattgcaGGGCGTCAACTGTATTCGAATTTTCGATCATAAAAG TGCACCACCCTCACAATCACCACCATATTTGTtcatttgtatatttttat atgttttataAAACAAGTACTGCTACTATTATTGTTATTGTGACCTACTA TTTCTCCCTACTATCATATCTTGCCTAATATTGAGTTTAGGTCATAGTTT TACAGAATTAGAAAATAGAAAGGTCAGATTATATCTCATCTTTTTGCATA GGGGAAATATAGAATATCATCTTGTAAAAATT

Coding sequence (CDS) from alignment at sc0000007:1405146..1409277+

>TCONS_00001077 ID=TCONS_00001077|Name=TCONS_00001077|organism=Clytia hemisphaerica|type=CDS|length=1215bp|location=Sequence derived from alignment at sc0000007:1405146..1409277+ (Clytia hemisphaerica)
ATGAGCATTGAAGAATGTCGAGAATTCCATCGATTGTGGAGCGCTATACA
GTTCATTTATTGCAAACCTCTGGGAGAACATGAAATCACCGTTGAGGAAA
cttttggtgaaagtttgaattGGGCAGGAATCACATTGATTATGCTATTA
CGTCAAGAACATCGTTTCGAAGCTTTGGATTTCTGTAATCACATTCTACG
AGTGCAAGAAATCGACTCTCGACAAGAAGTCGTGGCTGGCGTGgATTTGA
AACGTTTGATTCGTCGCATCAAAGAATATCAAACGATCAACAAGCACATT
ATGGCCGTGTTGAAACGTTATTTGAAGTCTGGTGATTCTTCGTCAGTAGA
GCAAGTGCGTTGCTTTCAACCTCCCATACATCAAGCCTTCATGTCATCCG
TCTGAATGAGCATTGAAGAATGTCGAGAATTCCATCGATTGTGGAGCGCT
ATACAGTTCATTTATTGCAAACCTCTGGGAGAACATGAAATCACCGTTGA
GGAAActtttggtgaaagtttgaattGGGCAGGAATCACATTGATTATGC
TATTACGTCAAGAACATCGTTTCGAAGCTTTGGATTTCTGTAATCACATT
CTACGAGTGCAAGAAATCGACTCTCGACAAGAAGTCGTGGCTGGCGTGgA
TTTGAAACGTTTGATTCGTCGCATCAAAGAATATCAAACGATCAACAAGC
ACATTATGGCCGTGTTGAAACGTTATTTGAAGTCTGGTGATTCTTCGTCA
GTAGAGCAAGTGCGTTGCTTTCAACCTCCCATACATCAAGCCTTCATGTC
ATCCGTCTGAATGAGCATTGAAGAATGTCGAGAATTCCATCGATTGTGGA
GCGCTATACAGTTCATTTATTGCAAACCTCTGGGAGAACATGAAATCACC
GTTGAGGAAActtttggtgaaagtttgaattGGGCAGGAATCACATTGAT
TATGCTATTACGTCAAGAACATCGTTTCGAAGCTTTGGATTTCTGTAATC
ACATTCTACGAGTGCAAGAAATCGACTCTCGACAAGAAGTCGTGGCTGGC
GTGgATTTGAAACGTTTGATTCGTCGCATCAAAGAATATCAAACGATCAA
CAAGCACATTATGGCCGTGTTGAAACGTTATTTGAAGTCTGGTGATTCTT
CGTCAGTAGAGCAAGTGCGTTGCTTTCAACCTCCCATACATCAAGCCTTC
ATGTCATCCGTCTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000609XLOC_000609Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001077-proteinTCONS_00001077-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001077-exon-sc0000007-1491911889:1405146..1405642TCONS_00001077-exon-sc0000007-1491911889:1405146..1405642Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1510915933:1405146..1405642TCONS_00001077-exon-sc0000007-1510915933:1405146..1405642Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1575043694:1405146..1405642TCONS_00001077-exon-sc0000007-1575043694:1405146..1405642Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1491911889:1405707..1407558TCONS_00001077-exon-sc0000007-1491911889:1405707..1407558Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1510915933:1405707..1407558TCONS_00001077-exon-sc0000007-1510915933:1405707..1407558Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1575043694:1405707..1407558TCONS_00001077-exon-sc0000007-1575043694:1405707..1407558Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1491911889:1407686..1407833TCONS_00001077-exon-sc0000007-1491911889:1407686..1407833Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1510915933:1407686..1407833TCONS_00001077-exon-sc0000007-1510915933:1407686..1407833Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1575043694:1407686..1407833TCONS_00001077-exon-sc0000007-1575043694:1407686..1407833Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1491911889:1408049..1409277TCONS_00001077-exon-sc0000007-1491911889:1408049..1409277Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1510915933:1408049..1409277TCONS_00001077-exon-sc0000007-1510915933:1408049..1409277Clytia hemisphaericaexon
TCONS_00001077-exon-sc0000007-1575043694:1408049..1409277TCONS_00001077-exon-sc0000007-1575043694:1408049..1409277Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1405146..1409277 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
17.058 16.3292 13.0652 13.5082 24.6224 18.1885 20.4393 24.4165 15.8365 19.6477 17.3638 15.1966 20.5885 21.5768 15.3969 17.1809 19.3983 21.4287 20.7948 19.7549 25.3268 27.8601 27.0791 29.2588 24.6392 25.7058 25.0339 29.6833 18.418 18.4113
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR008081Cytoplasmic_FMR1-int
Blast
BLAST of TCONS_00001077 vs. Swiss-Prot (Human)
Match: CYFP1 (Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens GN=CYFIP1 PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 6.934e-63
Identity = 101/179 (56.42%), Postives = 138/179 (77.09%), Query Frame = 2
Query: 2123 SEESDVLTRERLCCGLSLFEVVLRRIQSFLTDDAWKEPTPANGVMSIEECREFHRLWSAIQFIYCKPLGEHEITVEETFGESLNWAGITLIMLLRQEHRFEALDFCNHILRVQEIDSRQEVVAGVDLKRLIRRIKEYQTINKHIMAVLKRYLKSGD--SSSVEQVRCFQPPIHQAFMSS 2653
            + E D+LT+ERLCCGLS+FEV+L RI+SFL D  W+ P P+NGVM ++EC EFHRLWSA+QF+YC P+G HE TVE+ FG+ L+WAG  +I+LL Q+ RF  LDFC H+L+VQ+ D + E++  V LK+++ RI+++Q +N  I+ +L +YLKSGD   + VE VRCFQPPIHQ+  SS
Sbjct: 1075 AREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS 1253          
The following BLAST results are available for this feature:
BLAST of TCONS_00001077 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CYFP16.934e-6356.42Cytoplasmic FMR1-interacting protein 1 OS=Homo sap... [more]
back to top