Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001060-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001060-protein
Unique NameTCONS_00001060-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length877

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001060-protein ID=TCONS_00001060-protein|Name=TCONS_00001060-protein|organism=Clytia hemisphaerica|type=polypeptide|length=877bp
MADTAEDFKMTDDEARRIKQALKDKEFMDLLVEYAKEISDPENKKKYEEE
IVAMERQRGQDVRLLKPQSGFVIKTVRLSDNMKVFLNICSSPEVKEYELQ
HVKGGANLSLPHSVSPVREDIDKGGKACIVYDVCFNPKSYDKGMKESNFR
QSMVDSAFDTIERQMNIKLDRKNKKFPKLKYKGQARPLIIRPEQQSQQKT
SPKDDKNSKTEKDSPLDFRYPDIQKENKATEEKTGKDKESEKCTKRTVID
EGKPVVPKYKIVHRGFFEMTDYTGGSLSSTTPKELVVEIELPLAKSANGL
DLDIFAQQLILDSEKPSYHLDISLPHKVDEDRGKAQFDKSKKVLIVTLPI
LKAEPVTMVPNPPSRLVEECVDEKDVIHNGGHSPDSGIDEMCNHHQNDEE
DAEVVEDADECVFQPSDLDNAVFETKNFESMPMNAQLPQYSFDQTIESVV
VAVKVPNVKVENISLGITHQQVCLSLPQDASDINSPDWSLVIRLDDRYYL
EKDDCGFDILPDRMELNLKKKKSELWDRMFIGVSESSLKMEVFLVDATTS
GIVEQLKALNVDKLPRAEVGDVEERKVADMERRLEQLLNEEEKSKIDEET
YERCSNRDVARLKTESFSEGSDLDYRHVDLMELADDVIDENSPLISPTSN
TLNKHHEFAARTNRTLERSMSHDAYHPRLRSILKRSKSDGAANTTDTDDD
VIPHRARATTYSDGHTYLSDVENDFSRRRNKSVSFQDEPIVFEFTKMTKW
QWKRQELKKAKKKKSKAKNGTSSDQTASSADEEESSAVTSQEEEKLDKPS
EEKPPQKHGRKWKKAQKKRNRNNSESRSTEEETEQTNNGQKKDKRKKKNK
KNKNQVEDDSSNESKLTLSNPLIFQLD
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000600XLOC_000600Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001060TCONS_00001060Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR007052CS_dom
IPR008978HSP20-like_chaperone
IPR012981PIH1_dom
IPR034727Kintoun
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Biological Process
TermDefinition
GO:0070286axonemal dynein complex assembly
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0070286 axonemal dynein complex assembly
cellular_component GO:0005737 cytoplasm
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 570..597
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 183..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 683..707
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 759..877
NoneNo IPR availableCDDcd00298ACD_sHsps_p23-likecoord: 281..349
e-value: 7.86957E-4
score: 37.5687
IPR007052CS domainPFAMPF04969CScoord: 438..476
e-value: 0.014
score: 16.3
IPR007052CS domainPROSITEPS51203CScoord: 435..530
score: 9.862
IPR008978HSP20-like chaperoneGENE3D2.60.40.790coord: 250..356
e-value: 1.5E-11
score: 43.8
IPR008978HSP20-like chaperoneGENE3D2.60.40.790coord: 435..610
e-value: 5.7E-10
score: 38.9
IPR008978HSP20-like chaperoneSUPERFAMILY49764HSP20-like chaperonescoord: 432..532
IPR012981PIH1 domainPFAMPF08190PIH1coord: 38..350
e-value: 6.5E-75
score: 252.9
IPR034727KintounHAMAPMF_03069Kintouncoord: 1..877
score: 15.329

Blast
BLAST of TCONS_00001060-protein vs. Swiss-Prot (Human)
Match: KTU (Protein kintoun OS=Homo sapiens GN=DNAAF2 PE=1 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 2.059e-60
Identity = 121/359 (33.70%), Postives = 193/359 (53.76%), Query Frame = 0
Query:    2 ADTAEDFKMTDDEARRIKQALKDKEFMDLLVEYAKEISDPENKKKYEEEIVAMERQRGQDVRLLKPQSGFVIKTVRLSDNMKVFLNICSSPEVKEYELQHVKGG-------ANLSLPHSVSPVREDIDKGGKACIVYDVCFNPKSYDKGMKESNFRQSMVDSAFDTIERQMNIKLDRKNKKFPKLKYKGQARPLIIRPEQQSQQKTSPKDDKNSKTEKDSPLDFRYPDIQKENKATEEKTGKDKESEKCTKRTVIDEGKPVVPKYKIVHRGFFEMTDYTGG--SLSSTTPKELVVEIELPLAKSANGLDLDIFAQQLILDSEKPSYHLDISLPHKVDEDRGKAQFDKSKKVLIVTLPIL 351
            + + ED  ++ +E +R+  A +D EF  +  +YA+E++DPEN+++YE EI A+ER+RG +VR + P+ G V++T  L    + F+N+CS+  V     +   GG       ++ SLP+S++P RE   +     +VYDV F+P +     +   FRQ +  +A + +E+Q  +KLDR+N K  K KYKG     ++R          P D +      D P  ++YP        +  +                 +  P  P+Y +V R   ++ DY     S  S  P ELV+ IELPL +SA    L++  + L LDS KP Y L +SLP+ VD+ RGKAQF+K+++ L+VTLP++
Sbjct:    7 SSSLEDLDLSGEEVQRLTSAFQDPEFRRMFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRT-SLDGARRCFVNVCSNALVGAPSSRPGSGGDRGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFHPDALALARRHEGFRQMLDATALEAVEKQFGVKLDRRNAKTLKAKYKGTPEAAVLRTPLPGVIPARP-DGEPKGPLPDFPYPYQYPAAPGPRAPSPPEAAL--------------QPAPTEPRYSVVQRHHVDLQDYRCSRDSAPSPVPHELVITIELPLLRSAEQAALEVTRKLLCLDSRKPDYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPVV 349          
The following BLAST results are available for this feature:
BLAST of TCONS_00001060-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KTU2.059e-6033.70Protein kintoun OS=Homo sapiens GN=DNAAF2 PE=1 SV=... [more]
back to top