Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001060 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001060
Unique NameTCONS_00001060
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3223

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001060 ID=TCONS_00001060|Name=TCONS_00001060|organism=Clytia hemisphaerica|type=transcript|length=3223bp
aacaaataatTCAACATGGCGGATACTGCGGAAGATTTCAAAATGACGGA
TGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAATTCATGG
ACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAG
AAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGT
TCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTACGATTAT
CAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAG
GAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCA
TTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTA
TTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAG
GAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGA
GCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAAT
TGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCGGAACAGCAA
TCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAA
AGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGG
CCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAA
AGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGT
CCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGttTATCCT
CGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaa
tcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAATTGATTTTAGA
CTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTG
ACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaaagtGTTGATC
GTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCC
TCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATA
ATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTGTAACCATCAT
CAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGT
TTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCG
AAAGTATGCCAATGAATGCACAACTGCCACAATATTCGTTCGACCAGACA
ATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAA
CATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAG
ACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGAT
GACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGA
CCGAATggaattgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCA
TGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTG
GACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGA
TAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGG
ATATGGAAAGACGTTTGGAACAACTgctaaatgaagaagaaaagagtAAA
ATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCT
GAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCG
ACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCGCCGTTAATC
TCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGCGGCGCGCAC
CAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACCATCCTCGAC
TGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACG
GATactgatgatgacgtcataccTCATCGAGCGCGCGCTACTACTTACTC
AGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTTCACGACGTC
GGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACC
AAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaa
aaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCT
CGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaaaaa
cttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATG
GAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAA
CCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAACGG
AAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAA
TGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAT
TTTTGCATGACATTTATGACATCGCGTTTTAGGCGaatattttcaattgt
ttttcgtttaattgttttttataaagattGATTTTGTGTAAATAATGTGT
ATATATGGTAGACAACGTCGAGGAGCCCAAAAAATTGCTGACATATGCAT
ATTCAAGGGGCTTCTACGACACAACGGGTTCTGTTAGTCCAGTGTGCTGT
GAACTTACGAAAGTTTCTTTTAATTTAAATAAAACCTTTGAGTACGTTTG
ACTTGAAACTACGGGGCTATAACTTCAGTGAGCAACATTCGCATTCACAT
TAGTTCCAGAAGGTTCACAATGTTTATGGGTACTTGGACTAACatttttt
agagttttattttttatttgatacacCATGGACAAGCTATATAACTAAAA
GCCATGCCTCGAAATACACAGGTTTGTATCGAGAGCATCtagagaaatga
tcaatttttgttttgtgtaGTGTTTGATAATGTGCAAAATATTAATCGTG
CATTGTAAAGAGGTTGAAAATCTCGTTTTGTCGTTAGAAATATCACCGAA
ATTCAAATATTGTACCGAAATAT
Run BLAST on NCBI

protein sequence of TCONS_00001060-protein

>TCONS_00001060-protein ID=TCONS_00001060-protein|Name=TCONS_00001060-protein|organism=Clytia hemisphaerica|type=polypeptide|length=877bp
MADTAEDFKMTDDEARRIKQALKDKEFMDLLVEYAKEISDPENKKKYEEE
IVAMERQRGQDVRLLKPQSGFVIKTVRLSDNMKVFLNICSSPEVKEYELQ
HVKGGANLSLPHSVSPVREDIDKGGKACIVYDVCFNPKSYDKGMKESNFR
QSMVDSAFDTIERQMNIKLDRKNKKFPKLKYKGQARPLIIRPEQQSQQKT
SPKDDKNSKTEKDSPLDFRYPDIQKENKATEEKTGKDKESEKCTKRTVID
EGKPVVPKYKIVHRGFFEMTDYTGGSLSSTTPKELVVEIELPLAKSANGL
DLDIFAQQLILDSEKPSYHLDISLPHKVDEDRGKAQFDKSKKVLIVTLPI
LKAEPVTMVPNPPSRLVEECVDEKDVIHNGGHSPDSGIDEMCNHHQNDEE
DAEVVEDADECVFQPSDLDNAVFETKNFESMPMNAQLPQYSFDQTIESVV
VAVKVPNVKVENISLGITHQQVCLSLPQDASDINSPDWSLVIRLDDRYYL
EKDDCGFDILPDRMELNLKKKKSELWDRMFIGVSESSLKMEVFLVDATTS
GIVEQLKALNVDKLPRAEVGDVEERKVADMERRLEQLLNEEEKSKIDEET
YERCSNRDVARLKTESFSEGSDLDYRHVDLMELADDVIDENSPLISPTSN
TLNKHHEFAARTNRTLERSMSHDAYHPRLRSILKRSKSDGAANTTDTDDD
VIPHRARATTYSDGHTYLSDVENDFSRRRNKSVSFQDEPIVFEFTKMTKW
QWKRQELKKAKKKKSKAKNGTSSDQTASSADEEESSAVTSQEEEKLDKPS
EEKPPQKHGRKWKKAQKKRNRNNSESRSTEEETEQTNNGQKKDKRKKKNK
KNKNQVEDDSSNESKLTLSNPLIFQLD
Run BLAST on NCBI

transcript from alignment at sc0000007:1166492..1174367+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001060 ID=TCONS_00001060|Name=TCONS_00001060|organism=Clytia hemisphaerica|type=transcript|length=7876bp|location=Sequence derived from alignment at sc0000007:1166492..1174367+ (Clytia hemisphaerica)
aacaaataatTCAACATGGCGGATACTGCGGAAGATTTCAAAATGACGGA TGATGTAAGTTGCCAAATATTTGAAATCGATGCTAATTACTAGTAACTAA ATCACATTTATTAAATCTGATATTAAGACATCCAGTGTTTTTCAATTTAA AGCAGTTAACTAGAAAATGCCATTACTTATCAATTTTAGGAAGCTCGTCG GATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAAT ATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGGTGGCATAACAAATA CATTGCTCTTACTTCTTCTTCTTCGCGCTAAAACCTTTCTTCGAACGTTT GGGCACGATAGAGAAGGAATTTCATCTTGTTcaacctttgaaaatttgat ggcACTGTATTCTTCATGTATTTGAATGACTACGTTTCTTTGTCTGTTTT TTCAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAA GATGTTCGGCTGCTCAAACCACAGGTATCATAAAACATTCATGGGGCATC AATGAATTTATCCtcattcttcttttgttttatgtctACTCAAGTTGGTG AATCTTTTATAGAAAGAAacctaagaaattcaaaaatgttttaatatatg attttttttcatttatataCAAAACTATTTTCTATCAAATTCCACCTTTT TTATTTAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAATATG AAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATT GCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTC CTGTACGTGAAGACATCGACAAAGGTGACTAAAAAGTTTCATCACTTTGT ATTGTTGATAATTATTTAGTTTGGCAAAACCAAAGGACATTAAAGTATCA CAGGATTAGTGCAAAGATTTGTTTTGGTGTATTGTGTTAGTTTGAACTCT TGATTGTAATTATTTTCCCTGTTTATTTCTAGGTGGAAAGGCGTGTATTG TTTATGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGTC AGGCTTACTTATTTCAAGATATTAACACCAGATTATGCTAAGTTTCTATC GTTAGAGCTTGAAACATGAATGCGACGGTTTCTTAAAGATAGATTCCAAT AAGGTATAAAGAATTGTTGAAGTAAAGAAGACTCGTTTTGTCTCTAGGAA TCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCG TCAGATGAACATCAAACTCGATCGTAAAAGTAAGTCATTGTTACTATCTC TCTCCTTTCTCATTTAgatctttaaaggttttgttttgattgaaaggtct gatgatgctgatgtagtaaaaacaagtgcgacaagactagaaaatacatt gaataaaaaaccattcctcaaacaaagggacttttactgatactctttcg aatgttttatgtttataataaatagaacgttttctatcttataatcaaaa cattcgattgtaaatcaactttgctattttttgtttacaaaagcaataga atgtgAGGTCACATATCGAAACAACTtcgatctttcacttgtttgcagga tatcgttgcgtaaaaaagtagcttttatttatctgactcagcatgaagac actgcctaaaataagctccttttattcccgTAGAAAACCTTTAAGTGAGG CATTTTCAAAGGCTTGCTTGAAAAAACTAGGAATGATGTTTGAGAAGAAT TCTAACTCTTGATCTTAATTAAGAAACTTTTGTTAGACGGTTGTATAACA AAACATTGAATGCTTTCTCGCATCCATTTAGACAAGAAGTTTCCGAAATT GAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCGGAACAGGTTA GCActcgaaaatattttgatagaCCTCTTTTGAGATCGACAATTCATCCT CCTGGAAAAACTTTCTGTCTGTACGAGATACTAATAAATTTGTTGGAAAG TCTCAATCATGTGTATTATATTTAATCTCTCTCTCTATAAAGCAATCACA GCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACA GCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACG GAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGAC GGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACA GAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGGTACTTCaatcaa aactttttcatttttattttaagtgATCTCTCCTTGCAAGACTAGAGTTT TTTCGGCCATCTTTATCATGTCTTAAACAAATTAAGTTTTGCTGTTGATG ATCTGATGTATTTATGTTTAttgatgatttttattttttacagttTATCC TCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTGT GAGTATACTTTTGAGgagcttttgtttctttttttttatttcatgccATC AAATTTCTGTCAAATAATTGCGAAGTCCGTCCCGTTAAGGACAAATCCTC CTAAaatgctttctataattcgaatatctCTGAAATTCGAATAAATAAGA TTTCCCGCTCGAGTTCAAATTGGCGAGAGTGAACTGTACCTTCTTCAATT CCTTGAACCTCCTTGCTGTCCAATTCTactgtttattaaaatctctCATG ATcgctcatgttttttattttgaatttccagCAAGAGTCTTTTCTTTTGG AGGCTAATATTAGAAAAAGAGTAATCGTAAAATTTCTCGAATGTTANCTT TTCTTTTGGAGACTAATATTAGAAAAAGAGTAATCATGAAATTTCTCGaa tgttatttttagaaatcagCAAATGGTTTGGATTTGGACATCTTTGCACA ACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACTTGGATGTATCTT TTTCAATATTCTTCATAAAAAGTTAGAAGTTTCCCTCTATCAAGAAATAA GTGATTTCTCTAAAGCACCCTTGTAGCTCAatgtaaagttttctttttga tataaaaagtgttaaaaattcTCTCTCTCCTCTTCTTTTCAACTAATGAC ATCTAAAAGAGGTTTTCCTTGACGCAGATGTTTTACAGATTTCTCTGCCG CATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaa agtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGG TACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGAT GTGATTCATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTG TAACCATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAG ATGAATGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACC AAAAACTTCGAAAGTAAGAAGCATTTAAACTGTAAGAACAGAGGAAGTGA GAATTCATTGCTCTAATAAGGTTATACCCTTCACTCTTTATGTAGTACCG TATTCATCTTAGTTCATCATTAGTTCCatgtctttcatttttgttttaac tttttctaCATTTCTAACTGAAAAAAGCGCAAGGCTGAAAAGACTAGTTT TTTCTTGAAACTGGTGTTCCCTACAAAGCCTTCAAATGAATACGCTTCTT CCNTAACTGATGAAAGTGCAAGactattttttcttgaaattggtgtTGCT TACAAAGCCTTCAAATGAATACGCTTCTCTTTTCCCAGGTATGCCAATGA ATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTT GTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTAT CACACACCAACAGGTTAGtagaaagtcaatttttattaatttaacTAGGC TTCTATCAACACCGAAGTAGGTTGTGTGTGAGTGAACAGGGTCAATGATG TCAGAATGTCTCTTTCTCTGATCGCTAAAATGTAACTACTTCTGTTTTGC ATTACCCACGGTCCTTTTTAACTGGGATCTGACCCCGTTGCATGTAGCTT AAAGTGGTGAATTGTTAATTCTCTTTCAAGGTTTAGAGATGGAACGCTTA CAAAGTCACTCAAACCTTGCTGACCAAACTGAGAGTAATACTAGTTCCTA GTTCATTTAGGTCTTAAAAATATACTAGGATTAGAGATTTATATTTCAAC CTAAAACCTGATAAGCTTGGATAAGGCAATTTGTAATAAATTCCAACATT AGGTTATGTAACTTTAGCTTGGCTTCGGAGCCACTCCCTTAAATTGAAGT TATCAGTCAAACTTAGTATATTTGACCTAGCTTAAATGGCTTGCCGTTAA AAAAACTTGTCCCTTAATCTCTGAGATAAGGTTATCAAATTTTTGGCTTT CATTTTTGGTTCTTTCCTGTTCTTTCTTCGTCATTAGTCAATGGAAGTTT TTAACCGCACAATATATCCAacccaaattttcaaactttattaCGTAATC TAACATTTCCTTATTTTCATTTAGGTCTGTCTGAGTTTGCCACAAGACGC TTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACC GATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGA ATggaattgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTT CATTGGGGTTTCTGAATCTTCTTTGAAAGTATGTCTTCTTTGCTTGTTTG TTGAAATTACTGAACCGTTTCTCTGAACTCTTTTGTTTGTTAGCTAGAGA AGCACGGTATGGCTTCTAAACCGTTCAATAACtattataattattttttc tatgAAAGTGCTGTAGCAGATTTAAACTATGGCTAATTTGTTTCAATATC TGAACGTGTTTGTTAGTCAAAAAGATGAGGTCAGCTTGCCTTGATATGTT TCCATGCTTAATGTTCACCTTTTTCTTGagaattttaagatttaaaggAT GAATTAAGAAATAAGTTTTTGTTGTCTATTTAATTTAGATGGAGGTGTTT TTGGTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAA TGTGGATAAGGTGAAATTCTTATTTGTTCTATTCCGTATTATTGGCTATC GCCGCCTTATCCTGAACTAACGCCTCAGTATAAAAAGATAACTCAGTAGT TGAAAACTGTTTTAGTTTTCACTGCATACTTTTCCCTGTTTCACTGCATA TTTTCCCCTGCCTTACTGCATACTTGCCCTGTTTCACTGCATACTTGCCC TGTTTCACTGCATACTTGCCCTGCCTTACTGCATACTTGCCCTGTTTCAC TGCATACTTGCCCTGCCTTACTGCATACTTGCCCTGTTTCACTGCATACT TGCCCTGTTTCACTGCATACTTGCCCTGCCTTACTGCATACTTGCCCTGT TTCACTGCATACTTGCCCTGTTTCACTGCATACTTGCCCTGCCTTACTGC ATACTTGCCCTGTTTCACTGAATACTTGCCCTTCTTTGCTTAGCTTCCAC GAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGA CGTTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGTAAGGAT CAATCTACGCTAAGTATAGGTTTTGcctagaaaaaaaagaaaatacctCA GGTGGATTAATTTTGACGTGGATTTAATCTGGCGattggcaaaaatattt ttgacggGGATTCAATTTGGCGATTGatcaatattttgtaaaaattggcA AGGATTTAATTTGACGAATTAGGAATTTGTAGACACTAAAATGGATGAAA GTTACtataaaatatactaaaaaggtTTGATTACTCACATAATATTCTTT CCGTTAAATttagcggggatttaatttggcaaatgacctattttagaaat ttggcggggatttaatttgacgaattttgtcaaaattcgccaaattcgcc taATTTAATctccgccaaaattaatccacttaaggtacaaGACACAGACC TCAAATCATTCGAAAGTCTTTTGATAAGAATTAGGCTTTGTAGCAAATAC GAAAAGGTTTAGAAACAAACGGTGTGATAAGAACTTGATATCAATgttgt ttttccttcaaagGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATG TTGCACGTCTGAAAACAGGTCAGTAGTACAGTTTCAATTTAAACAAATTC TTCCCTTTGATGAAAACCTTAATCAAATGTTTAACTTTTAtcgtaagaaa aataaaatgcaGAGAGACATTTTTCAATCCactaaaatcctcaaaaaccg TTTCTTTGTAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATG TCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCGCCGTTA ATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGCGGCGCG CACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACCATCCTC GACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACT ACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCTACTACTTA CTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTTCACGAC GTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTT ACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaa gaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCAT CCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaa aaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAA ATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGT CAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAA CGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTC AAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATT GATTTTTGCATGACATTTATGACATCGCGTTTTAGGCGaatattttcaat tgtttttcgtttaattgttttttataaagattGATTTTGTGTAAATAATG TGTATATATGGTAGACAACGTCGAGGAGCCCAAAAAATTGCTGACATATG CATATTCAAGGGGCTTCTACGACACAACGGGTTCTGTTAGTCCAGTGTGC TGTGAACTTACGAAAGTTTCTTTTAATTTAAATAAAACCTTTGAGTACGT TTGACTTGAAACTACGGGGCTATAACTTCAGTGAGCAACATTCGCATTCA CATTAGTTCCAGAAGGTTCACAATGTTTATGGGTACTTGGACTAACattt tttagagttttattttttatttgatacacCATGGACAAGCTATATAACTA AAAGCCATGCCTCGAAATACACAGGTTTGTATCGAGAGCATCtagagaaa tgatcaatttttgttttgtgtaGTGTTTGATAATGTGCAAAATATTAATC GTGCATTGTAAAGAGGTTGAAAATCTCGTTTTGTCGTTAGAAATATCACC GAAATTCAAATATTGTACCGAAATAT

Coding sequence (CDS) from alignment at sc0000007:1166492..1174367+

>TCONS_00001060 ID=TCONS_00001060|Name=TCONS_00001060|organism=Clytia hemisphaerica|type=CDS|length=44778bp|location=Sequence derived from alignment at sc0000007:1166492..1174367+ (Clytia hemisphaerica)
ATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATGAAGCTCGTCG
GATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAAT
ATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAG
ATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACC
ACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAATATGAAAG
TCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAG
CATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGT
ACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTT
GTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATCGAATTTCCGC
CAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAGATGAACAT
CAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGAC
AAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACAGCAAAAGACT
TCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGA
TTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAA
CTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGACGGTTATTGAC
GAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTT
TGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACTACACCAAAAG
AGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTG
GATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAGAGAAACCGTC
TTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAA
AAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCACGCTACCCATT
TTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCATCGCGATTGGT
TGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGCGGTCATTCAC
CGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAATGACGAAGAA
GATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGA
TCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGA
ATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTT
GTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTAT
CACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCA
ACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCGATATTATCTC
GAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAATggaattgaa
tttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTCATTGGGGTTT
CTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCA
GGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGC
AGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTT
TGGAACAACTgctaaatgaagaagaaaagagtAAAATTGACGAAGAGACG
TATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTT
TTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTGATGGAACtcg
ctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACCCACCTCCAAT
ACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGA
ACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGTTCTATCTTGA
AACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATactgatgatgac
gtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACGGTCATACTTA
CTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAATAAATCGGTGA
GTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAAATGG
CAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaagaaatcgaaaGC
AAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAG
AATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgACAAACCGAGC
GAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAA
GAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTG
AGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAG
AAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTGAC
TCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCGGATACTGCGG
AAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAAACAAGCACTT
AAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAAAAGAAATTTC
TGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTTGCGATGGAGC
GACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTG
ATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTTTGAACATTTG
CAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTGAAAGGAGGCG
CCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGAAGACATCGAC
AAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCAATCCCAAATC
ATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCGATGGTGGACT
CAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACTCGATCGTAAA
AACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCCGACCACTGAT
CATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCAAAGGATGACA
AAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCGATATCCCGAT
ATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAAAGGATAAAGA
ATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGGAAGCCGGTAG
TTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAATGACTGATTAC
ACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGGTTGTGGAAAT
TGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTGGACATCTTTG
CACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACTTGGATATT
TCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgataa
atccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAACCCG
TTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGGAT
GAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATAGCGGTATTGA
TGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGG
AGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTC
TTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCACAACTGCCACA
ATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTAC
CCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACACCAACAGGTC
TGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGCCAGATTGGAG
CTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAAGACGATTGCG
GTTTCGATATTTTACCTGACCGAATggaattgaatttgaaaaagaagaaa
agtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAATCTTCTTTGAA
AATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATCGTTGAACAAT
TGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGATGTA
GAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAACAACTgctaaa
tgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAGAGATGTTCAA
ATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGAT
CTTGATTACCGACATGTCGACCTGATGGAACtcgctgatgacgtcatcga
cgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTGAACAAACATC
ATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTCTATGAGTCAC
GACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTTCGAAAAGCGA
CGGTGCTGCAAACACTACGGATactgatgatgacgtcataccTCATCGAG
CGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATCGGATGTCGAG
AACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTCAAGACGAGCC
GATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGGAAGCGACAAG
AATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAACGGAACGAGT
TCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTTAC
CTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAAAAACCGCCCC
AAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAAATCGGAAC
AACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGACGAACAACGG
ACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAACAAAAACCAAG
TTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAGCAATCCCTTG
ATTTTCCAATTAGATTGAATGGCGGATACTGCGGAAGATTTCAAAATGAC
GGATGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAATTCA
TGGACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAATAAG
AAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGA
TGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTACGAT
TATCAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTG
AAGGAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACC
GCATTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGT
GTATTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATG
AAGGAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAAT
TGAGCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGA
AATTGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCGGAACAG
CAATCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGA
AAAAGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATA
AGGCCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACG
AAAAGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAAT
CGTCCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGttTAT
CCTCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCT
aaatcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAATTGATTTT
AGACTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCCGCATAAAG
TTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaaagtGTTG
ATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGGTACCCAA
TCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTC
ATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTGTAACCAT
CATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATG
TGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAACT
TCGAAAGTATGCCAATGAATGCACAACTGCCACAATATTCGTTCGACCAG
ACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGA
AAACATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAGTTTGCCAC
AAGACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTG
GATGACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACC
TGACCGAATggaattgaatttgaaaaagaagaaaagtgaATTGTGGGATC
GCATGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTG
GTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGT
GGATAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGG
CGGATATGGAAAGACGTTTGGAACAACTgctaaatgaagaagaaaagagt
AAAATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATGTTGCACG
TCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATG
TCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCGCCGTTA
ATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGCGGCGCG
CACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACCATCCTC
GACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACT
ACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCTACTACTTA
CTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTTCACGAC
GTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTT
ACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaa
gaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCAT
CCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaa
aaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAA
ATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGT
CAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAA
CGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTC
AAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATT
GAATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATGAAGCTCGT
CGGATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGA
ATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAG
AGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAA
CCACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAATATGAA
AGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGC
AGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCT
GTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGT
TTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATCGAATTTCC
GCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAGATGAAC
ATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGG
ACAAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACAGCAAAAGA
CTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTG
GATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAA
AACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGACGGTTATTG
ACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTC
TTTGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACTACACCAAA
AGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTT
TGGATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAGAGAAACCG
TCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGG
AAAAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCACGCTACCCA
TTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCATCGCGATTG
GTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGCGGTCATTC
ACCGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAATGACGAAG
AAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGT
GATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAAT
GAATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTG
TTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGT
ATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACAT
CAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCGATATTATC
TCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAATggaattg
aatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTCATTGGGGT
TTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTT
CAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGA
GCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACG
TTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGACGAAGAGA
CGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGT
TTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTGATGGAACt
cgctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACCCACCTCCA
ATACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATCGGACGCTT
GAACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGTTCTATCTT
GAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATactgatgatg
acgtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACGGTCATACT
TACTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAATAAATCGGT
GAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAAAT
GGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaagaaatcgaaa
GCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGA
AGAATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgACAAACCGA
GCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAA
AAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAAC
TGAGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATA
AGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTG
ACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCGGATACTGC
GGAAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAAACAAGCAC
TTAAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAAAAGAAATT
TCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTTGCGATGGA
GCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTCTGGTTTTG
TGATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTTTGAACATT
TGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTGAAAGGAGG
CGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGAAGACATCG
ACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCAATCCCAAA
TCATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCGATGGTGGA
CTCAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACTCGATCGTA
AAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCCGACCACTG
ATCATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCAAAGGATGA
CAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCGATATCCCG
ATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAAAGGATAAA
GAATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGGAAGCCGGT
AGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAATGACTGATT
ACACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGGTTGTGGAA
ATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTGGACATCTT
TGCACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACTTGGATA
TTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgat
aaatccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAACC
CGTTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGG
ATGAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATAGCGGTATT
GATGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCAGAAGTTGT
GGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGACAACGCTG
TCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCACAACTGCCA
CAATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGT
ACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACACCAACAGG
TCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGCCAGATTGG
AGCTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAAGACGATTG
CGGTTTCGATATTTTACCTGACCGAATggaattgaatttgaaaaagaaga
aaagtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAATCTTCTTTG
AAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATCGTTGAACA
ATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGATG
TAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAACAACTgcta
aatgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAGAGATGTTC
AAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCG
ATCTTGATTACCGACATGTCGACCTGATGGAACtcgctgatgacgtcatc
gacgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTGAACAAACA
TCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTCTATGAGTC
ACGACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTTCGAAAAGC
GACGGTGCTGCAAACACTACGGATactgatgatgacgtcataccTCATCG
AGCGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATCGGATGTCG
AGAACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTCAAGACGAG
CCGATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGGAAGCGACA
AGAATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAACGGAACGA
GTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTT
ACCTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAAAAACCGCC
CCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAAATCGGA
ACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGACGAACAAC
GGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAACAAAAACCA
AGTTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAGCAATCCCT
TGATTTTCCAATTAGATTGAATGGCGGATACTGCGGAAGATTTCAAAATG
ACGGATGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAATT
CATGGACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAATA
AGAAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAA
GATGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTACG
ATTATCAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAG
TGAAGGAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTA
CCGCATTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGC
GTGTATTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAA
TGAAGGAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACA
ATTGAGCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAAGTTTCC
GAAATTGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCGGAAC
AGCAATCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACT
GAAAAAGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAA
TAAGGCCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCA
CGAAAAGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAA
ATCGTCCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGttT
ATCCTCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAG
CTaaatcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAATTGATT
TTAGACTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCCGCATAA
AGTTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaaagtGT
TGATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGGTACCC
AATCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGAT
TCATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTGTAACC
ATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAA
TGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAA
CTTCGAAAGTATGCCAATGAATGCACAACTGCCACAATATTCGTTCGACC
AGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTG
GAAAACATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAGTTTGCC
ACAAGACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTT
TGGATGACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTA
CCTGACCGAATggaattgaatttgaaaaagaagaaaagtgaATTGTGGGA
TCGCATGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTT
TGGTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAAT
GTGGATAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGT
GGCGGATATGGAAAGACGTTTGGAACAACTgctaaatgaagaagaaaaga
gtAAAATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATGTTGCA
CGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACA
TGTCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCGCCGT
TAATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGCGGCG
CGCACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACCATCC
TCGACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACA
CTACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCTACTACT
TACTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTTCACG
ACGTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGT
TTACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagca
aagaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGC
ATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaag
aaaaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGA
AAATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCG
GTCAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACA
AACGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCT
TCAAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGA
TTGAATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATGAAGCTC
GTCGGATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTA
GAATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATACGAGGA
AGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCA
AACCACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAATATG
AAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATT
GCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTC
CTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGAT
GTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATCGAATTT
CCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAGATGA
ACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAA
GGACAAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACAGCAAAA
GACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTT
TGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAA
AAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGACGGTTAT
TGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTT
TCTTTGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACTACACCA
AAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGG
TTTGGATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAGAGAAAC
CGTCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGACCGC
GGAAAAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCACGCTACC
CATTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCATCGCGAT
TGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGCGGTCAT
TCACCGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAATGACGA
AGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAA
GTGATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCA
ATGAATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGT
TGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCG
GTATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGAC
ATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCGATATTA
TCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAATggaat
tgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTCATTGGG
GTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAAC
TTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCCAC
GAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGA
CGTTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGACGAAGA
GACGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGA
GTTTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTGATGGAA
CtcgctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACCCACCTC
CAATACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATCGGACGC
TTGAACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGTTCTATC
TTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATactgatga
tgacgtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACGGTCATA
CTTACTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAATAAATCG
GTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAA
ATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaagaaatcga
aaGCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAA
GAAGAATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgACAAACC
GAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGC
AAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAA
ACTGAGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAA
TAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAAC
TGACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCGGATACT
GCGGAAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAAACAAGC
ACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAAAAGAAA
TTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTTGCGATG
GAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTCTGGTTT
TGTGATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTTTGAACA
TTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTGAAAGGA
GGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGAAGACAT
CGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCAATCCCA
AATCATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCGATGGTG
GACTCAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACTCGATCG
TAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCCGACCAC
TGATCATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCAAAGGAT
GACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCGATATCC
CGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAAAGGATA
AAGAATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGGAAGCCG
GTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAATGACTGA
TTACACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGGTTGTGG
AAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTGGACATC
TTTGCACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACTTGGA
TATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcg
ataaatccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAA
CCCGTTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGT
GGATGAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATAGCGGTA
TTGATGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCAGAAGTT
GTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGACAACGC
TGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCACAACTGC
CACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAA
GTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACACCAACA
GGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGCCAGATT
GGAGCTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAAGACGAT
TGCGGTTTCGATATTTTACCTGACCGAATggaattgaatttgaaaaagaa
gaaaagtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAATCTTCTT
TGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATCGTTGAA
CAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGA
TGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAACAACTgc
taaatgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAGAGATGT
TCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAG
CGATCTTGATTACCGACATGTCGACCTGATGGAACtcgctgatgacgtca
tcgacgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTGAACAAA
CATCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTCTATGAG
TCACGACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTTCGAAAA
GCGACGGTGCTGCAAACACTACGGATactgatgatgacgtcataccTCAT
CGAGCGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATCGGATGT
CGAGAACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTCAAGACG
AGCCGATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGGAAGCGA
CAAGAATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAACGGAAC
GAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTTCAGCTG
TTACCTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAAAAACCG
CCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAAATCG
GAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGACGAACA
ACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAACAAAAAC
CAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAGCAATCC
CTTGATTTTCCAATTAGATTGAATGGCGGATACTGCGGAAGATTTCAAAA
TGACGGATGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAA
TTCATGGACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAA
TAAGAAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTC
AAGATGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTA
CGATTATCAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGA
AGTGAAGGAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCT
TACCGCATTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAG
GCGTGTATTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATAAAGG
AATGAAGGAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATA
CAATTGAGCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAAGTTT
CCGAAATTGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCGGA
ACAGCAATCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGA
CTGAAAAAGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAA
AATAAGGCCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATG
CACGAAAAGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACA
AAATCGTCCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGt
tTATCCTCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTT
AGCTaaatcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAATTGA
TTTTAGACTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCCGCAT
AAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaaagt
GTTGATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGGTAC
CCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTG
ATTCATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTGTAA
CCATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATG
AATGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAA
AACTTCGAAAGTATGCCAATGAATGCACAACTGCCACAATATTCGTTCGA
CCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAG
TGGAAAACATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAGTTTG
CCACAAGACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCG
TTTGGATGACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTT
TACCTGACCGAATggaattgaatttgaaaaagaagaaaagtgaATTGTGG
GATCGCATGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTT
TTTGGTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGA
ATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAA
GTGGCGGATATGGAAAGACGTTTGGAACAACTgctaaatgaagaagaaaa
gagtAAAATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATGTTG
CACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGA
CATGTCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCGCC
GTTAATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGCGG
CGCGCACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACCAT
CCTCGACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAA
CACTACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCTACTA
CTTACTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTTCA
CGACGTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGA
GTTTACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaag
caaagaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACG
GCATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaaga
agaaaaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCC
GAAAATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGC
CGGTCAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGA
CAAACGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATT
CTTCAAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTA
GATTGAATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATGAAGC
TCGTCGGATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGG
TAGAATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATACGAG
GAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCT
CAAACCACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAATA
TGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAA
TTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTC
TCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATG
ATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATCGAAT
TTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAGAT
GAACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACA
AAGGACAAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACAGCAA
AAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACAGCCC
TTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAG
AAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGACGGTT
ATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGG
TTTCTTTGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACTACAC
CAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAAT
GGTTTGGATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAGAGAA
ACCGTCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGACC
GCGGAAAAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCACGCTA
CCCATTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCATCGCG
ATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGCGGTC
ATTCACCGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAATGAC
GAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACC
AAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGC
CAATGAATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGAGT
GTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCT
CGGTATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTG
ACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCGATAT
TATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAATgga
attgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTCATTG
GGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACA
ACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCC
ACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAA
GACGTTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGACGAA
GAGACGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGA
GAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTGATGG
AACtcgctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACCCACC
TCCAATACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATCGGAC
GCTTGAACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGTTCTA
TCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATactgat
gatgacgtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACGGTCA
TACTTACTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAATAAAT
CGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGACG
AAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaagaaatc
gaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGATG
AAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgACAAA
CCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGC
GCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAG
AAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAAGAAG
AATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAA
ACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCGGATA
CTGCGGAAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAAACAA
GCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAAAAGA
AATTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTTGCGA
TGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTCTGGT
TTTGTGATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTTTGAA
CATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTGAAAG
GAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGAAGAC
ATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCAATCC
CAAATCATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCGATGG
TGGACTCAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACTCGAT
CGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCCGACC
ACTGATCATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCAAAGG
ATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCGATAT
CCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAAAGGA
TAAAGAATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGGAAGC
CGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAATGACT
GATTACACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGGTTGT
GGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTGGACA
TCTTTGCACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACTTG
GATATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTCAATT
cgataaatccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAAGCTG
AACCCGTTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGAATGC
GTGGATGAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATAGCGG
TATTGATGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCAGAAG
TTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGACAAC
GCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCACAACT
GCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCAGTGA
AAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACACCAA
CAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGCCAGA
TTGGAGCTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAAGACG
ATTGCGGTTTCGATATTTTACCTGACCGAATggaattgaatttgaaaaag
aagaaaagtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAATCTTC
TTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATCGTTG
AACAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGTCGGT
GATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAACAACT
gctaaatgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAGAGAT
GTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGC
AGCGATCTTGATTACCGACATGTCGACCTGATGGAACtcgctgatgacgt
catcgacgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTGAACA
AACATCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTCTATG
AGTCACGACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTTCGAA
AAGCGACGGTGCTGCAAACACTACGGATactgatgatgacgtcataccTC
ATCGAGCGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATCGGAT
GTCGAGAACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTCAAGA
CGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGGAAGC
GACAAGAATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAACGGA
ACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTTCAGC
TGTTACCTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAAAAAC
CGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAAAT
CGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGACGAA
CAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAACAAAA
ACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAGCAAT
CCCTTGATTTTCCAATTAGATTGAATGGCGGATACTGCGGAAGATTTCAA
AATGACGGATGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAG
AATTCATGGACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAA
AATAAGAAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGG
TCAAGATGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAG
TACGATTATCAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCT
GAAGTGAAGGAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTC
CTTACCGCATTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAA
AGGCGTGTATTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATAAA
GGAATGAAGGAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGA
TACAATTGAGCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAAGT
TTCCGAAATTGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGACCG
GAACAGCAATCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAA
GACTGAAAAAGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAAGG
AAAATAAGGCCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAA
TGCACGAAAAGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTA
CAAAATCGTCCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGGAA
GttTATCCTCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCC
TTAGCTaaatcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAATT
GATTTTAGACTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCCGC
ATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaaaa
gtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATGGT
ACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATG
TGATTCATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGTGT
AACCATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGA
TGAATGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAACCA
AAAACTTCGAAAGTATGCCAATGAATGCACAACTGCCACAATATTCGTTC
GACCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAA
AGTGGAAAACATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAGTT
TGCCACAAGACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCATT
CGTTTGGATGACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGATAT
TTTACCTGACCGAATggaattgaatttgaaaaagaagaaaagtgaATTGT
GGGATCGCATGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTG
TTTTTGGTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCTTT
GAATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCA
AAGTGGCGGATATGGAAAGACGTTTGGAACAACTgctaaatgaagaagaa
aagagtAAAATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGATGT
TGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACC
GACATGTCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACTCG
CCGTTAATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTTGC
GGCGCGCACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATACC
ATCCTCGACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCA
AACACTACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCTAC
TACTTACTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTTTT
CACGACGTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTT
GAGTTTACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaagaa
agcaaagaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAA
CGGCATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaagaa
gaagaaaaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGG
CCGAAAATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAA
GCCGGTCAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGAAA
GACAAACGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGA
TTCTTCAAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCAAT
TAGATTGAATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATGAA
GCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTGCT
GGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATACG
AGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTG
CTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGACAA
TATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATG
AATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTG
TCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTA
TGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATCGA
ATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAG
ATGAACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTA
CAAAGGACAAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACAGC
AAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACAGC
CCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACGGA
AGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGACGG
TTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGA
GGTTTCTTTGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACTAC
ACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAA
ATGGTTTGGATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAGAG
AAACCGTCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGA
CCGCGGAAAAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCACGC
TACCCATTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCATCG
CGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGCGG
TCATTCACCGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAATG
ACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAA
CCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTAT
GCCAATGAATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGAGA
GTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCT
CTCGGTATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTC
TGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCGAT
ATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAATg
gaattgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTCAT
TGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCA
CAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTT
CCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGA
AAGACGTTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGACG
AAGAGACGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAACA
GAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTGAT
GGAACtcgctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACCCA
CCTCCAATACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATCGG
ACGCTTGAACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGTTC
TATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATactg
atgatgacgtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACGGT
CATACTTACTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAATAA
ATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGA
CGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaagaaa
tcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGA
TGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgACA
AACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAA
GCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGA
AGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAAGA
AGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGC
AAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCGGA
TACTGCGGAAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAAAC
AAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAAAA
GAAATTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTTGC
GATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTCTG
GTTTTGTGATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTTTG
AACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTGAA
AGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGAAG
ACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCAAT
CCCAAATCATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCGAT
GGTGGACTCAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACTCG
ATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCCGA
CCACTGATCATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCAAA
GGATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCGAT
ATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAAAG
GATAAAGAATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGGAA
GCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAATGA
CTGATTACACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGGTT
GTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTGGA
CATCTTTGCACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCACT
TGGATATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTCAA
TTcgataaatccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAAGC
TGAACCCGTTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGAAT
GCGTGGATGAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATAGC
GGTATTGATGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCAGA
AGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGACA
ACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCACAA
CTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCAGT
GAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACACC
AACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGCCA
GATTGGAGCTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAAGA
CGATTGCGGTTTCGATATTTTACCTGACCGAATggaattgaatttgaaaa
agaagaaaagtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAATCT
TCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATCGT
TGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGTCG
GTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAACAA
CTgctaaatgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAGAG
ATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAG
GCAGCGATCTTGATTACCGACATGTCGACCTGATGGAACtcgctgatgac
gtcatcgacgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTGAA
CAAACATCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTCTA
TGAGTCACGACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTTCG
AAAAGCGACGGTGCTGCAAACACTACGGATactgatgatgacgtcatacc
TCATCGAGCGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATCGG
ATGTCGAGAACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTCAA
GACGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGGAA
GCGACAAGAATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAACG
GAACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTTCA
GCTGTTACCTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAAAA
ACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAA
ATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGACG
AACAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAACAA
AAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAGCA
ATCCCTTGATTTTCCAATTAGATTGAATGGCGGATACTGCGGAAGATTTC
AAAATGACGGATGATGAAGCTCGTCGGATCAAACAAGCACTTAAAGACAA
AGAATTCATGGACTTGCTGGTAGAATATGCAAAAGAAATTTCTGATCCCG
AAAATAAGAAGAAATACGAGGAAGAGATCGTTGCGATGGAGCGACAAAGA
GGTCAAGATGTTCGGCTGCTCAAACCACAGTCTGGTTTTGTGATAAAGAC
AGTACGATTATCAGACAATATGAAAGTCTTTTTGAACATTTGCAGCAGCC
CTGAAGTGAAGGAGTATGAATTGCAGCATGTGAAAGGAGGCGCCAACCTC
TCCTTACCGCATTCTGTGTCTCCTGTACGTGAAGACATCGACAAAGGTGG
AAAGGCGTGTATTGTTTATGATGTTTGTTTCAATCCCAAATCATACGATA
AAGGAATGAAGGAATCGAATTTCCGCCAGTCGATGGTGGACTCAGCGTTC
GATACAATTGAGCGTCAGATGAACATCAAACTCGATCGTAAAAACAAGAA
GTTTCCGAAATTGAAGTACAAAGGACAAGCCCGACCACTGATCATTCGAC
CGGAACAGCAATCACAGCAAAAGACTTCTCCAAAGGATGACAAAAACTCT
AAGACTGAAAAAGACAGCCCTTTGGATTTTCGATATCCCGATATTCAAAA
GGAAAATAAGGCCACGGAAGAAAAAACTGGAAAGGATAAAGAATCGGAAA
AATGCACGAAAAGGACGGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAG
TACAAAATCGTCCACAGAGGTTTCTTTGAAATGACTGATTACACTGGGGG
AAGttTATCCTCGACTACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTC
CCTTAGCTaaatcagCAAATGGTTTGGATTTGGACATCTTTGCACAACAA
TTGATTTTAGACTCAGAGAAACCGTCTTATCACTTGGATATTTCTCTGCC
GCATAAAGTTGACGAGGACCGCGGAAAAGCTCAATTcgataaatccaaaa
aagtGTTGATCGTCACGCTACCCATTTTGAAAGCTGAACCCGTTACCATG
GTACCCAATCCTCCATCGCGATTGGTTGAAGAATGCGTGGATGAGAAAGA
TGTGATTCATAATGGCGGTCATTCACCGGATAGCGGTATTGATGAGATGT
GTAACCATCATCAAAATGACGAAGAAGATGCAGAAGTTGTGGAGGATGCA
GATGAATGTGTTTTTCAACCAAGTGATCTCGACAACGCTGTCTTTGAAAC
CAAAAACTTCGAAAGTATGCCAATGAATGCACAACTGCCACAATATTCGT
TCGACCAGACAATAGAGAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTT
AAAGTGGAAAACATCTCTCTCGGTATCACACACCAACAGGTCTGTCTGAG
TTTGCCACAAGACGCTTCTGACATCAACTCGCCAGATTGGAGCTTAGTCA
TTCGTTTGGATGACCGATATTATCTCGAAAAAGACGATTGCGGTTTCGAT
ATTTTACCTGACCGAATggaattgaatttgaaaaagaagaaaagtgaATT
GTGGGATCGCATGTTCATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGG
TGTTTTTGGTGGACGCCACAACTTCAGGCATCGTTGAACAATTGAAAGCT
TTGAATGTGGATAAGCTTCCACGAGCAGAGGTCGGTGATGTAGAAGAACG
CAAAGTGGCGGATATGGAAAGACGTTTGGAACAACTgctaaatgaagaag
aaaagagtAAAATTGACGAAGAGACGTATGAGAGATGTTCAAATCGAGAT
GTTGCACGTCTGAAAACAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTA
CCGACATGTCGACCTGATGGAACtcgctgatgacgtcatcgacgaAAACT
CGCCGTTAATCTCACCCACCTCCAATACATTGAACAAACATCATGAGTTT
GCGGCGCGCACCAATCGGACGCTTGAACGTTCTATGAGTCACGACGCATA
CCATCCTCGACTGCGTTCTATCTTGAAACGTTCGAAAAGCGACGGTGCTG
CAAACACTACGGATactgatgatgacgtcataccTCATCGAGCGCGCGCT
ACTACTTACTCAGACGGTCATACTTACTTATCGGATGTCGAGAACGACTT
TTCACGACGTCGGAATAAATCGGTGAGTTTTCAAGACGAGCCGATTGTTT
TTGAGTTTACCAAAATGACGAAATGGCAGTGGAAGCGACAAGAATTaaag
aaagcaaagaaaaagaaatcgaaaGCAAAGAACGGAACGAGTTCCGATCA
AACGGCATCCTCGGCGGATGAAGAAGAATCTTCAGCTGTTACCTctcaag
aagaagaaaaacttgACAAACCGAGCGAAGAAAAACCGCCCCAAAAACAC
GGCCGAAAATGGAAGAAAGCGCAAAAGAAACGAAATCGGAACAACTCGGA
AAGCCGGTCAACCGAAGAAGAAACTGAGCAGACGAACAACGGACAGAAGA
AAGACAAACGGAAAAAGAAGAATAAGAAGAACAAAAACCAAGTTGAAGAT
GATTCTTCAAATGAAAGCAAACTGACTCTCAGCAATCCCTTGATTTTCCA
ATTAGATTGAATGGCGGATACTGCGGAAGATTTCAAAATGACGGATGATG
AAGCTCGTCGGATCAAACAAGCACTTAAAGACAAAGAATTCATGGACTTG
CTGGTAGAATATGCAAAAGAAATTTCTGATCCCGAAAATAAGAAGAAATA
CGAGGAAGAGATCGTTGCGATGGAGCGACAAAGAGGTCAAGATGTTCGGC
TGCTCAAACCACAGTCTGGTTTTGTGATAAAGACAGTACGATTATCAGAC
AATATGAAAGTCTTTTTGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTA
TGAATTGCAGCATGTGAAAGGAGGCGCCAACCTCTCCTTACCGCATTCTG
TGTCTCCTGTACGTGAAGACATCGACAAAGGTGGAAAGGCGTGTATTGTT
TATGATGTTTGTTTCAATCCCAAATCATACGATAAAGGAATGAAGGAATC
GAATTTCCGCCAGTCGATGGTGGACTCAGCGTTCGATACAATTGAGCGTC
AGATGAACATCAAACTCGATCGTAAAAACAAGAAGTTTCCGAAATTGAAG
TACAAAGGACAAGCCCGACCACTGATCATTCGACCGGAACAGCAATCACA
GCAAAAGACTTCTCCAAAGGATGACAAAAACTCTAAGACTGAAAAAGACA
GCCCTTTGGATTTTCGATATCCCGATATTCAAAAGGAAAATAAGGCCACG
GAAGAAAAAACTGGAAAGGATAAAGAATCGGAAAAATGCACGAAAAGGAC
GGTTATTGACGAAGGGAAGCCGGTAGTTCCGAAGTACAAAATCGTCCACA
GAGGTTTCTTTGAAATGACTGATTACACTGGGGGAAGttTATCCTCGACT
ACACCAAAAGAGCTGGTTGTGGAAATTGAGCTTCCCTTAGCTaaatcagC
AAATGGTTTGGATTTGGACATCTTTGCACAACAATTGATTTTAGACTCAG
AGAAACCGTCTTATCACTTGGATATTTCTCTGCCGCATAAAGTTGACGAG
GACCGCGGAAAAGCTCAATTcgataaatccaaaaaagtGTTGATCGTCAC
GCTACCCATTTTGAAAGCTGAACCCGTTACCATGGTACCCAATCCTCCAT
CGCGATTGGTTGAAGAATGCGTGGATGAGAAAGATGTGATTCATAATGGC
GGTCATTCACCGGATAGCGGTATTGATGAGATGTGTAACCATCATCAAAA
TGACGAAGAAGATGCAGAAGTTGTGGAGGATGCAGATGAATGTGTTTTTC
AACCAAGTGATCTCGACAACGCTGTCTTTGAAACCAAAAACTTCGAAAGT
ATGCCAATGAATGCACAACTGCCACAATATTCGTTCGACCAGACAATAGA
GAGTGTTGTTGTCGCAGTGAAAGTACCCAATGTTAAAGTGGAAAACATCT
CTCTCGGTATCACACACCAACAGGTCTGTCTGAGTTTGCCACAAGACGCT
TCTGACATCAACTCGCCAGATTGGAGCTTAGTCATTCGTTTGGATGACCG
ATATTATCTCGAAAAAGACGATTGCGGTTTCGATATTTTACCTGACCGAA
TggaattgaatttgaaaaagaagaaaagtgaATTGTGGGATCGCATGTTC
ATTGGGGTTTCTGAATCTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGC
CACAACTTCAGGCATCGTTGAACAATTGAAAGCTTTGAATGTGGATAAGC
TTCCACGAGCAGAGGTCGGTGATGTAGAAGAACGCAAAGTGGCGGATATG
GAAAGACGTTTGGAACAACTgctaaatgaagaagaaaagagtAAAATTGA
CGAAGAGACGTATGAGAGATGTTCAAATCGAGATGTTGCACGTCTGAAAA
CAGAGAGTTTTTCGGAAGGCAGCGATCTTGATTACCGACATGTCGACCTG
ATGGAACtcgctgatgacgtcatcgacgaAAACTCGCCGTTAATCTCACC
CACCTCCAATACATTGAACAAACATCATGAGTTTGCGGCGCGCACCAATC
GGACGCTTGAACGTTCTATGAGTCACGACGCATACCATCCTCGACTGCGT
TCTATCTTGAAACGTTCGAAAAGCGACGGTGCTGCAAACACTACGGATac
tgatgatgacgtcataccTCATCGAGCGCGCGCTACTACTTACTCAGACG
GTCATACTTACTTATCGGATGTCGAGAACGACTTTTCACGACGTCGGAAT
AAATCGGTGAGTTTTCAAGACGAGCCGATTGTTTTTGAGTTTACCAAAAT
GACGAAATGGCAGTGGAAGCGACAAGAATTaaagaaagcaaagaaaaaga
aatcgaaaGCAAAGAACGGAACGAGTTCCGATCAAACGGCATCCTCGGCG
GATGAAGAAGAATCTTCAGCTGTTACCTctcaagaagaagaaaaacttgA
CAAACCGAGCGAAGAAAAACCGCCCCAAAAACACGGCCGAAAATGGAAGA
AAGCGCAAAAGAAACGAAATCGGAACAACTCGGAAAGCCGGTCAACCGAA
GAAGAAACTGAGCAGACGAACAACGGACAGAAGAAAGACAAACGGAAAAA
GAAGAATAAGAAGAACAAAAACCAAGTTGAAGATGATTCTTCAAATGAAA
GCAAACTGACTCTCAGCAATCCCTTGATTTTCCAATTAGATTGAATGGCG
GATACTGCGGAAGATTTCAAAATGACGGATGATGAAGCTCGTCGGATCAA
ACAAGCACTTAAAGACAAAGAATTCATGGACTTGCTGGTAGAATATGCAA
AAGAAATTTCTGATCCCGAAAATAAGAAGAAATACGAGGAAGAGATCGTT
GCGATGGAGCGACAAAGAGGTCAAGATGTTCGGCTGCTCAAACCACAGTC
TGGTTTTGTGATAAAGACAGTACGATTATCAGACAATATGAAAGTCTTTT
TGAACATTTGCAGCAGCCCTGAAGTGAAGGAGTATGAATTGCAGCATGTG
AAAGGAGGCGCCAACCTCTCCTTACCGCATTCTGTGTCTCCTGTACGTGA
AGACATCGACAAAGGTGGAAAGGCGTGTATTGTTTATGATGTTTGTTTCA
ATCCCAAATCATACGATAAAGGAATGAAGGAATCGAATTTCCGCCAGTCG
ATGGTGGACTCAGCGTTCGATACAATTGAGCGTCAGATGAACATCAAACT
CGATCGTAAAAACAAGAAGTTTCCGAAATTGAAGTACAAAGGACAAGCCC
GACCACTGATCATTCGACCGGAACAGCAATCACAGCAAAAGACTTCTCCA
AAGGATGACAAAAACTCTAAGACTGAAAAAGACAGCCCTTTGGATTTTCG
ATATCCCGATATTCAAAAGGAAAATAAGGCCACGGAAGAAAAAACTGGAA
AGGATAAAGAATCGGAAAAATGCACGAAAAGGACGGTTATTGACGAAGGG
AAGCCGGTAGTTCCGAAGTACAAAATCGTCCACAGAGGTTTCTTTGAAAT
GACTGATTACACTGGGGGAAGttTATCCTCGACTACACCAAAAGAGCTGG
TTGTGGAAATTGAGCTTCCCTTAGCTaaatcagCAAATGGTTTGGATTTG
GACATCTTTGCACAACAATTGATTTTAGACTCAGAGAAACCGTCTTATCA
CTTGGATATTTCTCTGCCGCATAAAGTTGACGAGGACCGCGGAAAAGCTC
AATTcgataaatccaaaaaagtGTTGATCGTCACGCTACCCATTTTGAAA
GCTGAACCCGTTACCATGGTACCCAATCCTCCATCGCGATTGGTTGAAGA
ATGCGTGGATGAGAAAGATGTGATTCATAATGGCGGTCATTCACCGGATA
GCGGTATTGATGAGATGTGTAACCATCATCAAAATGACGAAGAAGATGCA
GAAGTTGTGGAGGATGCAGATGAATGTGTTTTTCAACCAAGTGATCTCGA
CAACGCTGTCTTTGAAACCAAAAACTTCGAAAGTATGCCAATGAATGCAC
AACTGCCACAATATTCGTTCGACCAGACAATAGAGAGTGTTGTTGTCGCA
GTGAAAGTACCCAATGTTAAAGTGGAAAACATCTCTCTCGGTATCACACA
CCAACAGGTCTGTCTGAGTTTGCCACAAGACGCTTCTGACATCAACTCGC
CAGATTGGAGCTTAGTCATTCGTTTGGATGACCGATATTATCTCGAAAAA
GACGATTGCGGTTTCGATATTTTACCTGACCGAATggaattgaatttgaa
aaagaagaaaagtgaATTGTGGGATCGCATGTTCATTGGGGTTTCTGAAT
CTTCTTTGAAAATGGAGGTGTTTTTGGTGGACGCCACAACTTCAGGCATC
GTTGAACAATTGAAAGCTTTGAATGTGGATAAGCTTCCACGAGCAGAGGT
CGGTGATGTAGAAGAACGCAAAGTGGCGGATATGGAAAGACGTTTGGAAC
AACTgctaaatgaagaagaaaagagtAAAATTGACGAAGAGACGTATGAG
AGATGTTCAAATCGAGATGTTGCACGTCTGAAAACAGAGAGTTTTTCGGA
AGGCAGCGATCTTGATTACCGACATGTCGACCTGATGGAACtcgctgatg
