Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001006 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001006
Unique NameTCONS_00001006
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3079

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001006 ID=TCONS_00001006|Name=TCONS_00001006|organism=Clytia hemisphaerica|type=transcript|length=3079bp
TGAAACATTAGATTGCATTTTTATAATTCTTTCGTTGTGACTGTTGTTCT
TTCCTACTTCTTCTGTTCTTCCAGGTTCTTCTCTTCccgtttttcacttt
tttgaaaggTTCACACTTTCGAAACACCCTGATGGAGGGtagttttgttt
atatgaaCTTTGCCGCAGAGGTTTTTACCAGGACAACTAACTTTCTTCCT
CTAAGTAACAGAAAGCGAAAGAACTTTTCTATAGAATTCATCTTAACTTT
TTCCTCTCGCCGCGTCTAAAGAAGAGAACTTTGCTAGGCTAGAAAAACAA
ATTCACGtgctttttttcaaagaaaaatgtgaaaaaatggcgactGATCA
AAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGC
ATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAA
GTTGATGTAAAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCA
GAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttt
tagagaaaaaaagaaaacttggcACAGAACATTCACCACCTCATCTTATT
GTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATA
TTTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAA
CTACAATAATATCACCAAGACATCGACAAAGATTTCAAGTCATAATACca
caaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATT
CTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaat
gTCTGACATGCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTT
CAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattca
aaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATA
GTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacag
aaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGT
TCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATAT
CCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTG
CCACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCC
TTACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATG
AAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCA
TCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGC
TGAACAAACATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAG
CAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGA
ACATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGG
GGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGT
ATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAA
GAAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatga
aaaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGA
AATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACT
CCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAA
AAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATT
ATGCACGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATC
ATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGT
GACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATA
CTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATG
ACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGAT
CAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTG
CATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAA
AGGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTAT
TTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTC
TTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAA
AAGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgt
CGTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAG
TAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTA
GGAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCA
GGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTT
ATGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtca
gtgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAGAGAT
TGGAAATAGTAATTTTGGTTACATGTGTAATAGATTATAATTGTTATAAC
ATGAAAGCCTCCTCTGGATGGAAAAGTACTTATTCTGTGGCTTCTTAACT
GATTTTCTTTCAATATTAATCCGTATTTTTACAAACTGATAAAAGATAAA
GGTAGAGACACCACTTCGAGCTATTTGGACTTGATTTGTATTCTTTGAAA
AACCTACTTGGAATCTTTAAGTAGTGTTACTGATGAACAGTTATGTTTGA
TTTTGAACGATTCTTCACACATTCTACCGAAGGGTTTAGTTTTGTACTCA
AGTGTTTTtggtttgatatttttcttttt
Run BLAST on NCBI

protein sequence of TCONS_00001006-protein

>TCONS_00001006-protein ID=TCONS_00001006-protein|Name=TCONS_00001006-protein|organism=Clytia hemisphaerica|type=polypeptide|length=802bp
MATDQNTHKSGPLKQQNKSHKHGRHRTKGQVDKSHKGKVDVKSLSKKNKN
LDKQQRRHQAKQVRKNKREEVLEKKRKLGTEHSPPHLIVIFPLSSNCNCE
EALEYLVESDDTIIPIRNENTTTIISPRHRQRFQVIIPQRNFFSVLNAAK
VADSFLFLHPANNEIDEIGQKCLTCILAQGLPTNIHAVQGLRNVKKQGDV
KKNIQKSLEKWMPSVKLHSLDSKQDGELVLRLLSNQKQKRIFYRENRPYI
VADKVQFESNQDDESKGTLKISGFIRGQSLSVNRLVHLPQLGDFQLKKID
LPRDPYSMKRKDSNSNNMEGDEDNSMEEDVKTIAVADPSKQETLVTEAEV
DPMDAEQTWPTEEEIKQAQDEATAQMETERKIKRVPKGTSEYQAAWIDDE
DDDSGESEYEDSEDSEEEDMQYAQMQQSDDEQEAAEDKEDFDTISVAATT
VINDEKYDAQFDEDEEQRQLEKYRDEHENEMFPDEIDTPQDIDARVRFQK
YRGLKSFRTSPWDPKENLPLDYARIFQFQNFNRTKKRIMKQLQDDEDCAL
GGWYVTIHVKDVPKVYYENRDTSDPLVVFGLIPYEQKMTVMNFVLKRHPS
CGVPIKSKERLIFHVGYRMFSACPIFSQHTNSDKFKGERFLPHDAVTMAT
VYAPIFFPPAPVLVFTENCELLATGTVAGSNPDRVVVKKIVLSGHPFKIN
KKSSVVRYMFFSREDILWFKPVEVWTKYGRRGNIKEALGTHGHMKCVFDG
QLKAQDTVCMNLFKRLFPKWTYDPNIDIRNFKMITSSSVMTSHEDNEGDV
EM
Run BLAST on NCBI

transcript from alignment at sc0000007:630440..645717+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001006 ID=TCONS_00001006|Name=TCONS_00001006|organism=Clytia hemisphaerica|type=transcript|length=15278bp|location=Sequence derived from alignment at sc0000007:630440..645717+ (Clytia hemisphaerica)
TGAAACATTAGATTGCATTTTTATAATTCTTTCGTTGTGACTGTTGTTCT TTCCTACTTCTTCTGTTCTTCCAGGTTCTTCTCTTCccgtttttcacttt tttgaaaggTTCACACTTTCGAAACACCCTGATGGAGGGtagttttgttt atatgaaCTTTGCCGCAGAGGTTTTTACCAGGACAACTAACTTTCTTCCT CTAAGTAACAGAAAGCGAAAGAACTTTTCTATAGAATTCATCTTAACTTT TTCCTCTCGCCGCGTCTAAAGAAGAGAACTTTGCTAGGCTAGAAAAACAA ATTCACGtgctttttttcaaagaaaaatgtgaaaaaatggcgactGATCA AAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGC ATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaaggtatt attttttaatgataaATCTCTTTTACCACCTCTAAATAGGAACATAAGAT GAAAATATAACAATTATATATAACTCCATTTTCGTACAGAGGCGTagtgg tgtagtggttatcgtgcttgacttctgtccaggaggctcgagttcgatac ccaccgtggcactacgattcacttggcaagtgaatgctcctTCGCNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttgc atactttctaagggaatttcaccacggcaattcggcaaccataatttttg catacaattcaatatggcggacgcaaaggcgaaaaggtctattagacctc ctaattaagaatatatatcgaatttccagtttttttccaaaaatacaaat ttccgCAGATTCCTATCAGTCTCCAATGAAAGAATTTAGTGTgtagagca gattttgaaagtttgatacaGTAATATGGATGGAGTCCTGAGTTATGACA TTTAGAAAATGTTCTATTACCCGCGACAAAAACGCGTATAAAACGCGGGT GTATTGCCCTATCTAAtaatttttggggcaaatttgggccaaaaagtgcc taacatgggcttttttggactttggggAAAATCACCTTTTATTGTCAATA GGGAAATCacaataaaatatttattcacccCAGTATCTACGACTATAACT CATTCAAATTTAACTATACTTCACAGGTGGATATTAatttgagctgtgat actcacggtaatctatTTAAGCTGTTCACTACACTTTTTTCCTCTCTTGC TATTTGTTCTATTTTTAtctgaattaaaaaatttacattaaaaaaaatta ttgtctTTTTCTAGGGAAAGTTGATGTAAAATCTCTTTCaaagaagaata aaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAA AATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcACAGAACA TTCACCACCTCATCTTATTGtaagttcttttaaaaatgattatcttccta cctttcaaaaagaaaatagaacTTAAAAGTCTAAAGTGAGATATATACTA TAATTCCATATTTTTGAATAGACAATTTTATATACCACCCAGTACCACCA GCTAAATTAATTAAGTAACATTTTAtgttattttattaaattagaacCCA TACTTCCTTACAGGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAG AAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAGA AATGAAAATACAACTACAATAATGTAAGTAATGTCACATGATATCTCAAA TATTTGTGGTGGATAACTGTAGAGCATTTGTCTTGCAGTCCAAGGGTTGT TGGTTTGACCCCCCCCCTCACTGCAAATTCAAGGAATGGAGTTACCTCCC AGATCTAGTACAAATAGGAAAGCGGATATGCTTCCTTACTCCAAGCTCCA CAGACAGCCATCAAATGAATATAAATTCttacttcttttcaattttctca aTGTCACTTTACTTTCTAACTGTTATTTATCATGATTTTACTATCAAATT AAGCTTGGGAGTATATATAATTTTCTCTTTTAGATCACCAAGACATCGAC AAAGATTTCAAGTCATAATACcacaaagaaactttttttctgtgTTGAAT GCAGCAAAGGTATAACAAAGTCGATACTCTGACCAAATATTTTTTACAGA ACCTGGGTTGAAATTAGGGTCTTCACACTTCACTTATTTAAATTTTAGGT TGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaa ttggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAAAT ATTCACGCTGTTCAAGTATGTctgattttatctttttagatCATTGTAGA TATTTATTGTGAATTTATACAGCAATAtctgattttcaaattattaactg aatgaatgaaaaatcttttttagggCCTTCGGAATGTCAAAAAGCAAGGA GATGTcaagaaaaatattcaaaagtcACTGGAAAAATGGTAAGTGGTTTT AAATCTATGTAGGAAGACTTTTTCAGATCATAAATGTTATATAGTATAAT CTTatcttaattttgtttttttaggatGCCCTCAGTGAAACTTCATTCAT TGGATAGTAAGCAGGTAAGATAAGGGGAATGGAATATCTTTTGTAACGTC TTAACATTTACATTTTTTAGATGTTATTTTATAAGATCCCTAAACTAACT TTATTTTGAGGCTGATACTATAGAAAATTGACCTCTGACAAAAAGTAATG ACCCTGAGCTTGTGAGGGTAACAGGTTTGTTTCATAGGAGGAGTCAATAG ATTGTTTATTTCTTggcttaaaaaaaactttttcacaatTTCCAACATTA TTACACAATAACGTTTTTTTTCTATGCCTTTCTCCTTAAACCAAAAAAGT ACCTTTGCCCtgtacttcaaattttcaaataaacccCAACTAAAAAATGC CAATCTGGACTATTTTGACAAGATAGGGTGGCATGCGTTGCTTCTAGTTC TAAAAATTAAGCAATCTCGTTATGGCTGACACTACATAGGTTAAAAAGAT TGCATTGCCCAAGAATGTCAATTGATCTCATTATCCCAAAACCTGTTACA AATCCTACATAATActaattttcaatttattgCTCTAGCAGGCTCTAGAa aattatttacttatcttaAGAGAGTTTGCCCTCATTCTCAAATATGTTGC TTTTTTAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacag aaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGT TCAATTCGAATCCAATCAAGTAAGTCAAAGAAAGTTTacttataatttca aaaatgaaaagggTGTCTACTTTAATATTGGTTTGTCTTTGTGATCATCC ACTAAGGTAGTACCATCAACATCCCATTTAACTTTTTCTCTGCTTATATA GGCTATTTTGCCTAGGGTCGTTTGATAAAGTCTTTGATAGGTTGGGTGTC TATTGAAGCAGTAGAAGTTGGAGTGTCATTTTCTTGTGACATTGCGGTGA CTAAAGCTGACTGAAAAATTCAATTGTGTCAGTGCAACACGTTCTTGTGT CACCTGTTACATTTTCTCTTTTCACATTCATCCTCACATTATCATTTTAG GACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACA ATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCC AATTgaaaaaggttaatttatagaaaaagTGCTTTTGTCTTTTCTTATAT CTGGTGATTCAGTGTTGATCCTTTTTTGAAAACCCTTTTTCAAAGCTGAA CATTTAGGAAGAAGGTATTGACACCAAGCATCAAACTAACTTGTGGATGC ATAAATTTGAACTCTCTTTGTTCCTTTAGATTGACCTACCAAGAGATCCT TACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGTTTGTAAACA TGTCACTTTTTTCAATagttttaactgttttaaaatcTTCTATTTGATTA ACCAATACTGTGAACCTAATGAAGtagcttttattttttgtaacacAAAT GAATGGTAAAAATATCCCAAGGCTATAgaataaatatttcttttcttcag GAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGT TGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATC CCATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaaacaagCT CAAGGttcttctatttttctttcctaTATAGTCTTCTTTAAACAAACACT