Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001021 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001021
Unique NameTCONS_00001021
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3725

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001021 ID=TCONS_00001021|Name=TCONS_00001021|organism=Clytia hemisphaerica|type=transcript|length=3725bp
CCAATTTTTACTACATAATTCTGCCAGACTATAAGACtgatttatttctt
atttatttaCAATATTACTATAACCTTTCCCCTTTGTTAACTGCGACAAA
ACCACAAGTCTAACGTAGTAAAAGAACTATTCTCACTCTTGTTTAACATT
TTAACTTTAGAATACTCCAAGATACTCGTTTACAAACGACACACAACAAA
CAGAAAAGATTAATACTTACCTCGTGGACACAATAAACCCCATTACTATT
GACAGCGAGAAATGAAGGATTTTCTCCAACTTTGCTAGATGATACAAAAT
TCAAACGTGTTTCTTCTGGGGCTGACAAATTGATTGAAAGTTTGAATAAT
TCAATCgtttcaccaaaaccaccaacaaGCACTGAgcaattcattttttc
ttttttcgaatatGCAGCGCGCCTCTTCAGCTATCCTCCTCTCAAAATGA
TAGAAAAGTCACAGCTATTACTTTTGCAAGAACTAAAACAACAAATGGTC
AATAGGAAATGTTGAGGGGCGATCATAGATTTACACACAGCTTTAGGCCC
TGAACTCATCtcaactgccagccagccagttCTCTAACCCTTCTACGTTC
TGTTCTGTTCAACATTTTTAACCTCAGCCAAACGTAGCCACAAAGACAAG
TACAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAA
GTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCAG
CGATATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGT
TCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGT
TGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCT
GCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATTT
TGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAA
TTAACCCATTGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGTT
GATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAATT
CAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCCT
TCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGTC
AATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATA
CCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGAC
TTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATG
CTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAAT
CACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTA
TTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTC
TTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATATC
TAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATA
AAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACATC
AAATACATTGAAGATTATATGAAAGCCAACaaccttttccgtgattacac
AAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTG
GCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTA
CCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGT
TGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTC
CTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTT
ATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGCT
GGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACAT
TACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTAC
TATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCGG
CATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTAC
CTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGT
GTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAAG
AGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTG
GTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAA
GGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCA
GGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATT
CGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGCC
TCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCACC
ATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCA
ATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACATC
TCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGG
GGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGTG
GTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGTC
AACAAATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTGG
AGATGAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaaa
gatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAGA
GATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGC
TGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTG
CTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACC
GGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTC
TATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCAC
GTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTC
AATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATTACTGGCCG
TTGGATCGGACTTGAGTAAAACGGAAAATATGCAGTTCGGATGGTGCGCG
TCCCGTTCTGTTTTTGAATAAAGATTTATTATTTAGTTTTTTTAGCAGCT
gggtaatttcaattttttaatttcaaaattttgatactgAACTGATACTT
agatttgttgttgttgttttcaatatttcagTCAAACGATGTCGATGTGA
AAGACAAGAACGGTCAACCTTTTTTTAGCCgctttttttcaatcaaacaa
TGAAACAGTTTTAAATTATTGCTAATATTATTTTGTgagttttgtagatt
ttttgaattttgtgaTACGAAAGAATAGCAAGGGACAACGAAATTACATC
ATGACTCCTTTttttaccaatgaaa
Run BLAST on NCBI

protein sequence of TCONS_00001021-protein

>TCONS_00001021-protein ID=TCONS_00001021-protein|Name=TCONS_00001021-protein|organism=Clytia hemisphaerica|type=polypeptide|length=894bp
MENDHAFEKCKSTLKSGETDYSYFDLSKLEDQRYGQLPFSIRVLLESVVR
NCDGFQVHQKDVETLLNWKETQHNGVEFPFRPARTLLQDFTGVPAVTDFA
AMRDAVNRLGGDPSKINPLTPADMVIDHSIQVDHFRSEDALMKNQELEFS
RNKERFQFLKWGSQAFKNLQIIPPGSGIVHQVNLEYLARVVFSEKGALYP
DSLVGTDSHTTMINGLGILGWGVGGIEAEAVMLGQVISMVVPKVIGYKIT
GTMNPIATSTDVVLTITKHLRQIGVVGKFVEFFGAGVASLSIADRATISN
MCPEYGATVGFFPVDKMSLEYLRQSGRTEEHIKYIEDYMKANNLFRDYTN
PEQDPVFTEIVELDLGSVVPSCSGPKRPHDRVPVSEMKTDFRSCLLNKVG
FKGFGIVEEKTETIAPFIYEGKEYTLKHGSVVISSITSCTNTSNPSVMLG
AGLLAKKAIESGLTTLPYIKTSVSPGSGVVTYYLKESGVDKYLEQLGFGI
VGYGCMTCIGNSGPLPEAVAEVIEKNDLVVCGVLSGNRNFEGRIHPLTRA
NYLASPLLVIAYALAGTVDIDFEKEPIGRTEEGKEVFLRDIWPSRQEIQE
MERKTVIPALFQEVYSKIQTGNPAWNNLETSASLLYPWESSSTYIQPPPF
FNEMTLVVPEVESIANAAVLLNVGDSVTTDHISPAGMISRTSPAARYLGG
LGLTPREFNSYGSRRGNYNVMARGTFANIRLVNKFMNKPGPKTKHWPSGD
EMDIFDAAERYIKEKRSLIILAGKEYGCGSSRDWAAKGPWMQGIKAVIAE
SYERIHRSNLIGMGIAPLQYLSGDTTESLGLTGKESFTIEYPENLGAGSM
VTVKVDDGRSFQVKARFDTDLEFVYYKNGGILNYMIRKIASSAE
Run BLAST on NCBI

transcript from alignment at sc0000007:761698..780652+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001021 ID=TCONS_00001021|Name=TCONS_00001021|organism=Clytia hemisphaerica|type=transcript|length=18955bp|location=Sequence derived from alignment at sc0000007:761698..780652+ (Clytia hemisphaerica)
CCAATTTTTACTACATAATTCTGCCAGACTATAAGACtgatttatttctt atttatttaCAATATTACTATAACCTTTCCCCTTTGTTAACTGCGACAAA ACCACAAGTCTAACGTAGTAAAAGAACTATTCTCACTCTTGTTTAACATT TTAACTTTAGAATACTCCAAGATACTCGTTTACAAACGACACACAACAAA CAGAAAAGATTAATACTTACCTCGTGGACACAATAAACCCCATTACTATT GACAGCGAGAAATGAAGGATTTTCTCCAACTTTGCTAGATGATACAAAAT TCAAACGTGTTTCTTCTGGGGCTGACAAATTGATTGAAAGTTTGAATAAT TCAATCgtttcaccaaaaccaccaacaaGCACTGAgcaattcattttttc ttttttcgaatatGCAGCGCGCCTCTTCAGCTATCCTCCTCTCAAAATGA TAGAAAAGTCACAGCTATTACTTTTGCAAGAACTAAAACAACAAATGGTC AATAGGAAATGTTGAGGGGCGATCATAGATTTACACACAGCTTTAGGTAA ACAATAATTAGGGCTTTAACAACAAAAGcgaataaaaaatcaaagtacTT TTAGCCAATTAACTAATGAATGAGTTATTTCTAATAAATGTGAATAATGA ACATCGATCTTTACTTGAATAAacataaataagaaaaaaaatcttatccG ATATTAATTAATTCTCTGCTTACAAATCTTAAACCAAAGTTCCTGAATCA TATGACATCTTTTTGTACCTTCGTCTGTTTTGTCACGTCAGTTTAACTCG AAAAGGAGCCTTTTTCCCTAATATAACTTTTCTACTCATATCATGCTTTT AGTTTTTTCTAGTTTCGATTTCAATGTTATGATCACGTGtccaaattttt ttgtttacatctaTAAGAGGCTATATACACTAAATAAAAAACTATATCGT TAAAGTGTAGACAAAGTCTTAAAAAATACTAAATTTACTGACTAAAATAC TGCATATTTTTTTCTCTGCATTTACAAAATATTGCATTCAAACTCCCttg attttaaaataatattgttttaaacatttaaaaaatatttgtgcTGTTGT TGAGTTTAGTTTGATTCAAACTTCAAATATATGAACAGGTGTTTTTGAAG CTGTTTTTTACACAATGATAGTAGGCATTTTTGCGGACGTAAAAGGACGG ATTTAATTGCGATATATGACTTTGCATTGCACATTTTCCAGGCCCTGAAC TCATCtcaactgccagccagccagttCTCTAACCCTTCTACGTTCTGTTC TGTTCAACATTTTTAACCTCAGCCAAACGTAGCCACAAAGACAAGTACAA TGGAAAATGGTAATAttactttttaacttttagcTTTCTATCACTTGTTA GAGTAAAGTCACATAATCAGTCCGTCACAAAGTGCcatataccgtaagtt ggtctaatgtcgacatccctcttctaatttcgacatccttctttagagat aggaatataggaaggtcggaatcactgatggacTCCTTAACTGATTGCTG AGCAAAAGAAAATaagtttcaatcagcgattctgaccttcctatgCTTTC TATCcttaaagaaggatgtcgaaattagaagagggatgttgacattagac caacttacggtagctaaacaaaactcaacatccttactaaagttgtcttt ttgatttcccaaacattcgtctcaagctttcacttccacaataatttatg taattgcaatttctgtcagtccacagtcgggttcaacatatACGTGTGTT CTTAttcacgtgaccgaagtgcctactaaaacaatagaccttttttcaaa gaggacgtcctgtcagttagtcacactagcgtcccgccaaaatgcatatc aaagattaatgctgcgaaagcgctatatcgtttacttcactctcaaacaa aaaaatgcgccgcaaaacttctaaagggattcatgaaaaaataacccggc gcattttaatgaaattaacattttcaaaaactttgagaaattgcctaaaa tttgagccatagctgaaaaaatttgagccaagccaaccttgaaaactaat ttgaagatcaacttcacaaaaaaaagatctacgggggaggcggaacccac ctagatccgcacaCCGCCcgataggctatttcccagaaattttgccggac ctcaaacaatgacccatttacatgtgcggaattatttttactttagcgta taaacaaggccttatcagtatagacctaactgttcatacaaaaattacgg gaaacgcatatttggactttgtaccctatgctgcactcaagcacttaagc caaagtcccgcaaaggcgggaNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtgttagatct gacaaattgatgtttgtaagtgcactttatagttttgattcccgttgaag aatcatattctggttttcatgttattagatgctgcttgagagctttaggt ctacactgcttataaatcgaagcgctgtctcgggaattgaatgataaaat ttggttggttgatatttggctgctgcacgtttcaaactttcaagttttaa ttaattgtcttgcaaacttcattcaggtaactctcatccttgttgtgcaa atacatcctgtagatgactgatgctgttttttctgaaagctagatttcct agtgtgactaactgcctgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtt gaataattatgtagtccagccataaaagcaatgatagagccatgtataat tactgtatcatgcatattgtaataattatgcatggtcttatcattgtttt tctgctggactacataattattcaacagggtggcctctttgaaaaaaggt ctataagggggtaagtggcgaagcaacatAATAGTATAGatagcagatta ttcgtaaagtaaagaaatatcttttggcacaGACAATCAATATAATATAt tgtaccgtgagaggtcctaaatccgacaccactgcctaaatcTGATGGAG TCTTTCACAAatatacaaactaaaataaaaacaaacctttcgctgtgacg caacaaagataccaaagtgtcaacttaGCTGAGAGATTTGaaacactgaa ccaattgaaccaaataacaataattgcttcttataacaaaagatattttt ttattgcaatatgcacaacgtcataaatgacaacagtaataacagcatca taaaaagtaatgagatgttttgattttccaaagcacacacacgaaaatat aaaagaggtctgtgtacgagcgtgctcattttgaaacgttacgtaatcaa gcctggtttttattactttacactggcacttggcttgattgcgggccttc cgttgcaatttagtctgtttgtttcttgatggaaaccagcccaagttgtt tcatatttttcccgcacaagtcacttttattacaaaactgttatcgtttt aaacatgagcaactgatccagaataaaaggtaattatttttaNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN aattttttttcataacagttatttggcaGGCTTCagcataagaaaaaaga aggcgtgtgatcatcgcacgcctagatagtaatttttaataatttaggCG TGCAAGTCATCACACGCCTCATTTGCTTTAGACTTGCGATTGCAGTGCga tcgttttttattttataaacatcATTAATATTGATGAGgcacaaattttt gaaaaatttctaagaATGATCTTTCTTTTATTTACATTAAGTATTATTGA AGTAGACCTATCACTTCAAGACGTTTATTTTCTGCTTCGTACTTTTTTCT GGATATAGATAGAACCTACACCTGATCTTCTTCACCATTGATAATCTAGT CATTATATTTTATGGTAGTTGATTTTAAAACAAGAGGACAAAAGaatcaa taacatgaaaacaaaaaattgttattGAAGAAGTAAAAAGTTTTGTCTAA AATAAATCAAGCCTTACTAATTGTTCCTTTTGATTCTATTGATTTAGCAT TTGTATTATTCAACTGTTTCATTAATATTAAAAATGTGAATTGTTGAAAC AAAGCACAGCCATTAGATTTTACCTCgcagaaaaaaatataattgttttg TATGAATGCGAGTTATTCATTTCGCTTATAAGAAATTTTGTATACATATA ACAGCTTGAATGAGTAAAGGAAAGTTTATCTTTCATCTATTTGGTTTTTA TGATTAAAGtagaaaataatatttgatcttctttcaacaagggctgcaaa taagcgtcggtCATTGGTCAATGTCTGACTGAAAAAGCCATTTGAccaac tgaaaatcttttgtgtcggtcatgatgtccgaataaaaaaaggaataaac cattaacttgagatttgaaaataaatctcttacatccctgtctcttactt agcctatttttttaatactcgcttcctttgtagctttcaagagtgtttct aagatcacttttatcaactcgctttcttcgaaactttcaagagtgtctca aagttaacttttatcaactcgctttcttcgtaactttcaagggtgtttct aagaccACTTTAATCAATtcactttcttcgtaactttcaagggtgtttca aagttaacttttatcgactcgctttcttcgtaactttcaagagtgtttct aagatcacttttatcggcttgctttcttcgtaactttcaagggtgtttca aagttaacttttatcgactcgctttcttcgtaactttcaagagtgtttct aagatcacttttatcggcttgcttacttcataactttcaagagtgtttca aagttaaccttgatcgactcgctttcttcgtaactttcaagagtgtttct aaggtCACTTTCATCAAATTACTTACTTCATAACTTACTGAACAAgcaga aaaaagatttttagaataaatttttaCACGTGCGATTGATCGCACGCTTG ACTAGATTTTCATAATTTATGGCGTGTGATAAATTGCACACACCTAAAAG GCTTTTAGGCGTGTACGGAGGCGCGCGCGTGCGTTCGCACGCCTCATATG CCGAAGCCtgtttggggggtcggaattaggcagtggtgtcggatttagga cctctcatgGTATTATATtgccttaattcaaaaatgaataaaccagcaga ggctggaaggtcagccaatagagcttagctagatagctttaataagtggg ttaacagatgtaagagatgtactgaaacagagtagactaaatatGTNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Ntaaataagaaaattgccaaaacgtcagaaccaaaataaagatatccatc aaatatacatagaaactgtactttttgttttacttgataaaaccccaata acactttcaactaacaagctacaaactttaagtcacaaagcgcaaactcc agaaaaacaaaatttgcataaaaaactttgcaaaacgtagttcatattta taacatttcaacaggaactgtattttggtagacttggtcaaattacagaa accatttgtcagttgcTTGGAAGGCCAATGAGGcacgtaaaaactgactg ctattcagtcaaagccaaaatttggcaaggttagaaaaacataatttgcg TCCAGAACTGTTGAacaaattgtttatttttttaatcattcaaagtaaaa aagcCATTTGTTGTAACTTTCTGCAATTCCactaaaaacaagtgatacat ttatggacctacctgaatgaaaaatgaacatGTGAacaattcctatgatt caatcccgagaaaagttggtaacagacgaacggacggacagacgaacgaa cacaggttaatttataggacctccaggtacaGTGGGGCTTTCGCATGTCT TTACGTGTGCGCGAGGCTCGCGCGCTACGAGTACAAAATGTATAGGTGTT AGAAATCCAATTTATTCAGACTCGTTCAATGCGAGTGCTTTTGATTTCCC