acgtcatcgacgaAAACTCGCCGTTAATCTCACCCACCTCCAATACATTG
AACAAACATCATGAGTTTGCGGCGCGCACCAATCGGACGCTTGAACGTTC
TATGAGTCACGACGCATACCATCCTCGACTGCGTTCTATCTTGAAACGTT
CGAAAAGCGACGGTGCTGCAAACACTACGGATactgatgatgacgtcata
ccTCATCGAGCGCGCGCTACTACTTACTCAGACGGTCATACTTACTTATC
GGATGTCGAGAACGACTTTTCACGACGTCGGAATAAATCGGTGAGTTTTC
AAGACGAGCCGATTGTTTTTGAGTTTACCAAAATGACGAAATGGCAGTGG
AAGCGACAAGAATTaaagaaagcaaagaaaaagaaatcgaaaGCAAAGAA
CGGAACGAGTTCCGATCAAACGGCATCCTCGGCGGATGAAGAAGAATCTT
CAGCTGTTACCTctcaagaagaagaaaaacttgACAAACCGAGCGAAGAA
AAACCGCCCCAAAAACACGGCCGAAAATGGAAGAAAGCGCAAAAGAAACG
AAATCGGAACAACTCGGAAAGCCGGTCAACCGAAGAAGAAACTGAGCAGA
CGAACAACGGACAGAAGAAAGACAAACGGAAAAAGAAGAATAAGAAGAAC
AAAAACCAAGTTGAAGATGATTCTTCAAATGAAAGCAAACTGACTCTCAG
CAATCCCTTGATTTTCCAATTAGATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000600XLOC_000600Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001060-exon-sc0000007-1491911889:1166492..1166545TCONS_00001060-exon-sc0000007-1491911889:1166492..1166545Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1166492..1166545TCONS_00001060-exon-sc0000007-1510915933:1166492..1166545Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1166492..1166545TCONS_00001060-exon-sc0000007-1575043694:1166492..1166545Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1166681..1166776TCONS_00001060-exon-sc0000007-1491911889:1166681..1166776Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1166681..1166776TCONS_00001060-exon-sc0000007-1510915933:1166681..1166776Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1166681..1166776TCONS_00001060-exon-sc0000007-1575043694:1166681..1166776Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1166947..1167015TCONS_00001060-exon-sc0000007-1491911889:1166947..1167015Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1166947..1167015TCONS_00001060-exon-sc0000007-1510915933:1166947..1167015Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1166947..1167015TCONS_00001060-exon-sc0000007-1575043694:1166947..1167015Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1167200..1167365TCONS_00001060-exon-sc0000007-1491911889:1167200..1167365Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1167200..1167365TCONS_00001060-exon-sc0000007-1510915933:1167200..1167365Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1167200..1167365TCONS_00001060-exon-sc0000007-1575043694:1167200..1167365Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1167524..1167588TCONS_00001060-exon-sc0000007-1491911889:1167524..1167588Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1167524..1167588TCONS_00001060-exon-sc0000007-1510915933:1167524..1167588Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1167524..1167588TCONS_00001060-exon-sc0000007-1575043694:1167524..1167588Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1167739..1167820TCONS_00001060-exon-sc0000007-1491911889:1167739..1167820Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1167739..1167820TCONS_00001060-exon-sc0000007-1510915933:1167739..1167820Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1167739..1167820TCONS_00001060-exon-sc0000007-1575043694:1167739..1167820Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1168373..1168437TCONS_00001060-exon-sc0000007-1491911889:1168373..1168437Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1168373..1168437TCONS_00001060-exon-sc0000007-1510915933:1168373..1168437Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1168373..1168437TCONS_00001060-exon-sc0000007-1575043694:1168373..1168437Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1168584..1168828TCONS_00001060-exon-sc0000007-1491911889:1168584..1168828Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1168584..1168828TCONS_00001060-exon-sc0000007-1510915933:1168584..1168828Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1168584..1168828TCONS_00001060-exon-sc0000007-1575043694:1168584..1168828Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1168985..1169039TCONS_00001060-exon-sc0000007-1491911889:1168985..1169039Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1168985..1169039TCONS_00001060-exon-sc0000007-1510915933:1168985..1169039Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1168985..1169039TCONS_00001060-exon-sc0000007-1575043694:1168985..1169039Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1169454..1169534TCONS_00001060-exon-sc0000007-1491911889:1169454..1169534Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1169454..1169534TCONS_00001060-exon-sc0000007-1510915933:1169454..1169534Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1169454..1169534TCONS_00001060-exon-sc0000007-1575043694:1169454..1169534Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1169730..1170054TCONS_00001060-exon-sc0000007-1491911889:1169730..1170054Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1169730..1170054TCONS_00001060-exon-sc0000007-1510915933:1169730..1170054Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1169730..1170054TCONS_00001060-exon-sc0000007-1575043694:1169730..1170054Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1170380..1170504TCONS_00001060-exon-sc0000007-1491911889:1170380..1170504Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1170380..1170504TCONS_00001060-exon-sc0000007-1510915933:1170380..1170504Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1170380..1170504TCONS_00001060-exon-sc0000007-1575043694:1170380..1170504Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1171166..1171369TCONS_00001060-exon-sc0000007-1491911889:1171166..1171369Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1171166..1171369TCONS_00001060-exon-sc0000007-1510915933:1171166..1171369Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1171166..1171369TCONS_00001060-exon-sc0000007-1575043694:1171166..1171369Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1171680..1171751TCONS_00001060-exon-sc0000007-1491911889:1171680..1171751Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1171680..1171751TCONS_00001060-exon-sc0000007-1510915933:1171680..1171751Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1171680..1171751TCONS_00001060-exon-sc0000007-1575043694:1171680..1171751Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1172185..1172283TCONS_00001060-exon-sc0000007-1491911889:1172185..1172283Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1172185..1172283TCONS_00001060-exon-sc0000007-1510915933:1172185..1172283Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1172185..1172283TCONS_00001060-exon-sc0000007-1575043694:1172185..1172283Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1172805..1172859TCONS_00001060-exon-sc0000007-1491911889:1172805..1172859Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1172805..1172859TCONS_00001060-exon-sc0000007-1510915933:1172805..1172859Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1172805..1172859TCONS_00001060-exon-sc0000007-1575043694:1172805..1172859Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1491911889:1173003..1174367TCONS_00001060-exon-sc0000007-1491911889:1173003..1174367Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1510915933:1173003..1174367TCONS_00001060-exon-sc0000007-1510915933:1173003..1174367Clytia hemisphaericaexon
TCONS_00001060-exon-sc0000007-1575043694:1173003..1174367TCONS_00001060-exon-sc0000007-1575043694:1173003..1174367Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001060-proteinTCONS_00001060-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1166492..1174367 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
6.43873 6.09512 4.19823 2.51654 40.8116 31.0206 32.4915 34.6543 21.4254 23.9955 17.781 17.4113 14.1931 15.5527 17.3449 19.7685 21.4725 19.7353 10.7735 10.8416 14.5675 16.4204 15.3319 17.2641 21.0296 23.7876 7.81193 7.45861 8.83185 9.63719
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007052CS_dom
IPR008978HSP20-like_chaperone
IPR012981PIH1_dom
IPR034727Kintoun
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Biological Process
TermDefinition
GO:0070286axonemal dynein complex assembly
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0070286 axonemal dynein complex assembly
cellular_component GO:0005737 cytoplasm
Blast
BLAST of TCONS_00001060 vs. Swiss-Prot (Human)
Match: KTU (Protein kintoun OS=Homo sapiens GN=DNAAF2 PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 7.422e-59
Identity = 121/359 (33.70%), Postives = 194/359 (54.04%), Query Frame = 1
Query:   19 ADTAEDFKMTDDEARRIKQALKDKEFMDLLVEYAKEISDPENKKKYEEEIVAMERQRGQDVRLLKPQSGFVIKTVRLSDNMKVFLNICSSPEVKEYELQHVKGG-------ANLSLPHSVSPVREDIDKGGKACIVYDVCFNPKSYDKGMKESNFRQSMVDSAFDTIERQMNIKLDRKNKKFPKLKYKGQARPLIIRPEQQSQQKTSPKDDKNSKTEKDSPLDFRYPDIQKENKATEEKTGKDKESEKCTKRTVIDEGKPVVPKYKIVHRGFFEMTDY--TGGSLSSTTPKELVVEIELPLAKSANGLDLDIFAQQLILDSEKPSYHLDISLPHKVDEDRGKAQFDKSKKVLIVTLPIL 1068
            + + ED  ++ +E +R+  A +D EF  +  +YA+E++DPEN+++YE EI A+ER+RG +VR + P+ G V++T  L    + F+N+CS+  V     +   GG       ++ SLP+S++P RE   +     +VYDV F+P +     +   FRQ +  +A + +E+Q  +KLDR+N K  K KYKG     ++R          P D +      D P  ++YP        +  +                 +  P  P+Y +V R   ++ DY  +  S  S  P ELV+ IELPL +SA    L++  + L LDS KP Y L +SLP+ VD+ RGKAQF+K+++ L+VTLP++
Sbjct:    7 SSSLEDLDLSGEEVQRLTSAFQDPEFRRMFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRT-SLDGARRCFVNVCSNALVGAPSSRPGSGGDRGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFHPDALALARRHEGFRQMLDATALEAVEKQFGVKLDRRNAKTLKAKYKGTPEAAVLRTPLPGVIPARP-DGEPKGPLPDFPYPYQYPAAPGPRAPSPPEAAL--------------QPAPTEPRYSVVQRHHVDLQDYRCSRDSAPSPVPHELVITIELPLLRSAEQAALEVTRKLLCLDSRKPDYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPVV 349          
The following BLAST results are available for this feature:
BLAST of TCONS_00001060 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KTU7.422e-5933.70Protein kintoun OS=Homo sapiens GN=DNAAF2 PE=1 SV=... [more]
back to top