Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001021-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001021-protein
Unique NameTCONS_00001021-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length894

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001021-protein ID=TCONS_00001021-protein|Name=TCONS_00001021-protein|organism=Clytia hemisphaerica|type=polypeptide|length=894bp
MENDHAFEKCKSTLKSGETDYSYFDLSKLEDQRYGQLPFSIRVLLESVVR
NCDGFQVHQKDVETLLNWKETQHNGVEFPFRPARTLLQDFTGVPAVTDFA
AMRDAVNRLGGDPSKINPLTPADMVIDHSIQVDHFRSEDALMKNQELEFS
RNKERFQFLKWGSQAFKNLQIIPPGSGIVHQVNLEYLARVVFSEKGALYP
DSLVGTDSHTTMINGLGILGWGVGGIEAEAVMLGQVISMVVPKVIGYKIT
GTMNPIATSTDVVLTITKHLRQIGVVGKFVEFFGAGVASLSIADRATISN
MCPEYGATVGFFPVDKMSLEYLRQSGRTEEHIKYIEDYMKANNLFRDYTN
PEQDPVFTEIVELDLGSVVPSCSGPKRPHDRVPVSEMKTDFRSCLLNKVG
FKGFGIVEEKTETIAPFIYEGKEYTLKHGSVVISSITSCTNTSNPSVMLG
AGLLAKKAIESGLTTLPYIKTSVSPGSGVVTYYLKESGVDKYLEQLGFGI
VGYGCMTCIGNSGPLPEAVAEVIEKNDLVVCGVLSGNRNFEGRIHPLTRA
NYLASPLLVIAYALAGTVDIDFEKEPIGRTEEGKEVFLRDIWPSRQEIQE
MERKTVIPALFQEVYSKIQTGNPAWNNLETSASLLYPWESSSTYIQPPPF
FNEMTLVVPEVESIANAAVLLNVGDSVTTDHISPAGMISRTSPAARYLGG
LGLTPREFNSYGSRRGNYNVMARGTFANIRLVNKFMNKPGPKTKHWPSGD
EMDIFDAAERYIKEKRSLIILAGKEYGCGSSRDWAAKGPWMQGIKAVIAE
SYERIHRSNLIGMGIAPLQYLSGDTTESLGLTGKESFTIEYPENLGAGSM
VTVKVDDGRSFQVKARFDTDLEFVYYKNGGILNYMIRKIASSAE
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000586XLOC_000586Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001021TCONS_00001021Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001030Acoase/IPM_deHydtase_lsu_aba
IPR015931Acnase/IPM_dHydase_lsu_aba_1/3
IPR000573AconitaseA/IPMdHydase_ssu_swvl
IPR006249Aconitase/IRP2
IPR015928Aconitase/3IPM_dehydase_swvl
IPR015932Aconitase/IPMdHydase_lsu_aba_2
IPR018136Aconitase_4Fe-4S_BS
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001030Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha domainPRINTSPR00415ACONITASEcoord: 169..177
score: 44.44
coord: 370..384
score: 43.13
coord: 435..446
score: 59.01
coord: 145..158
score: 41.11
coord: 497..510
score: 55.1
coord: 198..211
score: 59.33
coord: 288..301
score: 56.12
coord: 212..227
score: 54.34
coord: 274..287
score: 56.85
IPR001030Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha domainPFAMPF00330Aconitasecoord: 69..566
e-value: 6.8E-176
score: 585.7
IPR001030Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha domainSUPERFAMILY53732Aconitase iron-sulfur domaincoord: 10..630
IPR015931Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3GENE3D3.30.499.10coord: 370..580
e-value: 1.6E-65
score: 219.3
IPR015931Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3GENE3D3.30.499.10coord: 24..234
e-value: 1.9E-80
score: 268.8
IPR000573Aconitase A/isopropylmalate dehydratase small subunit, swivel domainPFAMPF00694Aconitase_Ccoord: 696..820
e-value: 1.5E-43
score: 148.2
IPR006249Aconitase/Iron-responsive element-binding protein 2TIGRFAMTIGR01341TIGR01341coord: 21..889
e-value: 0.0
score: 1297.0
IPR015928Aconitase/3-isopropylmalate dehydratase, swivelGENE3D3.20.19.10coord: 657..891
e-value: 4.9E-89
score: 297.3
IPR015928Aconitase/3-isopropylmalate dehydratase, swivelSUPERFAMILY52016LeuD/IlvD-likecoord: 635..888
IPR015932Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2GENE3D3.40.1060.10coord: 235..369
e-value: 5.1E-43
score: 145.8
IPR018136Aconitase family, 4Fe-4S cluster binding sitePROSITEPS01244ACONITASE_2coord: 497..510
IPR018136Aconitase family, 4Fe-4S cluster binding sitePROSITEPS00450ACONITASE_1coord: 431..447
NoneNo IPR availableCDDcd01580AcnA_IRP_Swivelcoord: 672..839
e-value: 1.0215E-100
score: 312.288
NoneNo IPR availableCDDcd01586AcnA_IRPcoord: 84..568
e-value: 0.0
score: 786.497