TCCCAACACTCAACTCGTACCTTTTATAAAAGGCCTATTTAGTTTAGTAT AATAAGTACGTGCTATTCAACCGCTGATTAATAGGAAAGCAAAgctattt attttgaattaataGGGAAGCGAGTGAGTATTTTACTGACGTTTTATATT TCAAAGCCTCCTATCTTAAGTAAAGAAGATACAGCTGAAACATTTGTGAA AAGTCTTTTatttattgaataattaaaGCGTCCAAAAGATGAGATAAACA ATATCCAGGGTTTCAATTATAGCTTCGCACTTTTAGATTTTAGCGACCCA AAACGATattaaattaatgaaaaaaccATTAATGATCAATTGATACTCAA TATTTTAGAAAAGGCTTGATTACATATCGATAGATCTTTTTCTAAACTCA ATACTACTCAATGTCAGCGTCTGCGCACCAAGCTTAAAAGTACACATGCA AACATTAGGttacaaagttttaaaatgtcAAATATCCTAGCGATTGTTTA TGTACTCTTTTAGCCTAGCGAGTGGTGGTCACTAGTATAGCAAAATCAAT AGATTAAAATTAGGCGCTAAGAAGTTGATCTACTATCAGGCTATCATGTG GAGTCATTAGGTAGTGTTTTTTTGCCGCtaattaccgtaagttggtctaa tgtctaCATACCTCATCTTATCCAGATACCCtcctttagagataggaata gtaggaaggttggaatcactgattgaaactaCCGACACTGCTGTCATTTG CGTTTCAGATTTTATCCTTAAAGAGTTAGGAAAGGGTAAATATGTTGGAG CTGTACTTGTTGATCTCAAAAAGGCTTTCGACACTGTAGACCACCACATA CTCCTAAAGAAGCTTTTATGTTACGGATTTCGGGATGTCTCCCTTGAATG GTTTCAGTCGTATGTTAGTGACAGACTCCAGTGCACCCTCCTTGAAAACA CCATATCTGATTTATCGAAAGAAAATCCTTTTGGTGTTCCCCAAGGATCA GTACTAGGACCTCTTCTGTTCTTACTGTATATAAATGATATAGGAGATTG CATTAAATCTGGCACTTTTTACCATCTCTATGCTGACGACACAATAATCA TCAAGAGTGCTGACGACCCTGACTTATTACGCTCTGGTCTGATGCGTCAA CTCTCAGATCTTGGTCAGTGGTTCTATGGATGTAAACTCTCAGTTAACAC CTCTAAAACTGAAGTCATCTTCTTCGGTAGATCCAAGAAACTTGAGGAAT GCAAGTCTGTTCCTCCTCTCAGATTTCTAGGTGATGCTATAGACTCTAAA AAGGAGGTGAAATATCTATGTGTCGTATTTGACGAAAACATGACCTGGGA TGAGCAGGCTAAAAGGGTCCGAAGCAAAGCTTATCTTGCCTTAAACAGGA TAAAACGGATTTCATCTCTTCTAACAGATGATACTAAAAAGCTATTAACC AACGCTCTTGTCATGCCTCATGTCAATTACTGTTCCAACTCTTGGAGTGC TATGTCAGCTGCAAATCGGAATAAATTCTAATCTTTAATGCGTAACGTTA ATCGACTAGCTCTAAACAGAACTTCCCAACAAATGGCAGAGATTAACAAA GCCATTATGATGTTCAAAGGCATTCACAAAATTGCACCGAGCTACCTCTG TAACGAGGTGAATCTCGTCAGTGGCAGACATCAGAGAACAAGGTTTGCTG CTGAAAACAATGTTGTGGTGCCTTTATCTAAGACNGACCGATTGATCACA AACGATattaaattaatgaaaaaaccATTAATGATCAATTGATACTCAAT ATTTTAGAAAAGGCTTGATTACATAtcgatagaccttttgctaaaCTCAA TACCACTCAATGTCAGCGTCTGCGCACCAAGTTTAAAAGTACACATGCAA ACATTAGgttacaaagttctaaaatgtCAAATATCCTAGCGATTGTGTAT GTACTCTTTTAGCCTTAGCGAGTGGTGGTCACTGGTATAGCAAAATCAGT AGATTAAAATTAGGCGCTAAGAAGTTGATCTACTATCAGGCTATCATGTG GAGTCATTAGGTAGTGTTTTTTGCCGCtaattaccgtaagttggtctaat gtctaCATACCTCATCTTATCCAGatacccttctttagagataggattag taggaaggttggaatcactgattgaaactaTATTCTTTGCTTAGTGCAAC CATAAGAAAAAACCTTTTGTCAACCTTcccattattcctatctctTAAAT CACTCACTTTTTCCTAAGGAAATTTTaccatttctttattttttgatgat CAAATAATTAGGTGCTACTCATTAAGAAACACTAGGACTATTGTGTAAGG ATTACAACTGAAAAATATCCGTTCTGACAGAATAAACTAGTCTCTGGCCA CTCCTGGTCTACCAGACTAAACTAGTCTCTGGTCCAATATTTTAAGTTGA AGTAAGATTTATTGGAGGTCATTCTAAGGAGAGCCATCCAAACTCAATTT CCGTTTTCCACAGTAAATGTTGATTGGACGTTTAGAGCAGTGCTGGGCTG TAGGTTGTGGATGTTTATTcgtaaaaatatcaatattagAGAAGCTATGT TACTTTTTTAGTATcgccaaatttttgtttttcatgtttcTTTTCGATCA GTTATTTATTTGCTCGTTTTTTTCTTTGCTGCTACATGTCACTAAGAAAG ATGATAAACTTTTTGTAGGATGTGATGTAATTTTAATAATTCCAGTATAA TGAAAAGAACAAGCAAGAACATATTTAAGTAAGCCTGTGTACTGaatatt ttcttatcattgaCATGACGTTGTGTCCTACAAAAGGCCTATTAATTCCA AGAATTTATGCCAAAATTATTCTTTAACTATACACTTAGAAAATATACGA GTAGTAGGTAGTagtaaaaagagagaaaaaacaacagaaaattgcacttt tcatatttttctttcattattgTTTAAGATCATGCTTTTGAGAAATGCAA GTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAGCA AACTTGAAGATCAGCGATATGGTAAGTTTTATATTTCtagatcaaatttt cttttagaattttaaCCTAGTGATGTAATGATAATTATATGAGGCTAAAC CTCTCGAGCCTCCAgtcaacaaaataaattatcTTGTTTTTTATCATAGG ACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATT GTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGG AAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAAC ACTTTTGCAAGATTTCACGTAAGAACACAATGATATCTTGATTCTTAATC TCAACTATTAtattaaaaagtattttaatGTTCTGATTCAAAGACCTACC AGGTGGGCCACAAAGAATTTTCTCAAGCAGTTAGTACCGTGTACTAACAG GCAtaatgtcttgtactaactccATGCCCCTGTTATGACATTTTCATTTG ACCCGGCTGAAAATTTTCACACTTTTCAGCtagtaatttaaaattttttt gattttagtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGC TGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTG CTGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAGGTTT TTTGATTACTATATAAATGCtaacattttttgaaagcaATTCCAATACTT GTCATTAGTTTTATTTAAGATATGATGGAAGTTGATCATGTGATATTGAT TTTTTAGACTTTTGAAACTgatcagagcctttggaataTCTCTTAAGTTT CGGTTCTACTACCTCTAGTTTAATGTGTTTCATTTAACCAACAATTCTTC ATGTTTCCAAATAAATGATATTTCCACTAGTTCTTTTTCCAATTAACAAA TTGTTTTTGTGAGTGATATCCAGCACACTTTTGCTTCATTCTCTTACAGT GAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGA ACGATTCCAATTTCTCAAGGTATCTTtatcagaaaaatattaaaaaattg ttgtACTTCTTTAAAGTCTTCTCCCTTTTGTATGTGTGTaatgaatttcc tttttttccagtggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCG CCTGGATCTGGGATTGTACACCAGGTAAATATGCCCATCAAACTGCCGAA AAGTGCTCATGTTTTAACTATGAAGCTCAATTTGTTTTGAACATTGGCTT TGTcgtatcttccttcgtttcgagcatAAAACTACCCTTCGGGATATGCG cgctgctcttgttttgaatattgaatttttccaaATACATCGCATGCGTT TTTAATGAATTAATAGAGAGCTTTGAAACCcaagccaatcagctgttttT AAAACAACGTTTATTATCAACacgaaaaatatgagcaatttgattggcta aaaacgtgtacataaatgctgtatttcatattgtactgtacaaatacaag accgcgttcaaaaaaggggcctggtaagcgagagatcatattttgtacaa ttttatgATTAGAAAGGTTTTCTCTTCGCTTCCAATacacaaaaaattat caaaagattttttgaaaagaatgttttgatctttttaatgaccattcgat tcttatttcgaatgttttgatgttgatttcatctaaataaaagtaaaaga ataaaatattggaagagaaaaacaaaacaaagagagacacaaatggagag agaaaagtttgttgacatttttcaagttgatgataaactagttatcacac ttttactCGTACCTGTATAGGATATAGTTTTCTATATTATGACGAAAAAT GtaaactcgaaaaatatatacCATATTGTACTCGGTACCATGTGATAACT ATTACGTAAATTGACTAAGAtaataacaattttaaaagattttaaaagct cTTGTGTTGTAACTTTAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTT CAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTC ACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGGTAAGTAAGCT CGTTTGACAAgctattttttgtttaagttaaTCNTCACACCACAATGATC AATGGGCTTGGTATCTTAGGATGGGGTAAGTAAGCTCGTTTGACAAgcta ttttttgtttaagttagTCAAAGCTGAAAATGTCTTTTTTGTACTATGAA CAAGTAAGGAACATTTCTGACAAATTGATGACAAAGCAGAGTGCTTTTTC CTGCTTTGTTTATTACAATAGTAAATAGTAAATAGAATGTAAATAAGACA ACTTTCAAAACCTTATAGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATG CTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAAT CACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTA TTACTAAGGTGAGTAGATTCGATCCATCCAAATTTTAGGTTTGCTAAAGT TTACTTTCAGTGGATTAATTTCGGCGgggattaaattaaattaaatcccT GCAAAATTTAACGCAAATAATATCATGTGAAAGTCACATCTAATTTTCAT CCAGTTTGGTGTTCCAAAATTCCCAATTCACTAAATTAAGACCCCACCTA AAATCGTATATTTACCAATCGCCAAAttccacgccaaaattaatccattt AAGGTATCCGTTTTGTAGATACTTTTGCAAGCGCAGTAAATAGGGTCATA TAATTGATTTCTTCTATATCTCGAATAAAATACgtattcaaaattaaaat ttcaaatagcaGCCTTTCCTTCATCAActtttaactttctttttaattta caTCTTTTCAATCAAATTAGATAATTTTTCCAACGAGAACGAAACTAAAG ATGTCGATGTTTTTCTTTCAGCATTTAAGGCAGATCGGTGTGGTTGGAAA GTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATC GTGCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTC TTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTATGGT TGATGTTTTACATCGAATACTCCCGGAAATTCTTACCAGTTTATGATGTA GACTGAAAAAATCAGTCGTTCTGTCCTGACCAATTTAAAAACaacgaaaa ttttcttttaaaacttcaaaGTTCAAGAAATGACCAGAAAAACTATGTGA GACTATGACTTGATAGTTGATAGTGCTTTTCTTGTCGCTCGATCGCGTAC ATTATTCGGTAATTCGATCTTTGTTTAAAATCAACTATAGGTCGAACTGA GGAGCACATCAAATACATTGAAGATTATATGAAAGCCAACaaccttttcc gtgattacacAAATCCTGAACAAGACCCCGTCTTCACCGAGGTATTATAT TTAATCCTTACTGACAAGTTTATTCGAAGAAATTCTTGCAAGAAACTACT TTTTTTGTGATTCGTTCTCTTAGATCGTGGAACTTGATCTTGGCAGTGTT GTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTC CGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCA AAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATT TACGAAGGAAAAGAGTACACTCTCAAACACGGTAATTTCTATGACATCGT TTATCTATTATAAAATTTCTTTACGAGTAATGCGTCAGTAATTTATagtt tcaaaacattttaaagttattttaagCAGTCTAAGTCCATATACACGagt gttcttttttcaaattcaggcTCGGTGGTTATCTCTTCGATCACCAGTTG TACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCA AGAAAGCTATCGAATCTGGGTTGACCACATTACCATACATCAAGACCAGT GTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGT TGATAAATACCTCGAACAATTAGGGTAATTCATTTTGACTCATCTTAAGT TTTTAAAACACCATTTGCAAACCGTTTACGGTTTTACCATTTAGGTAATC GTCGACAGGGTTTGTCAAGTTCGTAAAATCAGTGTAAAAGAATGGCTGTT ACTCAGTGAAGACTATTTCTCCCCACATTGACAAAATTGAGTTCTAAGCG TAGACTTTGTAGCTAACTAGGAGTGCTAATAGCCATAATGACATTACCCA ATATATTTAGACGAATTTATAACACTACTTTTCAGCTAATGATATTCTTC TCTCTCCCTTTCAGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTAT TGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGG TAACTTGAAATCTTTTCATTATATATGCAAATTTATTCCTATAAGACATG AAATCATAAGTCCTATGATTGATGCCAGTTTTTTGAGTGAAGCAACCCTG AGGAACTCGATGGAAATCGTAATATCCTCTTGTTAGAGCAAAATTGGAAA CTCGCGCCTATTTCAACAGCTATAAAATTAAAGCAAAGTCAGTCTTTTGG AAACCATTGCCGTTTGAGCTTGGCAAGCAGTTCTTGTCTCCTTAGTTTAT CGCTTTGCTAGTTACTGTAATTTTCTCGCACAGAACGATCTTGTTGTGTG TGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGA CAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTG GCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGGTAAGATGAA ACGTTGCACTTTTTACTTCTATTTCTCAATAAGCATGGTCTCCGTCTGGC TAATAAGGTTCCACTTTTTTGTGTTGACAGACAATTATAGAGATAACAAT AACAAAGTTAGCTGATCGAGTTAGTAGCCTTTGTCACATGTTCAAGTATT CAACAAATTTGCTTTTGGAAAAATNCGTTAGCTGATCGAGTTAGTAGCCT TTGTCACATGTTTAAGTATTCAACAAAtttgcttttggaaaaataatcgt tctatatttttttacgtttttaggtAGAACGGAGGAAGGCAAAGAAGTCT TCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGTGAATATTTTT ATTAGCACAtaatattttttccctacacTGTAATATTTTTATCTCGACTT AATTATGTGCTTTTTTCCGTAGGAAATGGAACGAAAAACTGTCATCCCAG CCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGG AATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTC AACTTATATTCAACCCCCACCATTCTTTAATGAAATGGTAAGAATCTCAT TTTAAATATGATGTATTTTATCTCTTCAGATCTTCGAAATTCTTTTGTCT AAGCTTATTTTTCGTGCTGCACTGAGAAGTACCAACAAATACCTTAAGTA GattaattttgacgaatttggcGAAATGTAAAAAACTCGTCAAATTAATA TCCgaagtaaaatttaaaaaatcggccattcgccaaattaaatccccact AAACTTAACCAAAAGATTAATACGCATAGCGATATACATAGCGATTCTCA TGTACATTACTGACTTCAATCTCcccattcgccaaatttaatccccgcca aaaatcgtattttgacCAAATATCAAATGAAATCTGCGCCAAAATTAAAA GTTGGTagtcaaatttcataaatttttctcCAGACACTTGTTGTACCAGA AGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAG TCACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCT GCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTC TTACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTG CAAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACT AAACATTGGCCTTCTGGAGATGAGGTAAATTTAAATAACTTTCCATTTGC AAATATTTAATTTCGACTAATTGCCCCAATCTAACCATATTACGTCCCTC TTAAACCagctactttaatcgtagaaattttagcgagactaattttagcg tatattagcgagtcagaaaaatctagattttttttggatttattttagtg aatcacgatttcaaaaaatttctcgtggataaattttagcgaatactcgt attacattattgactgaattcgttttctagcatttctttgcactgaaact cTTTCTATTGATAAagatgtatcaaggcaatataaccagaaatttcgcgc ggataaattttagtgatctgtcgattcggcgtgttttagcgagatttatt ttagcgaaaatagggaaaactcgctaaaacgctaaaattagtctcgctaa aatttctacgattaaagtaaatGTTTGCACGGAAGAACCTACAATTCTTG TTCTTTTAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaa aagatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAA GAGATTGGGCTGCTAAAGGTCCATGGATGCAGGTATGTGCGTACTCATAT AATCCAATAACCATGATGACACGTCTTCTCGGTTTCCTTAAATCTGAAAT TAATCAGCAGTAAAATGGAacagttttcttataaatataCCTTTAATCTA TTCTCCATAGCTATGAATCTCAAAAACCTGTTTAATGTAGATGAATTTAG TATTCGGCACTTCATAGAAACAACAAATCATGGAATTTCAGTAGAAATTG TTAGCACAATGCAACTTTATCTTTTTAGGGCATCAAAGCAGTGATCGCTG AGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCT CCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGG TAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTA TGGTGACTGTCAAGGTAAGTGTTTCATTTCTACATATTTTCTAAACGAAT CGTGCGAGTGTGAACTTAAAGAGAAAAAACTCTATCGAAACTACACACCA TTTTctgatgcattgctctgatttCTCCGATGATAGACATGTAatgtttg acagccttcttcaacttgacatatGCTTGGTACCATTAAACCCAAGAAGA CTTTCCAGAATACTTCTCTTTGGGGATTTGAATTTTAGTAACAACCTAAA TCATGATATATTAAGTATAACCGTAAACTTTATCCAAGATACCGGTCGAT TCGAGGGtccgttgttttgatttttcacaatgctcatttagtttgttttt tgtttttccttacctttctattgtttttttttcctcgTTTCTCTTTTTAT AAGGTTCCTCTCTCCTGGCGGTATAATCTAGCGGTTTTTTGCGGGAGGGC TGGAGCCTTTTAGTGTTTGTATTCTATGTTCGTGCCattacttataaata aaaagaaataaaaagcttCAATCTGATTATTTGCAATGAAGCGAGTACAT TCGTTCCaatgttgtcttctgaccagctGCCTTTGGAAAACAACAAATCC GGCGACCCTCAAACTCGCAATTTGCTGAACTATTGAGCTACGGGCCATGT AATATATATCCAAAAGGAAAAACTCATGATTAAATATGGctaatgacaaa aaattaacgacTAATAACTTTCTCCCATCCTTGTACTACCAGCCAGAATC CCTTCTATGTTCAATAAATCCTTAATTTGATACATATCAGATACTATCAG TTTCTGTCAACGGAAAGTAAATGTATTTATCTTTTATCATCTGTAGGTTG ATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAG TTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGAT CGCTTCTTCAGCTGAGTGAATTACTGGCCGTTGGATCGGACTTGAGTAAA ACGGAAAATATGCAGTTCGGATGGTGCGCGTCCCGTTCTGTTTTTGAATA AAGATTTATTATTTAGTTTTTTTAGCAGCTgggtaatttcaattttttaa tttcaaaattttgatactgAACTGATACTTagatttgttgttgttgtttt caatatttcagTCAAACGATGTCGATGTGAAAGACAAGAACGGTCAACCT TTTTTTAGCCgctttttttcaatcaaacaaTGAAACAGTTTTAAATTATT GCTAATATTATTTTGTgagttttgtagattttttgaattttgtgaTACGA AAGAATAGCAAGGGACAACGAAATTACATCATGACTCCTTTttttaccaa tgaaa