GGGGTATTCGCGATATGGATTGATTTATGATATGCTATAATGCAATATAT GTACATTATgtcagctgattggttgcatgTGACGTAGAATTTGGTATAAA AAAAAGAGGACAAATATATAGTTTGGTAAAGGCATTGCCATTGTGCATAC AAGAAAACTGtgcatagcgtcagcctgggtttaagtcccaggcaaaaatt aggtccccctgagttttaagtccccccaaagatttatgaaattctttgtt agcccccaggacttttgaccctagacactttcaaaaaattgatccagtaa aaaagggttttccaatgtaaattgcgttcagtttatagtaaaaaatattt ttcaaatttttcagattcatgagcttcaatttgagtaattgaaagccaac tattaagctgaattattttagcccccacattaagtgatgagattttagct ccccccaaaacagtggtgtacttccagccccctttttttggaaaaaattt aggGTGTAATCCCCCCAACCAGCAGGGGGAGGCTGACGCTATTCTGTGTT CACTAGGAGGTGATATTTTCCGTCTAGGGTCAGCATGTACGAGGTGTATA TTTCTTTACTTGGTAGACCATTGAAATATGAGCCaggcaaaattccaagc acttttcccACTGGCCGTTTTTTGatctagaaattgagtttcagcCATGC CATTGCTATTATCTGAGACCCCCCTAACGGACTCCTAGTTAAGAGTTTAT TAATGATATCAAGAATTAAAATGCAACAAAAATAGGTACTTTTCTTTCGT AACATAAACAAAATTATCGTTTACTAACTAACTATAATAGAATACACTTT AACCATGCATGGATAGGGGCCgcggctccactttgaaagtgGTAGGTGTT AGGGTGATAGGGCCGTAGTTTAGTGTCCCTTAattagtgtctaaggaggc gccacaatggttggcgccgacgggagaaaatttttgaaaataaaattttt gaaaattaccccTTCTAGACTGCTTAAAACAGGACTTTTTTAAAGCTTAC GGCCCCTGATGGAAAGAAATGCttgaagaacaaaagaaatgcttcaagaa caaaagaaacaaagctttatttattaaagtaagatttcaaaataaaaaaa gagccAATATTGTGGAATGTACTTTCCACTATCGATATTATTCTAACAAA TCTGGAGTTTTAAAAGTGAATATGAAGGaagaattgataaaaaaatgggA CATATTTCTAGCGGCCTTCTTAGTAAACCAACAAAACGATTTTTTATgac tcaaaaaattttttttcttcaaatattgagtttcaaaactcaatttaaaa ttgagttttcTGGCCGTATAACGGCCACAGAAAAGTGCTCGGAATTTTCA CTGTGAGCATACCATTGAAGGATTGAGAATCTTAATGTTATAGTAGAGGG TCAACCCTTAGGATTCGTAGTATCTTTTGTGGGACANCTTAATGTTATAG TAGAGGGTCAACCCTTAGGACCCGTATCATCTTTCGTGGGACTCAACCGC ATGTAATTGGTTCGAAAGTAGATAggattttgtaacttttttaagAGGGG ACCCGCAAATTAGCCCTGGCAAAACTTTTTATGGCTAAAAACCTGACGTC GTAGGTAAAACAAAACTCCTGACCcccaaaatgagtaaaaatttgacgat ttttcaaagtcgaataaaacgaaaatgattgataccatatcgtataaaac atgaaattctGAGATGAAAAATGTAGACTACAACAAGTCCCACAAAAGTT GTACGGATCCGAGCTAAGAGTTGGGCCCCTACTATTATTCCATCAATCAA ATAGATCAATAATTGTATTTTTTCATGTCTTTCAACAGATGAAGCAACAG CACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCT GAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAG TGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTC AAATGCAACAAAGTGACGATGAACAAGAAGTAAGtggaaaatcaagaaaa ccTTCTTTCTATTAAAATAGCAATTTTATATTCTATGTAAGGGCTAAATC TTTTTATATTTCGGCACGTTTTGACATGTATAAGGGGATCGGGGGATCTG ATTACGGTTACTTGCTTAAAGGAATTTATTGAAGATTCAGGTCATCATTT TCTTCCTGGAAACTGTCTGGTTTAGTTTTCAGTCTCCTGAGCAAATGAGT GCCTGTCCTAAGCCTAGCCCTCCAAGAAGAGGTAGGCACCAATAGCGCTT GAATGAAGTTGTTTCTttcagtttttggacctaccccggtgggtagaggt cctataaattaacctgtgttcgtccgtccgtccgtccgtccgtccgtccg ttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg tctttTACCAACTTTTcccaggattgaatcataggaatcctttgattttt ggtacaaaggtgcaaaatggtggtgggcaaaatgtgacggagcccgattt tcaaaaaaaaaatttgggcaaatttgcgccaaaaaacggctaaaaaacgg gttttttggactttgtgaaaaattgaatctttaattttttccgatttttt ctatgaaagtagggtaccatcataggtaaaagatggctcaagatgatttt tgcaaagaaattttgttggctcaaaaaacgcagaattatctataagaatc actattaataagcatacatcaatgttcttagtcaaattactcaattttgt ttatgagatagatgttttttttgctcatgatggcttacttttgaagaatt tgtgtgtttagatatgaaattttggttgattggCTTTTTTACATAGAAAG ACTGGCCAAattctacatttttttataagcacattatcaattacttaggt attagcttttctcgagattggctctttcaatctttatgatttttcgcaca aagatgcataactataaacgctcgaatgtgacggagcctggttatcgaaa aaaaatatttttgggcaaatttgggccaaaaaacggctaaaaacgggtta ttggatcattgattttttccatgaaagtagataaaagatggttccagctg atttttgtaaaaaaaagaatttttcagctcaaaaaacgcatctttatcta taagaatcactatcaataattatacatcaatgtttttagccaaattactg aattttttgatgagatagatgtttattttgctcacgaagtcttgaatata aaaaaatatttcaagagcatgaaattttggtttctaaacgttttttttta taagaaacaaacaactatatttaatagatcgtcactatttgtgttttgaa tgattttttattgGTCACGCTCACGATGATATCAATTATTTGCAAATCTG ACTTGCAATTCAAGAAAGTGATCTATACCATCGGTAGAACGATATATCAG TCAATAATAGAGACtagtttattttccgatactcggattgactgaagact gcctgaaacggcacgaaactctgagtatcggaaaataaactagtctctat tattgactgatagatatcaattatatatgtgttaaatgcataaccaggta ggtctataaaagtatcacttgttaattTCATTTCTTCATTTTAGGCTGCG GAAGATAAAGAAGATTTTGATACCGTAAGACTTCATACTTTTATCGTCCA AGTTTTCATTCATTTGCTAGATTTATTCAGTTTTTATGGAGACAAAGAAC ATTGCACGAAGTTGCATTAAATGAACTTTTACAGGCAGAGCTTCTATCCG ATTTATACTCAATTTATTTCGTTATTGCAGATCAGTGTGGCTGCAACGAC GGTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagatgaagaac aaAGAcagtaaaataaattttttactcataggttccaaataaacgggagg ctggaaaattttcgagattttaataaacggggggggttggaaattgtact tctgaaaacccagaaataaggtaaatataggctaaaatcaggctatttag agcaaaataaggggccttctttttgacagctgaaaatattcttaaaaatt aataaagggggggtcctaataaggccCGGGGGTtggaaagttttcgaaaa attaacaagcggggaggggcgtttatttggaacctaagagcaATCATTTC CGTTAGATAACCAACGGATCTGTTGAATCTCAAGTTGCCACTCGGTAGAG TTTGAAATGAATTTCTACTGacaatttttttggttttatcaCCCAGGTTA GAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGA TACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGAC TGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTA GATTATGCACGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAG AATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGTAAGATTTC CTTCTAGTACAAATGATACTTCTTACTGTTGATAAATAATCAATAAGTAA GTAATTAAATAAGTAAATGATTGCAGATtcaaatgaatatttttctgatc CCTGCTATTGAGTGTTTATGGTcacccagggggggggtacaTGTTCAGTG TAGTGACCCATGGCCGGTGGGGTGGTGGTTTTTCGAAGTTATTTCCATTT AGTACATGGTAGTAANAAAAGGGTGGTCTCCtaaaaaaaatcccagaaaa aatTACTACCATGTACTAAATTGGGTGGTACCAAAgtaaactttaatttt aaaggatAGTATGATGTAGTATATTCAGCTAGATttgatcaaaccaaatc gaaaaaCTGCCAGTTGTATTATCGTACTGCACTGTACTGCATNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTA TATTCAGCTAGATttgatcaaaccaaatcgaaaaaCTGCCAGTTCTATTA TCGTACTGCACTGCACTGCGTGCCTTaactaaaatctttctttctttctt tttgttatgtttagaaatttcaatttcgaatgtttgaaatattcgaattt cgaatatTTACATAAATCAGTGCTGATTTCGCCGTGACGTTTAATGTTAT TGAAGGACTTACTTATTCAAAATGTAAAATGCAGTCATTAACTCAAGAAA TGATTTTCAATAGGTTTACTgtattactttcaaataaacgccccctcgaa taaacgcccctcctaaaagaaaaattattaaataaacgcccccttggAAT GAACGCCCTCTCTAgcggaggggcgtttattagaaacttgttaCTTTCAA Tacagattttagtcatttcttataaccagagcagttttcgatgcaatttt aatCCTTGAACCAAATAAgttttgcactaaaatcctgataaagaactaaa acaaagaaagggcATAGTTGCTCTAAATATTAGACTTTAGActgaaataa tttaaaaaaaaggccccttcttttaaacgcccccctcCCTCGAAAAAACG CCCctcttaaaatcgaaaaaattaaatattaaataaacgccccgggcgtt tattcgaagtaatacggtaagtAGGTTCAAGGAGTCGGCGAAAGCTTTTC TAtcccaaaattttagaaaaaaaaaatcatggttagtatcaatgactgtA TTTGTTATTGCTTTTcatactttttcaaaagaaccagAAGGAATGGTTAT TTGTATCaaaaataaagacaaagtaAATGGTACAGGTGTGGTTAGTTTCC TGCAGCGTATTAAAAGGGTGTTGTTGTAAAGATTCAAAATAGGTGATGGT AGACACTACAGGGTATTAAAAGGGTGGTATGAGGATTGAAATGGGTGGTG CTAGCTTCTACAGGTTATTAAAAGGGTGGTATGAGGATTGAAATGGGTGG TGCTAGCTTCTACAGGTTATTAAAAGGGTGGTATAGGGATTTATATGGGC GGTGATATCTACTACAAGGTACTAAAGAGTGGTATAAGGATTCGAATTGG TGGTAATAGCTACTACGTGGTAGTAAAAGGGGTGGTCCCCtaaaaaaaat cccagaaaaaactagtaccatgtactaaaaaagggtggtggtcccaaatt ttttaaaaattactgaaaatCAGGTTATTACCCCATGGGTTACTACACTG AACATGTACCCCCCCTGGGTCACCCCTCCCCTCTCTACTTATGGGATGAA TTTTCCTGAAATACCAATTGATCTAAATAACTTCTCATGATCTCCTTCCA TTACAACAGGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAA AGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTC TCATACCTTACGAACAAAAGGTAGGTTTCTTTTTTATCGAATCTTTCGCG TTCATCAATTCACCCACCTTTGTTACTTACTGTGTAATTTTGTACAGGTT AGTTTTTACCATCTACCGAAATAGATCCAAACTTAGTTTAAAGGCAAATA ATTGGGAATGGTATTAGCGAATTTCAGTGAACTCTCATTTCGAAAAACCT ACGGCTGTTCTTTTTAGATGACAGTAATGAACTTCGTTTTGAAGAGACAT CCTTCTTGTGGAGTACCGATCAAATCCAAGGTTTGTTTTCCTGTTTAACT AACTCTTGAGAACACTAAAATAACTAGACGGTAGGTTAGGATGGTTTATC CACACCTAGTTTCTTTAGCCAACCGCGTAAAAGTGGTGACCGTTTCGAAA CGTTATATTAGGGCAATATTTCAAGATCGAAAGGAACTTTAAGCTGTAta cttttcttcttcaattaTGTGGTTAAATAAGTTATCATGTTTGCTCTAAT TTTCTTCGTTTCGTGTTTAAGAATGCTATAAGACGTAATTTTCTTTCTTG CTTGTTTAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGC ATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGTAAAGC ATCGTTGAAAACTTCTTTTATAGTAAAGCTAAGCTTAGCAACCGGGCAGA GCTGATAGTttttaaagtaactttttacAAATACTTTACAacgaagtgaa tacagtcgctctcatgttgtcttctgaccagccaccaaaaccgttggaaa accaacggatccggcgagactcgaactcacaaccatgccattcgcgggca tttgctctaccattgagctacgggtccatgtgAAACCCGAGGACTCAATT GCCACTGTGTAGAGCTGGAAGTAaattcttgtctactgactGGTCAGAGA CGGTGAATTGGGAGAAATCCATCTCCACATTGCTAGTGGGTTGGAATCCA CCAACTACTACACTAATCTGTGGGCATGCGACCACAGATATGAATATTGA CCTTatacaatgaagtgaatacagtcgctctcatatgttgtcttctgacc agccaccagaacaaTACTTTACACTTTGGAATCGCTTTTCTCATACAACG TTTTCACCAAACCTTGTTTCCCCTTATGTAAAAATGTCACGGTACTGATA TTGACTGCCCCCATCGAAAGCAGAAATAGTTCTTACGAGCCTTTTACGcc acaaaaaattttatttattttcttgtattttcagGGTGAAAGGTTTTTAC CGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCG CCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGG AACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTAT TAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATAC ATGTTCTTTAGCAGAGGTGAGTGTGGATTTTATACTCATTGATTAGGCTT TGGTATTCAATTGCGAAATATTTATTTGCGAAAATTATCAGTCAAGAATA TAGATGAACTTTTTTATTCTCTATTCTTGACTGATATACCGCTCTACCAT GATGGTAGAGAGCACTTTGTTGAATCGGAAGTCAGATTTGCAACTATATT TGCAATAATTACATACAAAGAAGTAAAAATTTACAGTAAACTTTTAAGGA TTTTATACTAAACGGGTTTAGAATGAAGATTATCAAAATGAATACCCTCT CAGTTAAAACAGCActcaagaaatctttttttccttttttcagagGACAT ATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAA ACATCAAAGAAGCCCTAGGTAAACTTTTTTTACTGTATTCTGTTTATGTT TCAGTAAATTTCCTTCAAAGTTGTATTTGAACATTGGAAATTTCCGTTTC ATTGGATTGGGGAGggttgaaatttaaaagaattcttTCCCTACCTTGCA TATATGGAAAGGGTCTTTATGTGAAACCTTTAGCTGACCCCCTAAAGATT TATTTACTCGTAAAACCTCTAGGCCAACACATTGGGGGCCTTTCAATCAA AGAGTAAAATAAGTGAGAAAATAAAAAGGACCatattgattttttctttc aaccaaattttatttcatcGAAATTTTATTCctaaatatttctttgataG GAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAG GACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTA TGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcag tgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAGAGATT GGAAATAGTAATTTTGGTTACATGTGTAATAGATTATAATTGTTATAACA TGAAAGCCTCCTCTGGATGGAAAAGTACTTATTCTGTGGCTTCTTAACTG ATTTTCTTTCAATATTAATCCGTATTTTTACAAACTGATAAAAGATAAAG GTAGAGACACCACTTCGAGCTATTTGGACTTGATTTGTATTCTTTGAAAA ACCTACTTGGAATCTTTAAGTAGTGTTACTGATGAACAGTTATGTTTGAT TTTGAACGATTCTTCACACATTCTACCGAAGGGTTTAGTTTTGTACTCAA GTGTTTTtggtttgatatttttcttttt

Coding sequence (CDS) from alignment at sc0000007:630440..645717+

>TCONS_00001006 ID=TCONS_00001006|Name=TCONS_00001006|organism=Clytia hemisphaerica|type=CDS|length=50589bp|location=Sequence derived from alignment at sc0000007:630440..645717+ (Clytia hemisphaerica)