Blast
BLAST of TCONS_00001021-protein vs. Swiss-Prot (Human)
Match: ACOC (Cytoplasmic aconitate hydratase OS=Homo sapiens GN=ACO1 PE=1 SV=3)

HSP 1 Score: 1288.86 bits (3334), Expect = 0.000e+0
Identity = 604/868 (69.59%), Postives = 718/868 (82.72%), Query Frame = 0
Query:   23 YFDLSKLEDQRYGQLPFSIRVLLESVVRNCDGFQVHQKDVETLLNWKETQHNGVEFPFRPARTLLQDFTGVPAVTDFAAMRDAVNRLGGDPSKINPLTPADMVIDHSIQVDHFRSEDALMKNQELEFSRNKERFQFLKWGSQAFKNLQIIPPGSGIVHQVNLEYLARVVFSEKGALYPDSLVGTDSHTTMINGLGILGWGVGGIEAEAVMLGQVISMVVPKVIGYKITGTMNPIATSTDVVLTITKHLRQIGVVGKFVEFFGAGVASLSIADRATISNMCPEYGATVGFFPVDKMSLEYLRQSGRTEEHIKYIEDYMKANNLFRDYTNPEQDPVFTEIVELDLGSVVPSCSGPKRPHDRVPVSEMKTDFRSCLLNKVGFKGFGIVEEKTETIAPFIYEGKEYTLKHGSVVISSITSCTNTSNPSVMLGAGLLAKKAIESGLTTLPYIKTSVSPGSGVVTYYLKESGVDKYLEQLGFGIVGYGCMTCIGNSGPLPEAVAEVIEKNDLVVCGVLSGNRNFEGRIHPLTRANYLASPLLVIAYALAGTVDIDFEKEPIGRTEEGKEVFLRDIWPSRQEIQEMERKTVIPALFQEVYSKIQTGNPAWNNLETSASLLYPWESSSTYIQPPPFFNEMTLVVPEVESIANAAVLLNVGDSVTTDHISPAGMISRTSPAARYLGGLGLTPREFNSYGSRRGNYNVMARGTFANIRLVNKFMNKPGPKTKHWPSGDEMDIFDAAERYIKEKRSLIILAGKEYGCGSSRDWAAKGPWMQGIKAVIAESYERIHRSNLIGMGIAPLQYLSGDTTESLGLTGKESFTIEYPENLGAGSMVTVKVDDGRSFQVKARFDTDLEFVYYKNGGILNYMIRKIA 890
            +F+L+KLED RYG+LPFSIRVLLE+ +RNCD F V ++D+E +L+W  TQH  +E PF+PAR +LQDFTGVPAV DFAAMRDAV +LGGDP KINP+ PAD+VIDHSIQVD  R  D+L KNQ+LEF RN+ERF+FLKWGSQAF N++IIPPGSGI+HQVNLEYLARVVF + G  YPDSLVGTDSHTTMI+GLGILGWGVGGIEAEAVMLGQ ISMV+P+VIGY++ G  +P+ TSTD+VLTITKHLRQ+GVVGKFVEFFG GVA LSIADRATI+NMCPEYGAT  FFPVD++S+ YL Q+GR EE +KYI+ Y++A  +FRD+ +P QDP FT++VELDL +VVP CSGPKRP D+V VS+MK DF SCL  K GFKGF +  E       FIY+  E+TL HGSVVI++ITSCTNTSNPSVMLGAGLLAKKA+++GL  +PYIKTS+SPGSGVVTYYL+ESGV  YL QLGF +VGYGCMTCIGNSGPLPE V E I + DLV  GVLSGNRNFEGR+HP TRANYLASP LVIAYA+AGT+ IDFEKEP+G   +G++VFL+DIWP+R EIQ +ER+ VIP +F+EVY KI+T N +WN L T +  L+ W S STYI+ PPFF  +TL +   +SI +A VLLN+GDSVTTDHISPAG I+R SPAARYL   GLTPREFNSYGSRRGN  VMARGTFANIRL+N+F+NK  P+T H PSG+ +D+FDAAERY +    LI+LAGKEYG GSSRDWAAKGP++ GIKAV+AESYERIHRSNL+GMG+ PL+YL G+  ++LGLTG+E +TI  PENL     V VK+D G++FQ   RFDTD+E  Y+ NGGILNYMIRK+A
Sbjct:   21 FFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMA 888          
The following BLAST results are available for this feature:
BLAST of TCONS_00001021-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACOC0.000e+069.59Cytoplasmic aconitate hydratase OS=Homo sapiens GN... [more]
back to top