Coding sequence (CDS) from alignment at sc0000007:761698..780652+

>TCONS_00001021 ID=TCONS_00001021|Name=TCONS_00001021|organism=Clytia hemisphaerica|type=CDS|length=53700bp|location=Sequence derived from alignment at sc0000007:761698..780652+ (Clytia hemisphaerica)
ATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGG
TGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGAT
ATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGA
AATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAA
CTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTA
GAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCG
GCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAA
CCCATTGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATC
ATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGT
AGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAA
AAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATT
TGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCA
GATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGACTTGG
TATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTG
GTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACT
GGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTAC
TAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCG
GGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAAC
ATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAAT
GAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAAT
ACATTGAAGATTATATGAAAGCCAACaaccttttccgtgattacacAAAT
CCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAG
TGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAG
TCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGT
TTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTT
CATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCT
CTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGT
GCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACC
ATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATC
TAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATC
GTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGA
AGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTC
TATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCA
AATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTAC
TGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCA
AAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAA
ATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAA
GATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTC
TTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTC
TTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGC
AGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCC
CTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGC
CTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAA
TTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACA
AATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGAT
GAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatC
GCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATT
GGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAG
AGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCC
GCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTA
AAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATG
GTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTT
TGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATT
ACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCAT
GCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTC
ATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCAT
TCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTT
CAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACA
GCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAG
ATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCT
GTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGC
TGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAG
ATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGA
TTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTAT
CCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTC
GAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGT
ACTGATTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGG
TGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTA
TGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCT
ATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCA
GATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAA
GTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTAT
GGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTT
AAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATA
TGAAAGCCAACaaccttttccgtgattacacAAATCCTGAACAAGACCCC
GTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATG
CTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAA
CTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGA
ATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAA
AGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTT
GTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCC
AAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACATCAAGACCAG
TGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTG
TTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGT
ATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGT
AATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTA
ACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCA
CCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTT
CGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGC
GCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACT
GTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAA
CCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGG
AATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAATGACA
CTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAA
TGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCT
CCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCA
AGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGC
ACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAAC
CAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTC
GATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGC
TGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTC
CATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATT
CACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATC
CGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTA
TTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTT
GATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGA
GTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGA
TCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGC
AAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAG
CAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTT
TACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaa
gatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGA
ATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTAC
CCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGA
GGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGA
TCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAA
ACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAG
tggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGG
GATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTG
AAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACC
ACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGA
AGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAG
TTATTGGATATAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACT
GATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGG
AAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCG
ATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGC
TTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCG
AACTGAGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAACaacc
ttttccgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATC
GTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACG
TCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTT
GTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAA
ACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAA
ACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTA
ATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAA
TCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATC
AGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCG
AACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGA
AACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGA
TCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTA
TCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATC
GCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAAT
CGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCAT
CAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTG
TTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAA
CTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTT
ATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAA
GTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGT
CACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTG
CTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCT
TACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGC
AAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTA
AACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGA
tacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGG
ATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCA
TCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTG
ATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGA
AAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAA
ATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCG
TTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAA
AAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTG
AGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAA
AGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCA
GCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCG
TTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTG
TTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACC
TGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATT
TTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAA
ATTAACCCATTGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGT
TGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAAT
TCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCC
TTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGT
CAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTAT
ACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGA
CTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGAT
GCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAA
TCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACT
ATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTT
CTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATAT
CTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGAT
AAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACAT
CAAATACATTGAAGATTATATGAAAGCCAACaaccttttccgtgattaca
cAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTT
GGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGT
ACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAG
TTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCT
CCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGT
TATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGC
TGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACA
TTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTA
CTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCG
GCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTA
CCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGG
TGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAA
GAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCT
GGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGA
AGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTC
AGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTAT
TCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGC
CTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCAC
CATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCC
AATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACAT
CTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTG
GGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGT
GGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGT
CAACAAATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTG
GAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaa
agatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAG
AGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCG
CTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATT
GCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGAC
CGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTT
CTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCA
CGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCT
CAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATG
ATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGAC
TATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATT
ACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATG
GTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAG
ACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTT
GCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGG
ACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACA
CCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAG
TGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAG
AACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAA
ATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTT
GGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAG
TTGGTACTGATTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGA
TGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCAT
CAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGA
ACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTA
AGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGT
GGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAG
AGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAA
TACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGA
TTATATGAAAGCCAACaaccttttccgtgattacacAAATCCTGAACAAG
ACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCA
TCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAAT
GAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTT
TCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAA
GGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCAC
CAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGT
TAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACATCAAG
ACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAG
CGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATG
GTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCT
GAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAA
CCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGG
CTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATC
GACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTT
CTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAA
AAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACT
GGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCC
TTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAA
TGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTA
TTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAAT
GATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGA
CGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTG
ATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAA
CAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACA
TATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATT
TTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAA
AGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAAC
GTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATAC
TTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTT
CACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCA
AGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGAT
CTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCG
AAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGA
AATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGAT
TTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAG
AGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatc
aaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGA
GTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtgg
TGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGAC
TTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTC
ATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGAT
GAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTC
TCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGA
TCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTT
CAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTC
ACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGT
ATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACC
CAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCTATTGCTACCT
CCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTG
GTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGAT
TGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTG
TTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCA
GGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAA
CaaccttttccgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCG
AGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCA
AAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAG
GAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAG
AAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACT
CTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACAC
AAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTA
TCGAATCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCT
GGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATA
CCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTA
TTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAG
AACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGG
ACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCG
TTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAA
CCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTG
GCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAG
CCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGG
AATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTC
AACTTATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTAC
CAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGAT
TCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAG
TCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCA
ATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACT
TTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAA
AACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCG
AGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAA
TACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCA
GGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTA
ACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACT
ACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCC
AGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTC
GATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTAC
TACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTC
AGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCT
TGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAA
GATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATC
AGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaa
cATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTC
AGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTAC
TGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTT
CAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGATCACTCCATC
CAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACT
TGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcAC
AAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACAC
CAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGC
TTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCA
ATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCA
GTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATA
TAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCC
TCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTC
GAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGAC
CATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTG
TTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAG
CACATCAAATACATTGAAGATTATATGAAAGCCAACaaccttttccgtga
ttacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTG
ATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGAT
CGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAA
CAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGA
TCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCG
GTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGT
CATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGA
CCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTG
ACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGG
TTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTC
CTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTG
TGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTT
GACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTT
TGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACG
GAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGA
AATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAG
TTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACC
AGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACC
CCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCA
TCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGAT
CACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTA
TCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCAC
GACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGA
TTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCC
TTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaag
aaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCA
TCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGT
GATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGG
GTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGT
TTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGC
TGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGA
AAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGC
ATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGA
AAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAA
CGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGA
CAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTG
TGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGA
AAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACA
CTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAAT
GAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCAT
TGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTC
AGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAA
TAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACC
TTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAA
TATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTC
TCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGACTTGGTATCT
TAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAA
GTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTAC
TATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGC
ATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCT
GGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTG
TCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTT
TGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATT
GAAGATTATATGAAAGCCAACaaccttttccgtgattacacAAATCCTGA
ACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTG
TCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCC
GAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAA
AGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTT
ACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCG
ATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGG
CTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACA
TCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAA
GAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGG
ATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTG
TCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCT
GGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTA
TTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTG
ATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAA
GTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGA
ACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTC
AGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTT
TACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAA
TGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAG
TCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCT
GGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGG
ACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACA
ATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTC
ATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGAT
GGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCA
TTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCT
GCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTA
CGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTC
AATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAG
AGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGAC
TGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATA
CCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATG
ATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTT
TGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACT
TCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCT
ATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGT
TCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATA
ATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTC
ACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAA
CAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATA
TGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCA
CTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCA
ATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGC
CTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTT
GTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGA
TTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTG
GTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTG
GTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCTATTGC
TACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCG
GTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTG
TCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGC
CACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGAC
AGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATATGAAA
GCCAACaaccttttccgtgattacacAAATCCTGAACAAGACCCCGTCTT
CACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTG
GTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGAT
TTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGT
TGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGT
ACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACA
AACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAA
AGCTATCGAATCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCA
GCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGAT
AAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGAC
TTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCG
AAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTC
GAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCT
TCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAA
AAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGAC
ATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCAT
CCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAG
CATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCA
AGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGT
TGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTG
GTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGA
ACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGA
ATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTG
GTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGA
CCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGC
AGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCA
AAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGG
ATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCG
AAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTG
ATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAA
TATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGA
TGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTG
TTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCT
TCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTC
CACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAAC
TTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTG
GAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgt
tgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCC
CTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCA
GTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGA
TCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGATCACT
CCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAG
GAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtgggg
atcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTG
TACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAA
GGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAAT
GATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAG
AAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATT
GGATATAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGT
CGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGT
TTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGT
GCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTT
CCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTG
AGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAACaaccttttc
cgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGA
ACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCC
ATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTC
CTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGA
AACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACG
gcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCG
TCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGG
GTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTG
TTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAA
TTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAG
TGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTG
TTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCAT
CCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTA
TGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtA
GAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGA
CAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCA
AGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGG
AAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATT
CAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGA
AAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCA
CCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCA
CGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGG
CTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACA
TCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTAAACAT
TGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacat
caaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTG
GATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAA
GCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGG
GATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCC
TCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTG
GGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCA
AGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATG
GCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGA
ATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGG
TGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGAT
ATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGA
AATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAA
CTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTA
GAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCG
GCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAA
CCCATTGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATC
ATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGT
AGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAA
AAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATT
TGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCA
GATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGACTTGG
TATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTG
GTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACT
GGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTAC
TAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCG
GGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAAC
ATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAAT
GAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAAT
ACATTGAAGATTATATGAAAGCCAACaaccttttccgtgattacacAAAT
CCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAG
TGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAG
TCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGT
TTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTT
CATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCT
CTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGT
GCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACC
ATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATC
TAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATC
GTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGA
AGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTC
TATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCA
AATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTAC
TGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCA
AAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAA
ATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAA
GATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTC
TTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTC
TTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGC
AGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCC
CTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGC
CTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAA
TTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACA
AATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGAT
GAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatC
GCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATT
GGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAG
AGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCC
GCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTA
AAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATG
GTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTT
TGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATT
ACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCAT
GCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTC
ATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCAT
TCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTT
CAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACA
GCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAG
ATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCT
GTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGC
TGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAG
ATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGA
TTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTAT
CCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTC
GAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGT
ACTGATTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGG
TGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTA
TGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCT
ATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCA
GATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAA
GTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTAT
GGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTT
AAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATA
TGAAAGCCAACaaccttttccgtgattacacAAATCCTGAACAAGACCCC
GTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATG
CTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAA
CTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGA
ATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAA
AGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTT
GTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCC
AAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACATCAAGACCAG
TGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTG
TTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGT
ATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGT
AATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTA
ACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCA
CCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTT
CGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGC
GCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACT
GTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAA
CCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGG
AATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAATGACA
CTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAA
TGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCT
CCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCA
AGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGC
ACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAAC
CAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTC
GATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGC
TGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTC
CATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATT
CACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATC
CGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTA
TTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTT
GATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGA
GTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGA
TCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGC
AAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAG
CAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTT
TACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaa
gatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGA
ATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTAC
CCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGA
GGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGA
TCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAA
ACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAG
tggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGG
GATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTG
AAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACC
ACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGA
AGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAG
TTATTGGATATAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACT
GATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGG
AAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCG
ATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGC
TTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCG
AACTGAGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAACaacc
ttttccgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATC
GTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACG
TCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTT
GTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAA
ACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAA
ACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTA
ATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAA
TCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATC
AGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCG
AACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGA
AACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGA
TCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTA
TCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATC
GCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAAT
CGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCAT
CAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTG
TTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAA
CTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTT
ATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAA
GTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGT
CACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTG
CTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCT
TACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGC
AAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTA
AACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGA
tacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGG
ATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCA
TCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTG
ATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGA
AAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAA
ATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCG
TTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAA
AAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTG
AGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAA
AGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCA
GCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCG
TTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTG
TTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACC
TGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATT
TTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAA
ATTAACCCATTGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGT
TGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAAT
TCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCC
TTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGT
CAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTAT
ACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGA
CTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGAT
GCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAA
TCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACT
ATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTT
CTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATAT
CTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGAT
AAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACAT
CAAATACATTGAAGATTATATGAAAGCCAACaaccttttccgtgattaca
cAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTT
GGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGT
ACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAG
TTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCT
CCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGT
TATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGC
TGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACA
TTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTA
CTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCG
GCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTA
CCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGG
TGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAA
GAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCT
GGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGA
AGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTC
AGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTAT
TCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGC
CTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCAC
CATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCC
AATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACAT
CTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTG
GGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGT
GGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGT
CAACAAATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTG
GAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaa
agatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAG
AGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCG
CTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATT
GCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGAC
CGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTT
CTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCA
CGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCT
CAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATG
ATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGAC
TATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATT
ACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATG
GTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAG
ACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTT
GCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGG
ACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACA
CCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAG
TGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAG
AACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAA
ATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTT
GGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAG
TTGGTACTGATTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGA
TGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCAT
CAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGA
ACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTA
AGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGT
GGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAG
AGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAA
TACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGA
TTATATGAAAGCCAACaaccttttccgtgattacacAAATCCTGAACAAG
ACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCA
TCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAAT
GAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTT
TCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAA
GGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCAC
CAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGT
TAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACATCAAG
ACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAG
CGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATG
GTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCT
GAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAA
CCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGG
CTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATC
GACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTT
CTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAA
AAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACT
GGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCC
TTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAA
TGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTA
TTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAAT
GATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGA
CGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTG
ATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAA
CAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACA
TATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATT
TTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAA
AGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAAC
GTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATAC
TTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTT
CACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCA
AGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGAT
CTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCG
AAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGA
AATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGAT
TTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAG
AGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatc
aaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGA
GTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtgg
TGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGAC
TTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTC
ATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGAT
GAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTC
TCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGA
TCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTT
CAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTC
ACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGT
ATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACC
CAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCTATTGCTACCT
CCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTG
GTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGAT
TGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTG
TTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCA
GGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAA
CaaccttttccgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCG
AGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCA
AAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAG
GAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAG
AAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACT
CTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACAC
AAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTA
TCGAATCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCT
GGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATA
CCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTA
TTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAG
AACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGG
ACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCG
TTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAA
CCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTG
GCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAG
CCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGG
AATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTC
AACTTATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTAC
CAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGAT
TCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAG
TCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCA
ATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACT
TTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAA
AACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCG
AGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAA
TACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCA
GGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTA
ACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACT
ACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCC
AGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTC
GATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTAC
TACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTC
AGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTCCACCT
TGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAACTTGAA
GATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTGGAATC
AGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgttgaaa
cATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCCCTTTC
AGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCAGTTAC
TGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGATCCTT
CAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGATCACTCCATC
CAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAGGAACT
TGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtggggatcAC
AAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTGTACAC
CAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGC
TTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAATGATCA
ATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCA
GTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATTGGATA
TAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGTCGTCC
TCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTC
GAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGAC
CATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTG
TTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTGAGGAG
CACATCAAATACATTGAAGATTATATGAAAGCCAACaaccttttccgtga
ttacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGAACTTG
ATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCCATGAT
CGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAA
CAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGA
TCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACGgcTCG
GTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCGTCAGT
CATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGA
CCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTG
ACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAATTAGG
TTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAGTGGTC
CTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTG
TGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCATCCTTT
GACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTT
TGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtAGAACG
GAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGACAAGA
AATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAG
TTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGGAAACC
AGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATTCAACC
CCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGAAAGCA
TCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCACCGAT
CACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCACGTTA
TCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGGCTCAC
GACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACATCCGA
TTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTAAACATTGGCC
TTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacatcaaag
aaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTGGATCA
TCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGT
GATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGGGATGG
GTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCCTCGGT
TTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTGGGAGC
TGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGA
AAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATGGCGGC
ATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGA
AAATGATCATGCTTTTGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAA
CGGACTATTCATACTTCGATTTGAGCAAACTTGAAGATCAGCGATATGGA
CAATTACCATTCTCTATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTG
TGATGGTTTTCAAGTTCatcaaaaagatgttgaaacATTGTTGAACTGGA
AAGAGACACAGCATAATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACA
CTTTTGCAAGATTTCACtggTGTACCCGCAGTTACTGATTTTGCGGCAAT
GAGGGACGCTGTCAACAGACTTGGAGGTGATCCTTCAAAAATTAACCCAT
TGACACCTGCTGATATGGTCATCGATCACTCCATCCAAGTTGATCATTTC
AGAAGTGAAGATGCACTGATGAAAAACCAGGAACTTGAATTCAGTAGAAA
TAAAGAACGATTCCAATTTCTCAAGtggggatcACAAGCCTTCAAAAACC
TTCAAATTATCCCGCCTGGATCTGGGATTGTACACCAGGTCAATTTGGAA
TATTTGGCTCGAGTTGTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTC
TCTAGTTGGTACTGATTCTCACACCACAATGATCAATGGACTTGGTATCT
TAGGATGGGGTGTTGGTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAA
GTCATCAGTATGGTGGTACCCAAAGTTATTGGATATAAAATCACTGGTAC
TATGAACCCTATTGCTACCTCCACTGATGTCGTCCTCACTATTACTAAGC
ATTTAAGGCAGATCGGTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCT
GGCGTGGCAAGTTTGTCGATTGCCGATCGTGCGACCATATCTAACATGTG
TCCAGAGTATGGAGCCACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTT
TGGAATACTTAAGACAGTCAGGTCGAACTGAGGAGCACATCAAATACATT
GAAGATTATATGAAAGCCAACaaccttttccgtgattacacAAATCCTGA
ACAAGACCCCGTCTTCACCGAGATCGTGGAACTTGATCTTGGCAGTGTTG
TCCCATCATGCTCTGGTCCAAAACGTCCCCATGATCGAGTACCAGTCTCC
GAAATGAAAACTGATTTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAA
AGGTTTCGGAATCGTTGAAGAAAAAACTGAAACGATCGCTCCTTTCATTT
ACGAAGGAAAAGAGTACACTCTCAAACACGgcTCGGTGGTTATCTCTTCG
ATCACCAGTTGTACAAACACAAGTAATCCGTCAGTCATGCTGGGTGCAGG
CTTGTTAGCCAAGAAAGCTATCGAATCTGGGTTGACCACATTACCATACA
TCAAGACCAGTGTCAGCCCTGGATCAGGTGTTGTGACGTACTATCTAAAA
GAAAGCGGTGTTGATAAATACCTCGAACAATTAGGTTTCGGCATCGTTGG
ATATGGTTGTATGACTTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTG
TCGCTGAAGTAATCGAAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCT
GGTAACCGTAACTTCGAAGGACGTATCCATCCTTTGACAAGAGCAAATTA
TTTGGCTTCACCGCTTCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTG
ATATCGACTTCGAAAAAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAA
GTCTTCTTGCGCGACATCTGGCCATCAAGACAAGAAATTCAGGAAATGGA
ACGAAAAACTGTCATCCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTC
AGACTGGAAACCCAGCATGGAATAACTTGGAAACCAGCGCCTCTCTTCTT
TACCCTTGGGAATCAAGTTCAACTTATATTCAACCCCCACCATTCTTTAA
TGAAATGACACTTGTTGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAG
TCTTATTGAATGTTGGTGATTCAGTCACCACCGATCACATCTCCCCTGCT
GGAATGATCTCCAGAACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGG
ACTGACGCCAAGAGAATTCAATTCTTACGGCTCACGACGTGGTAATTACA
ATGTGATGGCACGTGGTACTTTTGCAAACATCCGATTGGTCAACAAATTC
ATGAACAAACCAGGACCTAAAACTAAACATTGGCCTTCTGGAGATGAGAT
GGACATATTCGATGCAGCCGAGAGAtacatcaaagaaaaaagatCGCTCA
TTATTTTGGCTGGCAAAGAATACGGATGTGGATCATCAAGAGATTGGGCT
GCTAAAGGTCCATGGATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTA
CGAACGTATTCACCGAAGTAACTTGATTGGGATGGGTATTGCTCCGCTTC
AATACTTATCCGGTGATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAG
AGCTTCACTATTGAATATCCAGAAAATTTGGGAGCTGGTTCTATGGTGAC
TGTCAAGGTTGATGATGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATA
CCGATCTCGAGTTTGTTTACTACAAAAATGGCGGCATCCTCAATTACATG
ATTCGAAAGATCGCTTCTTCAGCTGAGTGAATGGAAAATGATCATGCTTT
TGAGAAATGCAAGTCCACCTTGAAAAGTGGTGAAACGGACTATTCATACT
TCGATTTGAGCAAACTTGAAGATCAGCGATATGGACAATTACCATTCTCT
ATCAGAGTTTTACTGGAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGT
TCatcaaaaagatgttgaaacATTGTTGAACTGGAAAGAGACACAGCATA
ATGGAGTCGAATTCCCTTTCAGACCTGCTAGAACACTTTTGCAAGATTTC
ACtggTGTACCCGCAGTTACTGATTTTGCGGCAATGAGGGACGCTGTCAA
CAGACTTGGAGGTGATCCTTCAAAAATTAACCCATTGACACCTGCTGATA
TGGTCATCGATCACTCCATCCAAGTTGATCATTTCAGAAGTGAAGATGCA
CTGATGAAAAACCAGGAACTTGAATTCAGTAGAAATAAAGAACGATTCCA
ATTTCTCAAGtggggatcACAAGCCTTCAAAAACCTTCAAATTATCCCGC
CTGGATCTGGGATTGTACACCAGGTCAATTTGGAATATTTGGCTCGAGTT
GTGTTCAGTGAAAAAGGAGCTTTATACCCAGATTCTCTAGTTGGTACTGA
TTCTCACACCACAATGATCAATGGACTTGGTATCTTAGGATGGGGTGTTG
GTGGTATTGAAGCAGAAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTG
GTACCCAAAGTTATTGGATATAAAATCACTGGTACTATGAACCCTATTGC
TACCTCCACTGATGTCGTCCTCACTATTACTAAGCATTTAAGGCAGATCG
GTGTGGTTGGAAAGTTTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTG
TCGATTGCCGATCGTGCGACCATATCTAACATGTGTCCAGAGTATGGAGC
CACTGTTGGCTTCTTCCCTGTTGATAAAATGAGTTTGGAATACTTAAGAC
AGTCAGGTCGAACTGAGGAGCACATCAAATACATTGAAGATTATATGAAA
GCCAACaaccttttccgtgattacacAAATCCTGAACAAGACCCCGTCTT
CACCGAGATCGTGGAACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTG
GTCCAAAACGTCCCCATGATCGAGTACCAGTCTCCGAAATGAAAACTGAT
TTCAGGAGTTGTCTCCTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGT
TGAAGAAAAAACTGAAACGATCGCTCCTTTCATTTACGAAGGAAAAGAGT
ACACTCTCAAACACGgcTCGGTGGTTATCTCTTCGATCACCAGTTGTACA
AACACAAGTAATCCGTCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAA
AGCTATCGAATCTGGGTTGACCACATTACCATACATCAAGACCAGTGTCA
GCCCTGGATCAGGTGTTGTGACGTACTATCTAAAAGAAAGCGGTGTTGAT
AAATACCTCGAACAATTAGGTTTCGGCATCGTTGGATATGGTTGTATGAC
TTGTATTGGAAACAGTGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCG
AAAAGAACGATCTTGTTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTC
GAAGGACGTATCCATCCTTTGACAAGAGCAAATTATTTGGCTTCACCGCT
TCTCGTTATCGCTTATGCTTTGGCTGGTACTGTTGATATCGACTTCGAAA
AAGAACCAATCGgtAGAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGAC
ATCTGGCCATCAAGACAAGAAATTCAGGAAATGGAACGAAAAACTGTCAT
CCCAGCCTTGTTCCAAGAAGTTTATTCGAAGATTCAGACTGGAAACCCAG
CATGGAATAACTTGGAAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCA
AGTTCAACTTATATTCAACCCCCACCATTCTTTAATGAAATGACACTTGT
TGTACCAGAAGTTGAAAGCATCGCCAATGCAGCAGTCTTATTGAATGTTG
GTGATTCAGTCACCACCGATCACATCTCCCCTGCTGGAATGATCTCCAGA
ACGAGTCCTGCTGCACGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGA
ATTCAATTCTTACGGCTCACGACGTGGTAATTACAATGTGATGGCACGTG
GTACTTTTGCAAACATCCGATTGGTCAACAAATTCATGAACAAACCAGGA
CCTAAAACTAAACATTGGCCTTCTGGAGATGAGATGGACATATTCGATGC
AGCCGAGAGAtacatcaaagaaaaaagatCGCTCATTATTTTGGCTGGCA
AAGAATACGGATGTGGATCATCAAGAGATTGGGCTGCTAAAGGTCCATGG
ATGCAGGGCATCAAAGCAGTGATCGCTGAGAGTTACGAACGTATTCACCG
AAGTAACTTGATTGGGATGGGTATTGCTCCGCTTCAATACTTATCCGGTG
ATACTACGGAAAGCCTCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAA
TATCCAGAAAATTTGGGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGA
TGGTCGATCGTTCCAAGTGAAAGCACGTTTTGATACCGATCTCGAGTTTG
TTTACTACAAAAATGGCGGCATCCTCAATTACATGATTCGAAAGATCGCT
TCTTCAGCTGAGTGAATGGAAAATGATCATGCTTTTGAGAAATGCAAGTC
CACCTTGAAAAGTGGTGAAACGGACTATTCATACTTCGATTTGAGCAAAC
TTGAAGATCAGCGATATGGACAATTACCATTCTCTATCAGAGTTTTACTG
GAATCAGTCGTTCGAAATTGTGATGGTTTTCAAGTTCatcaaaaagatgt
tgaaacATTGTTGAACTGGAAAGAGACACAGCATAATGGAGTCGAATTCC
CTTTCAGACCTGCTAGAACACTTTTGCAAGATTTCACtggTGTACCCGCA
GTTACTGATTTTGCGGCAATGAGGGACGCTGTCAACAGACTTGGAGGTGA
TCCTTCAAAAATTAACCCATTGACACCTGCTGATATGGTCATCGATCACT
CCATCCAAGTTGATCATTTCAGAAGTGAAGATGCACTGATGAAAAACCAG
GAACTTGAATTCAGTAGAAATAAAGAACGATTCCAATTTCTCAAGtgggg
atcACAAGCCTTCAAAAACCTTCAAATTATCCCGCCTGGATCTGGGATTG
TACACCAGGTCAATTTGGAATATTTGGCTCGAGTTGTGTTCAGTGAAAAA
GGAGCTTTATACCCAGATTCTCTAGTTGGTACTGATTCTCACACCACAAT
GATCAATGGACTTGGTATCTTAGGATGGGGTGTTGGTGGTATTGAAGCAG
AAGCAGTGATGCTTGGTCAAGTCATCAGTATGGTGGTACCCAAAGTTATT
GGATATAAAATCACTGGTACTATGAACCCTATTGCTACCTCCACTGATGT
CGTCCTCACTATTACTAAGCATTTAAGGCAGATCGGTGTGGTTGGAAAGT
TTGTCGAGTTCTTCGGGGCTGGCGTGGCAAGTTTGTCGATTGCCGATCGT
GCGACCATATCTAACATGTGTCCAGAGTATGGAGCCACTGTTGGCTTCTT
CCCTGTTGATAAAATGAGTTTGGAATACTTAAGACAGTCAGGTCGAACTG
AGGAGCACATCAAATACATTGAAGATTATATGAAAGCCAACaaccttttc
cgtgattacacAAATCCTGAACAAGACCCCGTCTTCACCGAGATCGTGGA
ACTTGATCTTGGCAGTGTTGTCCCATCATGCTCTGGTCCAAAACGTCCCC
ATGATCGAGTACCAGTCTCCGAAATGAAAACTGATTTCAGGAGTTGTCTC
CTCAACAAAGTTGGTTTCAAAGGTTTCGGAATCGTTGAAGAAAAAACTGA
AACGATCGCTCCTTTCATTTACGAAGGAAAAGAGTACACTCTCAAACACG
gcTCGGTGGTTATCTCTTCGATCACCAGTTGTACAAACACAAGTAATCCG
TCAGTCATGCTGGGTGCAGGCTTGTTAGCCAAGAAAGCTATCGAATCTGG
GTTGACCACATTACCATACATCAAGACCAGTGTCAGCCCTGGATCAGGTG
TTGTGACGTACTATCTAAAAGAAAGCGGTGTTGATAAATACCTCGAACAA
TTAGGTTTCGGCATCGTTGGATATGGTTGTATGACTTGTATTGGAAACAG
TGGTCCTCTACCTGAAGCTGTCGCTGAAGTAATCGAAAAGAACGATCTTG
TTGTGTGTGGTGTTCTATCTGGTAACCGTAACTTCGAAGGACGTATCCAT
CCTTTGACAAGAGCAAATTATTTGGCTTCACCGCTTCTCGTTATCGCTTA
TGCTTTGGCTGGTACTGTTGATATCGACTTCGAAAAAGAACCAATCGgtA
GAACGGAGGAAGGCAAAGAAGTCTTCTTGCGCGACATCTGGCCATCAAGA
CAAGAAATTCAGGAAATGGAACGAAAAACTGTCATCCCAGCCTTGTTCCA
AGAAGTTTATTCGAAGATTCAGACTGGAAACCCAGCATGGAATAACTTGG
AAACCAGCGCCTCTCTTCTTTACCCTTGGGAATCAAGTTCAACTTATATT
CAACCCCCACCATTCTTTAATGAAATGACACTTGTTGTACCAGAAGTTGA
AAGCATCGCCAATGCAGCAGTCTTATTGAATGTTGGTGATTCAGTCACCA
CCGATCACATCTCCCCTGCTGGAATGATCTCCAGAACGAGTCCTGCTGCA
CGTTATCTTGGGGGCCTGGGACTGACGCCAAGAGAATTCAATTCTTACGG
CTCACGACGTGGTAATTACAATGTGATGGCACGTGGTACTTTTGCAAACA
TCCGATTGGTCAACAAATTCATGAACAAACCAGGACCTAAAACTAAACAT
TGGCCTTCTGGAGATGAGATGGACATATTCGATGCAGCCGAGAGAtacat
caaagaaaaaagatCGCTCATTATTTTGGCTGGCAAAGAATACGGATGTG
GATCATCAAGAGATTGGGCTGCTAAAGGTCCATGGATGCAGGGCATCAAA
GCAGTGATCGCTGAGAGTTACGAACGTATTCACCGAAGTAACTTGATTGG
GATGGGTATTGCTCCGCTTCAATACTTATCCGGTGATACTACGGAAAGCC
TCGGTTTGACCGGTAAAGAGAGCTTCACTATTGAATATCCAGAAAATTTG
GGAGCTGGTTCTATGGTGACTGTCAAGGTTGATGATGGTCGATCGTTCCA
AGTGAAAGCACGTTTTGATACCGATCTCGAGTTTGTTTACTACAAAAATG
GCGGCATCCTCAATTACATGATTCGAAAGATCGCTTCTTCAGCTGAGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000586XLOC_000586Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001021-exon-sc0000007-1491911889:761698..762243TCONS_00001021-exon-sc0000007-1491911889:761698..762243Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:761698..762243TCONS_00001021-exon-sc0000007-1510915933:761698..762243Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:761698..762243TCONS_00001021-exon-sc0000007-1575043694:761698..762243Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:762939..763056TCONS_00001021-exon-sc0000007-1491911889:762939..763056Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:762939..763056TCONS_00001021-exon-sc0000007-1510915933:762939..763056Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:762939..763056TCONS_00001021-exon-sc0000007-1575043694:762939..763056Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:771926..772018TCONS_00001021-exon-sc0000007-1491911889:771926..772018Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:771926..772018TCONS_00001021-exon-sc0000007-1510915933:771926..772018Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:771926..772018TCONS_00001021-exon-sc0000007-1575043694:771926..772018Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:772147..772315TCONS_00001021-exon-sc0000007-1491911889:772147..772315Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:772147..772315TCONS_00001021-exon-sc0000007-1510915933:772147..772315Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:772147..772315TCONS_00001021-exon-sc0000007-1575043694:772147..772315Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:772556..772693TCONS_00001021-exon-sc0000007-1491911889:772556..772693Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:772556..772693TCONS_00001021-exon-sc0000007-1510915933:772556..772693Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:772556..772693TCONS_00001021-exon-sc0000007-1575043694:772556..772693Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:772997..773066TCONS_00001021-exon-sc0000007-1491911889:772997..773066Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:772997..773066TCONS_00001021-exon-sc0000007-1510915933:772997..773066Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:772997..773066TCONS_00001021-exon-sc0000007-1575043694:772997..773066Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:773159..773221TCONS_00001021-exon-sc0000007-1491911889:773159..773221Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:773159..773221TCONS_00001021-exon-sc0000007-1510915933:773159..773221Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:773159..773221TCONS_00001021-exon-sc0000007-1575043694:773159..773221Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:774016..774136TCONS_00001021-exon-sc0000007-1491911889:774016..774136Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:774016..774136TCONS_00001021-exon-sc0000007-1510915933:774016..774136Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:774016..774136TCONS_00001021-exon-sc0000007-1575043694:774016..774136Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:774416..774555TCONS_00001021-exon-sc0000007-1491911889:774416..774555Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:774416..774555TCONS_00001021-exon-sc0000007-1510915933:774416..774555Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:774416..774555TCONS_00001021-exon-sc0000007-1575043694:774416..774555Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:775019..775190TCONS_00001021-exon-sc0000007-1491911889:775019..775190Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:775019..775190TCONS_00001021-exon-sc0000007-1510915933:775019..775190Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:775019..775190TCONS_00001021-exon-sc0000007-1575043694:775019..775190Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:775438..775538TCONS_00001021-exon-sc0000007-1491911889:775438..775538Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:775438..775538TCONS_00001021-exon-sc0000007-1510915933:775438..775538Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:775438..775538TCONS_00001021-exon-sc0000007-1575043694:775438..775538Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:775621..775828TCONS_00001021-exon-sc0000007-1491911889:775621..775828Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:775621..775828TCONS_00001021-exon-sc0000007-1510915933:775621..775828Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:775621..775828TCONS_00001021-exon-sc0000007-1575043694:775621..775828Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:775967..776171TCONS_00001021-exon-sc0000007-1491911889:775967..776171Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:775967..776171TCONS_00001021-exon-sc0000007-1510915933:775967..776171Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:775967..776171TCONS_00001021-exon-sc0000007-1575043694:775967..776171Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:776462..776546TCONS_00001021-exon-sc0000007-1491911889:776462..776546Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:776462..776546TCONS_00001021-exon-sc0000007-1510915933:776462..776546Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:776462..776546TCONS_00001021-exon-sc0000007-1575043694:776462..776546Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:776831..776987TCONS_00001021-exon-sc0000007-1491911889:776831..776987Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:776831..776987TCONS_00001021-exon-sc0000007-1510915933:776831..776987Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:776831..776987TCONS_00001021-exon-sc0000007-1575043694:776831..776987Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:777271..777335TCONS_00001021-exon-sc0000007-1491911889:777271..777335Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:777271..777335TCONS_00001021-exon-sc0000007-1510915933:777271..777335Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:777271..777335TCONS_00001021-exon-sc0000007-1575043694:777271..777335Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:777420..777584TCONS_00001021-exon-sc0000007-1491911889:777420..777584Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:777420..777584TCONS_00001021-exon-sc0000007-1510915933:777420..777584Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:777420..777584TCONS_00001021-exon-sc0000007-1575043694:777420..777584Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:777981..778271TCONS_00001021-exon-sc0000007-1491911889:777981..778271Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:777981..778271TCONS_00001021-exon-sc0000007-1510915933:777981..778271Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:777981..778271TCONS_00001021-exon-sc0000007-1575043694:777981..778271Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:778757..778879TCONS_00001021-exon-sc0000007-1491911889:778757..778879Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:778757..778879TCONS_00001021-exon-sc0000007-1510915933:778757..778879Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:778757..778879TCONS_00001021-exon-sc0000007-1575043694:778757..778879Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:779126..779311TCONS_00001021-exon-sc0000007-1491911889:779126..779311Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:779126..779311TCONS_00001021-exon-sc0000007-1510915933:779126..779311Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:779126..779311TCONS_00001021-exon-sc0000007-1575043694:779126..779311Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1491911889:780144..780652TCONS_00001021-exon-sc0000007-1491911889:780144..780652Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1510915933:780144..780652TCONS_00001021-exon-sc0000007-1510915933:780144..780652Clytia hemisphaericaexon
TCONS_00001021-exon-sc0000007-1575043694:780144..780652TCONS_00001021-exon-sc0000007-1575043694:780144..780652Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001021-proteinTCONS_00001021-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:761698..780652 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
121.049 125.544 104.117 95.7152 34.7647 28.511 54.4265 58.199 88.9408 77.859 122.624 130.13 143.155 138.714 129.549 137.614 87.4319 101.1 87.6355 95.9661 88.1136 85.6447 86.8217 111.913 109.485 103.508 111.917 135.441 120.78 113.484
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001030Acoase/IPM_deHydtase_lsu_aba
IPR015931Acnase/IPM_dHydase_lsu_aba_1/3
IPR000573AconitaseA/IPMdHydase_ssu_swvl
IPR006249Aconitase/IRP2
IPR015928Aconitase/3IPM_dehydase_swvl
IPR015932Aconitase/IPMdHydase_lsu_aba_2
IPR018136Aconitase_4Fe-4S_BS
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
Blast
BLAST of TCONS_00001021 vs. Swiss-Prot (Human)
Match: ACOC (Cytoplasmic aconitate hydratase OS=Homo sapiens GN=ACO1 PE=1 SV=3)

HSP 1 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 604/868 (69.59%), Postives = 718/868 (82.72%), Query Frame = 1
Query:  721 YFDLSKLEDQRYGQLPFSIRVLLESVVRNCDGFQVHQKDVETLLNWKETQHNGVEFPFRPARTLLQDFTGVPAVTDFAAMRDAVNRLGGDPSKINPLTPADMVIDHSIQVDHFRSEDALMKNQELEFSRNKERFQFLKWGSQAFKNLQIIPPGSGIVHQVNLEYLARVVFSEKGALYPDSLVGTDSHTTMINXXXXXXXXXXXXEAEAVMLGQVISMVVPKVIGYKITGTMNPIATSTDVVLTITKHLRQIGVVGKFVEFFGAGVASLSIADRATISNMCPEYGATVGFFPVDKMSLEYLRQSGRTEEHIKYIEDYMKANNLFRDYTNPEQDPVFTEIVELDLGSVVPSCSGPKRPHDRVPVSEMKTDFRSCLLNKVGFKGFGIVEEKTETIAPFIYEGKEYTLKHGXXXXXXXXXXXXXXXXXVMLGAGLLAKKAIESGLTTLPYIKTSVSPGSGVVTYYLKESGVDKYLEQLGFGIVGYGCMTCIGNSGPLPEAVAEVIEKNDLVVCGVLSGNRNFEGRIHPLTRANYLASPLLVIAYALAGTVDIDFEKEPIGRTEEGKEVFLRDIWPSRQEIQEMERKTVIPALFQEVYSKIQTGNPAWNNLETSASLLYPWESSSTYIQPPPFFNEMTLVVPEVESIANAAVLLNVGDSVTTDHISPAGMISRTSPAARYLGGLGLTPREFNSYGSRRGNYNVMARGTFANIRLVNKFMNKPGPKTKHWPSGDEMDIFDAAERYIKEKRSLIILAGKEYGCGSSRDWAAKGPWMQGIKAVIAESYERIHRSNLIGMGIAPLQYLSGDTTESLGLTGKESFTIEYPENLGAGSMVTVKVDDGRSFQVKARFDTDLEFVYYKNGGILNYMIRKIA 3324
            +F+L+KLED RYG+LPFSIRVLLE+ +RNCD F V ++D+E +L+W  TQH  +E PF+PAR +LQDFTGVPAV DFAAMRDAV +LGGDP KINP+ PAD+VIDHSIQVD  R  D+L KNQ+LEF RN+ERF+FLKWGSQAF N++IIPPGSGI+HQVNLEYLARVVF + G  YPDSLVGTDSHTTMI+GLGILGWGVGGIEAEAVMLGQ ISMV+P+VIGY++ G  +P+ TSTD+VLTITKHLRQ+GVVGKFVEFFG GVA LSIADRATI+NMCPEYGAT  FFPVD++S+ YL Q+GR EE +KYI+ Y++A  +FRD+ +P QDP FT++VELDL +VVP CSGPKRP D+V VS+MK DF SCL  K GFKGF +  E       FIY+  E+TL HGSVVI++ITSCTNTSNPSVMLGAGLLAKKA+++GL  +PYIKTS+SPGSGVVTYYL+ESGV  YL QLGF +VGYGCMTCIGNSGPLPE V E I + DLV  GVLSGNRNFEGR+HP TRANYLASP LVIAYA+AGT+ IDFEKEP+G   +G++VFL+DIWP+R EIQ +ER+ VIP +F+EVY KI+T N +WN L T +  L+ W S STYI+ PPFF  +TL +   +SI +A VLLN+GDSVTTDHISPAG I+R SPAARYL   GLTPREFNSYGSRRGN  VMARGTFANIRL+N+F+NK  P+T H PSG+ +D+FDAAERY +    LI+LAGKEYG GSSRDWAAKGP++ GIKAV+AESYERIHRSNL+GMG+ PL+YL G+  ++LGLTG+E +TI  PENL     V VK+D G++FQ   RFDTD+E  Y+ NGGILNYMIRK+A
Sbjct:   21 FFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMA 888          
The following BLAST results are available for this feature:
BLAST of TCONS_00001021 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACOC0.000e+069.59Cytoplasmic aconitate hydratase OS=Homo sapiens GN... [more]
back to top