atggcgactGATCAAAACACTCACAAATCTGGACCTCTCAAGCAACAGAA
CAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGT
CTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataaaaat
ttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAA
AAGGGAAGAggttttagagaaaaaaagaaaacttggcACAGAACATTCAC
CACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAA
GAAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAG
AAATGAAAATACAACTACAATAATATCACCAAGACATCGACAAAGATTTC
AAGTCATAATACcacaaagaaactttttttctgtgTTGAATGCAGCAAAG
GTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatga
aattggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAA
ATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTc
aagaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAAACT
TCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTAT
CGAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTACATA
GTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAAAGG
CACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAAATC
GGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATTGAC
CTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAACAA
TATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTG
CAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTT
GATCCCATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaaaca
agCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAAAGC
GAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGATGAG
GATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGA
GGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAAGAAG
CTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACGACG
GTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagatgaagaaca
aAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCG
ATGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAA
TACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAA
CCTTCCATTAGATTATGCACGGATtttccagtttcaaaatttcaatcgCA
CGAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTT
GGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGTATTA
TGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTT
ACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCT
TGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATA
TCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGTGACA
AGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCTACA
GTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGA
GAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATC
GGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaatcaat
aaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACATATT
ATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACA
TCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGACGGT
CAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACTCTT
CCCCAAATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAAATGA
TTACGTCATCAtcagtgatgacgtcacatgagGACAATGAAGGTGATGTC
GAAATGTGAatggcgactGATCAAAACACTCACAAATCTGGACCTCTCAA
GCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAG
TGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaag
aataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCG
TAAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcACAG
AACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGT
AATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAAT
TCCTATAAGAAATGAAAATACAACTACAATAATATCACCAAGACATCGAC
AAAGATTTCAAGTCATAATACcacaaagaaactttttttctgtgTTGAAT
GCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGA
AATTgatgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAAGGAT
TACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAA
GGAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTC
AGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCA
GACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGG
CCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGA
AAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGT
CAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaa
aagATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAA
TTCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGA
AAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAA
GCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaagaaga
aattaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAA
AGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATT
GATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGA
CAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATG
AACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCT
GCAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaaga
tgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAA
TGTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGC
TTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCC
TAAGGAAAACCTTCCATTAGATTATGCACGGATtttccagtttcaaaatt
tcaatcgCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGAC
TGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAA
AGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTC
TCATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGA
CATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCA
CGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCA
ACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACC
ATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGT
GTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAA
ATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttc
aaaatcaataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGa
gGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCA
GAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTG
TTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAA
AAGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGAAACT
TCAAAATGATTACGTCATCAtcagtgatgacgtcacatgagGACAATGAA
GGTGATGTCGAAATGTGAatggcgactGATCAAAACACTCACAAATCTGG
ACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCA
AAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTT
TCaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAA
GCAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaac
ttggcACAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCA
AGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGA
TACAATAATTCCTATAAGAAATGAAAATACAACTACAATAATATCACCAA
GACATCGACAAAGATTTCAAGTCATAATACcacaaagaaactttttttct
gtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGC
AAATAATGAAATTgatgaaattggtcaaaaatgTCTGACATGCATACTGG
CTCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTC
AAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATG
gatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGC
TAGTACTCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGA
GAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCA
AGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGAC
AATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTC
CAATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAA
AGACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAG
AGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTT
GTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTAC
TGaagaagaaattaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGA
CGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCG
GCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGA
TAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAA
GTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATC
AGTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTT
CgatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATG
AGAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCT
AGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCC
TTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttccagt
ttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAATTACAGGAT
GATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGA
TGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTG
TTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTT
TTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTT
GATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCC
AACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGAT
GCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCC
AGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAG
CTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGA
CATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATACATGTTCTT
TAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAAT
ATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATG
AAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAA
CCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATA
TTCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacgtcacatgag
GACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACACTCA
CAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTC
ACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTA
AAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCA
CCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaa
aaagaaaacttggcACAGAACATTCACCACCTCATCTTATTGTAATATTC
CCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGA
AAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAACTACAATAA
TATCACCAAGACATCGACAAAGATTTCAAGTCATAATACcacaaagaaac
tttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCT
CCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTGACAT
GCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTT
CGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACT
GGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGG
ATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaagaatt
TTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGA
ATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTA
TAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTA
GGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAAT
GAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATT
CTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAA
GAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAAC
ATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAGCAACAGCAC
AAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAA
TACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGA
GTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAA
TGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTT
GATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGA
CGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAG
ACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGAT
ATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAG
AACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGA
TtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAA
TTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACA
CGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATC
CTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATG
AACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAA
GGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCA
TTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTA
CCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCC
GCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTG
GAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTA
TTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATA
CATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGT
GGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCAC
GGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGT
TTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTA
ACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacg
tcacatgagGACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCA
AAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGC
ATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAA
GTTGATGTAAAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCA
GAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttt
tagagaaaaaaagaaaacttggcACAGAACATTCACCACCTCATCTTATT
GTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATA
TTTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAA
CTACAATAATATCACCAAGACATCGACAAAGATTTCAAGTCATAATACca
caaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATT
CTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaat
gTCTGACATGCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTT
CAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattca
aaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATA
GTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacag
aaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGT
TCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATAT
CCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTG
CCACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCC
TTACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATG
AAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCA
TCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGC
TGAACAAACATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAG
CAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGA
ACATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGG
GGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGT
ATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAA
GAAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatga
aaaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGA
AATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACT
CCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAA
AAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATT
ATGCACGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATC
ATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGT
GACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATA
CTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATG
ACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGAT
CAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTG
CATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAA
AGGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTAT
TTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTC
TTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAA
AAGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgt
CGTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAG
TAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTA
GGAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCA
GGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTT
ATGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtca
gtgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAatggc
gactGATCAAAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAAT
CCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCAC
aaagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataaaaatttgga
caaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGG
AAGAggttttagagaaaaaaagaaaacttggcACAGAACATTCACCACCT
CATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGC
ACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATG
AAAATACAACTACAATAATATCACCAAGACATCGACAAAGATTTCAAGTC
ATAATACcacaaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGC
AGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattg
gtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAAATATT
CACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaa
aaatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATT
CATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAac
caaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGC
TGATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTT
TGAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTG
GTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACC
AAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGG
AAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTT
GCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCC
CATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaaacaagCTC
AAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTA
CCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGA
TGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGG
ACATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCG
GAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgat
caatgatgaaaaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAc
aGTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAA
ATTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAG
AGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTC
CATTAGATTATGCACGGATtttccagtttcaaaatttcaatcgCACGAAG
AAAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGG
TTGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGA
ATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAA
CAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGG
AGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAA
TGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTT
AAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATA
CGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATT
GTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTG
GTCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaa
atccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGT
TTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAA
GAAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTT
GAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCA
AATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAAATGATTACG
TCATCAtcagtgatgacgtcacatgagGACAATGAAGGTGATGTCGAAAT
GTGAatggcgactGATCAAAACACTCACAAATCTGGACCTCTCAAGCAAC
AGAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGAT
AAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataa
aaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAA
ATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcACAGAACAT
TCACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTG
CGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTA
TAAGAAATGAAAATACAACTACAATAATATCACCAAGACATCGACAAAGA
TTTCAAGTCATAATACcacaaagaaactttttttctgtgTTGAATGCAGC
AAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTg
atgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCA
ACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGA
TGTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGA
AACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTT
TTATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTA
CATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCA
AAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTA
AATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagAT
TGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTA
ACAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACA
ATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGA
AGTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaagaagaaatta
aacaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATA
AAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGA
TGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCG
AAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAA
GAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAAC
GACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagatgaag
aacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTC
CCCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCA
AAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGG
AAAACCTTCCATTAGATTATGCACGGATtttccagtttcaaaatttcaat
cgCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGC
CCTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGT
ATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATA
CCTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCC
TTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTG
GATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGT
GACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGC
TACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCA
CAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCT
GATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaat
caataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACA
TATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGA
AACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGA
CGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGAC
TCTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAA
ATGATTACGTCATCAtcagtgatgacgtcacatgagGACAATGAAGGTGA
TGTCGAAATGTGAatggcgactGATCAAAACACTCACAAATCTGGACCTC
TCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGA
CAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaa
gaagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAG
TTCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggc
ACAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAA
TTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAA
TAATTCCTATAAGAAATGAAAATACAACTACAATAATATCACCAAGACAT
CGACAAAGATTTCAAGTCATAATACcacaaagaaactttttttctgtgTT
GAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATA
ATGAAATTgatgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAA
GGATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAA
GCAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGC
CCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTA
CTCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAA
CAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACG
ATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCA
TTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATT
gaaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACT
CAAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGAT
GTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCAC
TGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaag
aagaaattaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAG
AGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTG
GATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCG
AGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGAC
GATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGT
GGCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatg
aagatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAAT
GAAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGT
TCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGG
ATCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttccagtttcaa
aatttcaatcgCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGA
AGACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTAC
CAAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTT
GGTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAA
GAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCT
TCCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACAT
ACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGT
TACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGC
TTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGC
TCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCC
cttcaaaatcaataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCA
GAGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGT
CGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATG
CGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCT
TCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGA
AACTTCAAAATGATTACGTCATCAtcagtgatgacgtcacatgagGACAA
TGAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACACTCACAAAT
CTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGA
ACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATC
TCTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAG
CTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaaga
aaacttggcACAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCT
TTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTG
ATGATACAATAATTCCTATAAGAAATGAAAATACAACTACAATAATATCA
CCAAGACATCGACAAAGATTTCAAGTCATAATACcacaaagaaacttttt
ttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACC
CAGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTGACATGCATA
CTGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAA
TGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAA
AATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGT
GAGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTA
TCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCA
ATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGA
GGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGA
CTTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAA
GAAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATG
GAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAAC
ACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGC
CTACTGaagaagaaattaaacaagCTCAAGATGAAGCAACAGCACAAATG
GAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCA
GGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACG
AAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAA
CAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATAC
CATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTC
AGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAG
CATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGA
TGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTT
CTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttc
cagtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAATTACA
GGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTA
AAGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTG
GTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTT
CGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGC
GCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTC
TCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCA
TGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTG
CTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACA
GTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAG
TGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATACATGT
TCTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACA
AAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACA
CATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTA
TGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATT
GATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacgtcaca
tgagGACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACA
CTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGC
CGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGA
TGTAAAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAA
GGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagag
aaaaaaagaaaacttggcACAGAACATTCACCACCTCATCTTATTGTAAT
ATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGG
TTGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAACTACA
ATAATATCACCAAGACATCGACAAAGATTTCAAGTCATAATACcacaaag
aaactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGT
TTCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTG
ACATGCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAgg
CCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagt
cACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAG
CAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaag
aattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAAT
TCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGC
TTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACA
GCTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACT
CAATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGAC
AATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAA
GCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAAC
AAACATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAGCAACA
GCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATC
TGAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGA
GTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCT
CAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGA
TTTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaat
atGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATAC
AGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACA
AGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCT
TTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCA
CGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAA
ACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCA
TACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCT
GATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGT
AATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAAT
CCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGT
CCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTT
TTTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCT
TCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCC
ACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGAT
TGTATTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTC
GATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAA
GTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAAC
GCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACA
CTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGAT
CCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgat
gacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAatggcgactG
ATCAAAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCAC
AAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagG
GAAAGTTGATGTAAAATCTCTTTCaaagaagaataaaaatttggacaaaC
AGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAg
gttttagagaaaaaaagaaaacttggcACAGAACATTCACCACCTCATCT
TATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTG
AATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAAT
ACAACTACAATAATATCACCAAGACATCGACAAAGATTTCAAGTCATAAT
ACcacaaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATT
CATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaa
aaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAAATATTCACGC
TGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaata
ttcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTG
GATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaa
acagaaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATA
AAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAG
ATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCA
TTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAG
ATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGT
GATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGA
TCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGG
ATGCTGAACAAACATGGCCTACTGaagaagaaattaaacaagCTCAAGAT
GAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAA
AGGAACATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATA
GTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATG
CAGTATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGA
TAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatg
atgaaaaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTA
GAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGA
TACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGAC
TGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTA
GATTATGCACGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAG
AATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGT
ATGTGACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGA
GATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAA
GATGACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTAC
CGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTC
AGTGCATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGG
TGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCC
CTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAG
CTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGT
CAAAAAGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaaatcca
gtgtCGTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAA
CCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGC
CCTAGGAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAG
CGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGG
ACTTATGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATC
AtcagtgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAa
tggcgactGATCAAAACACTCACAAATCTGGACCTCTCAAGCAACAGAAC
AAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTC
TCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataaaaatt
tggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAA
AGGGAAGAggttttagagaaaaaaagaaaacttggcACAGAACATTCACC
ACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAG
AAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAGA
AATGAAAATACAACTACAATAATATCACCAAGACATCGACAAAGATTTCA
AGTCATAATACcacaaagaaactttttttctgtgTTGAATGCAGCAAAGG
TTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaa
attggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAAA
TATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTca
agaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTT
CATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATC
GAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTACATAG
TTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGC
ACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCG
GTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATTGACC
TACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAACAAT
ATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTGC
AGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTG
ATCCCATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaaacaa
gCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCG
AGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGATGAGG
ATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAG
GAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGC
TGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACGACGG
TgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagatgaagaacaa
AGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCGA
TGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAAT
ACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAAC
CTTCCATTAGATTATGCACGGATtttccagtttcaaaatttcaatcgCAC
GAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTTG
GTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGTATTAT
GAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTA
CGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTT
GTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATAT
CGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGTGACAA
GTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCTACAG
TATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAG
AATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCG
GGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaatcaata
aaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACATATTA
TGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACAT
CAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGACGGTC
AGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTC
CCCAAATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAAATGAT
TACGTCATCAtcagtgatgacgtcacatgagGACAATGAAGGTGATGTCG
AAATGTGAatggcgactGATCAAAACACTCACAAATCTGGACCTCTCAAG
CAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGT
GGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaaga
ataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGT
AAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcACAGA
ACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTA
ATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATT
CCTATAAGAAATGAAAATACAACTACAATAATATCACCAAGACATCGACA
AAGATTTCAAGTCATAATACcacaaagaaactttttttctgtgTTGAATG
CAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAA
ATTgatgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATT
ACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAG
GAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTCA
GTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAG
ACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGGC
CTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGAA
AGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGTC
AGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaa
agATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAAT
TCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAA
AACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAG
CTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaagaagaa
attaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAA
GATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTG
ATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGAC
AGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATGA
ACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTG
CAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagat
gaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAAT
GTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGCT
TTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCT
AAGGAAAACCTTCCATTAGATTATGCACGGATtttccagtttcaaaattt
caatcgCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGACT
GTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAAA
GTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCT
CATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGAC
ATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCAC
GTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAA
CAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCA
TGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTG
TTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAA
TCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttca
aaatcaataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGag
GACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAG
AGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTGT
TTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAA
AGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGAAACTT
CAAAATGATTACGTCATCAtcagtgatgacgtcacatgagGACAATGAAG
GTGATGTCGAAATGTGAatggcgactGATCAAAACACTCACAAATCTGGA
CCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCAA
AGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTT
CaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAG
CAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaact
tggcACAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCAA
GTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGAT
ACAATAATTCCTATAAGAAATGAAAATACAACTACAATAATATCACCAAG
ACATCGACAAAGATTTCAAGTCATAATACcacaaagaaactttttttctg
tgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCA
AATAATGAAATTgatgaaattggtcaaaaatgTCTGACATGCATACTGGC
TCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCA
AAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATGg
atGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCT
AGTACTCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGAG
AAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAA
GACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACA
ATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCC
AATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAA
GACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAGA
GGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTG
TCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTACT
GaagaagaaattaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGAC
GGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGG
CGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGAT
AGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAG
TGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCA
GTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTTC
gatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGA
GAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCTA
GGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCT
TGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttccagtt
tcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAATTACAGGATG
ATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGAT
GTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGT
TTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTTT
TGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTG
ATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCA
ACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATG
CTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCA
GTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGC
TGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGAC
ATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATACATGTTCTTT
AGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATA
TGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATGA
AATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAAC
CTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATAT
TCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacgtcacatgagG
ACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACACTCAC
AAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCA
CAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAA
AATCTCTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCAC
CAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaaa
aagaaaacttggcACAGAACATTCACCACCTCATCTTATTGTAATATTCC
CTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAA
AGTGATGATACAATAATTCCTATAAGAAATGAAAATACAACTACAATAAT
ATCACCAAGACATCGACAAAGATTTCAAGTCATAATACcacaaagaaact
ttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTC
CACCCAGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTGACATG
CATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTTC
GGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACTG
GAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGA
TGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaagaattT
TCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAA
TCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTAT
AAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAG
GCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAATG
AAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATTC
TATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAG
AAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACA
TGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAGCAACAGCACA
AATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAAT
ACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGAG
TACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAAT
GCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTG
ATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGAC
GCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAGA
CGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGATA
TCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGA
ACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGAT
tttccagtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAAT
TACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACAC
GTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATCC
TCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATGA
ACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAG
GAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCAT
TTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTAC
CGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCG
CCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGG
AACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTAT
TAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATAC
ATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGTG
GACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACG
GACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTT
TGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAA
CATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacgt
cacatgagGACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCAA
AACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCA
TGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAG
TTGATGTAAAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCAG
AGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggtttt
agagaaaaaaagaaaacttggcACAGAACATTCACCACCTCATCTTATTG
TAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATAT
TTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAAC
TACAATAATATCACCAAGACATCGACAAAGATTTCAAGTCATAATACcac
aaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTC
TTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaatg
TCTGACATGCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTTC
AAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaa
aagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATAG
TAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacaga
aaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTT
CAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATC
CGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGC
CACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCCT
TACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATGA
AGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCAT
CCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCT
GAACAAACATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAGC
AACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAA
CATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGG
GAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTA
TGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAG
AAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatgaa
aaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAA
ATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACTC
CACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAA
AGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTA
TGCACGGATtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATCA
TGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTG
ACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATAC
TTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGA
CAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATC
AAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGC
ATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAA
GGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATT
TTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCT
TGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAA
AGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtC
GTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAGT
AGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAG
GAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAG
GACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTA
TGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcag
tgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATGTGAatggcg
actGATCAAAACACTCACAAATCTGGACCTCTCAAGCAACAGAACAAATC
CCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATAAGTCTCACa
aagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataaaaatttggac
aaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGA
AGAggttttagagaaaaaaagaaaacttggcACAGAACATTCACCACCTC
ATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCA
CTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTATAAGAAATGA
AAATACAACTACAATAATATCACCAAGACATCGACAAAGATTTCAAGTCA
TAATACcacaaagaaactttttttctgtgTTGAATGCAGCAAAGGTTGCA
GATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTgatgaaattgg
tcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAACAAATATTC
ACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaa
aatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTC
ATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTTTATCGAacc
aaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTACATAGTTGCT
GATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAAAGGCACTTT
GAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAAATCGGTTGG
TTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATTGACCTACCA
AGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAACAATATGGA
AGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTG
CTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCC
ATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaaacaagCTCA
AGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAAAGCGAGTAC
CAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGATGAGGATGAT
GATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGA
CATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAAGAAGCTGCGG
AAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACGACGGTgatc
aatgatgaaaaatatGACGCTCAGTTCgatgaagatgaagaacaaAGAca
GTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTCCCCGATGAAA
TTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAAAAATACAGA
GGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCC
ATTAGATTATGCACGGATtttccagtttcaaaatttcaatcgCACGAAGA
AAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGCCCTTGGTGGT
TGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGTATTATGAGAA
TAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAAC
AAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGA
GTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGGATATCGAAT
GTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGTGACAAGTTTA
AGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCTACAGTATAC
GCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTG
TGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGG
TCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaatcaataaaaaa
tccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACATATTATGGTT
TAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAAACATCAAAG
AAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGACGGTCAGTTG
AAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAA
ATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAAATGATTACGT
CATCAtcagtgatgacgtcacatgagGACAATGAAGGTGATGTCGAAATG
TGAatggcgactGATCAAAACACTCACAAATCTGGACCTCTCAAGCAACA
GAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGACAAGTGGATA
AGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaagaagaataaa
aatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGTTCGTAAAAA
TAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcACAGAACATT
CACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAATTGTAATTGC
GAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAATAATTCCTAT
AAGAAATGAAAATACAACTACAATAATATCACCAAGACATCGACAAAGAT
TTCAAGTCATAATACcacaaagaaactttttttctgtgTTGAATGCAGCA
AAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAATGAAATTga
tgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAAGGATTACCAA
CAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAGCAAGGAGAT
GTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGCCCTCAGTGAA
ACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTACTCAGACTTT
TATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAACAGGCCTTAC
ATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGATGAAAGCAA
AGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCATTGTCAGTAA
ATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTgaaaaagATT
GACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTCAAATTCTAA
CAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATGTGAAAACAA
TTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACTGAAGCTGAA
GTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaagaagaaattaa
acaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGAGAAAGATAA
AGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGGATTGATGAT
GAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGAGGACAGCGA
AGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACGATGAACAAG
AAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTGGCTGCAACG
ACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatgaagatgaaga
acaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATGAAATGTTCC
CCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGTTCGCTTTCAA
AAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGATCCTAAGGA
AAACCTTCCATTAGATTATGCACGGATtttccagtttcaaaatttcaatc
gCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGAAGACTGTGCC
CTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACCAAAAGTGTA
TTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTGGTCTCATAC
CTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAGAGACATCCT
TCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTTCCACGTTGG
ATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATACCAACAGTG
ACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTTACCATGGCT
ACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCTTGTGTTCAC
AGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCTCAAATCCTG
ATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCcttcaaaatc
aataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAGAGagGACAT
ATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTCGCAGAGGAA
ACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGCGTGTTTGAC
GGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTTCAAAAGACT
CTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGAAACTTCAAAA
TGATTACGTCATCAtcagtgatgacgtcacatgagGACAATGAAGGTGAT
GTCGAAATGTGAatggcgactGATCAAAACACTCACAAATCTGGACCTCT
CAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAACCAAAGGAC
AAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCTCTTTCaaag
aagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAGCTAAGCAAGT
TCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaagaaaacttggcA
CAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCTTTCAAGTAAT
TGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGATGATACAAT
AATTCCTATAAGAAATGAAAATACAACTACAATAATATCACCAAGACATC
GACAAAGATTTCAAGTCATAATACcacaaagaaactttttttctgtgTTG
AATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCCAGCAAATAA
TGAAATTgatgaaattggtcaaaaatgTCTGACATGCATACTGGCTCAAG
GATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAATGTCAAAAAG
CAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAAAATGgatGCC
CTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTGAGCTAGTAC
TCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTATCGAGAAAAC
AGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAATCAAGACGA
TGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAGGACAATCAT
TGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGACTTCCAATTg
aaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAAGAAAAGACTC
AAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATGGAAGAGGATG
TGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACACTTGTCACT
GAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCCTACTGaaga
agaaattaaacaagCTCAAGATGAAGCAACAGCACAAATGGAGACGGAGA
GAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAGGCGGCGTGG
ATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGAAGATAGCGA
GGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAACAAAGTGACG
ATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACCATCAGTGTG
GCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTCAGTTCgatga
agatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGCATGAGAATG
AAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGATGCTAGGGTT
CGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTCTCCTTGGGA
TCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttccagtttcaaa
atttcaatcgCACGAAGAAAAGAATCATGAAACAATTACAGGATGATGAA
GACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAAAGATGTACC
AAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGGTTGTTTTTG
GTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTTCGTTTTGAAG
AGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCGCTTGATCTT
CCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCTCCCAACATA
CCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCATGATGCTGTT
ACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGCTCCAGTGCT
TGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAGTAGCTGGCT
CAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGTGGACATCCc
ttcaaaatcaataaaaaatccagtgtCGTTCGATACATGTTCTTTAGCAG
AGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAAAATATGGTC
GCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACACATGAAATGC
GTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTATGAACCTCTT
CAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATTGATATTCGAA
ACTTCAAAATGATTACGTCATCAtcagtgatgacgtcacatgagGACAAT
GAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACACTCACAAATC
TGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCCGTCACAGAA
CCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGATGTAAAATCT
CTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAAGGCACCAAGC
TAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagagaaaaaaagaa
aacttggcACAGAACATTCACCACCTCATCTTATTGTAATATTCCCTCTT
TCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGTTGAAAGTGA
TGATACAATAATTCCTATAAGAAATGAAAATACAACTACAATAATATCAC
CAAGACATCGACAAAGATTTCAAGTCATAATACcacaaagaaactttttt
tctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTTTCTCCACCC
AGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTGACATGCATAC
TGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAggCCTTCGGAAT
GTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtcACTGGAAAA
ATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGCAGGATGGTG
AGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaagaattTTCTAT
CGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATTCGAATCCAA
TCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCTTTATAAGAG
GACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAGCTAGGCGAC
TTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACTCAATGAAAAG
AAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGACAATTCTATGG
AAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAGCAAGAAACA
CTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACAAACATGGCC
TACTGaagaagaaattaaacaagCTCAAGATGAAGCAACAGCACAAATGG
AGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCTGAATACCAG
GCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAGTGAGTACGA
AGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTCAAATGCAAC
AAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGATTTTGATACC
ATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaatatGACGCTCA
GTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATACAGAGACGAGC
ATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACAAGATATCGAT
GCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTTTAGAACTTC
TCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCACGGATtttcc
agtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAACAATTACAG
GATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCATACACGTTAA
AGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTGATCCTCTGG
TTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTAATGAACTTC
GTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATCCAAGGAGCG
CTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTCCCATTTTCT
CCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTTTTACCGCAT
GATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTTCCCGCCTGC
TCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCACTGGAACAG
TAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATTGTATTAAGT
GGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCGATACATGTT
CTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAGTGTGGACAA
AATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACGCACGGACAC
ATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACACTGTTTGTAT
GAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATCCTAACATTG
ATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgatgacgtcacat
gagGACAATGAAGGTGATGTCGAAATGTGAatggcgactGATCAAAACAC
TCACAAATCTGGACCTCTCAAGCAACAGAACAAATCCCACAAGCATGGCC
GTCACAGAACCAAAGGACAAGTGGATAAGTCTCACaaagGGAAAGTTGAT
GTAAAATCTCTTTCaaagaagaataaaaatttggacaaaCAGCAGAGAAG
GCACCAAGCTAAGCAAGTTCGTAAAAATAAAAGGGAAGAggttttagaga
aaaaaagaaaacttggcACAGAACATTCACCACCTCATCTTATTGTAATA
TTCCCTCTTTCAAGTAATTGTAATTGCGAAGAAGCACTTGAATATTTGGT
TGAAAGTGATGATACAATAATTCCTATAAGAAATGAAAATACAACTACAA
TAATATCACCAAGACATCGACAAAGATTTCAAGTCATAATACcacaaaga
aactttttttctgtgTTGAATGCAGCAAAGGTTGCAGATTCATTCTTGTT
TCTCCACCCAGCAAATAATGAAATTgatgaaattggtcaaaaatgTCTGA
CATGCATACTGGCTCAAGGATTACCAACAAATATTCACGCTGTTCAAggC
CTTCGGAATGTCAAAAAGCAAGGAGATGTcaagaaaaatattcaaaagtc
ACTGGAAAAATGgatGCCCTCAGTGAAACTTCATTCATTGGATAGTAAGC
AGGATGGTGAGCTAGTACTCAGACTTTTATCGAaccaaaaacagaaaaga
attTTCTATCGAGAAAACAGGCCTTACATAGTTGCTGATAAAGTTCAATT
CGAATCCAATCAAGACGATGAAAGCAAAGGCACTTTGAAGATATCCGGCT
TTATAAGAGGACAATCATTGTCAGTAAATCGGTTGGTTCATTTGCCACAG
CTAGGCGACTTCCAATTgaaaaagATTGACCTACCAAGAGATCCTTACTC
AATGAAAAGAAAAGACTCAAATTCTAACAATATGGAAGGTGATGAAGACA
ATTCTATGGAAGAGGATGTGAAAACAATTGCAGTTGCTGATCCATCCAAG
CAAGAAACACTTGTCACTGAAGCTGAAGTTGATCCCATGGATGCTGAACA
AACATGGCCTACTGaagaagaaattaaacaagCTCAAGATGAAGCAACAG
CACAAATGGAGACGGAGAGAAAGATAAAGCGAGTACCAAAAGGAACATCT
GAATACCAGGCGGCGTGGATTGATGATGAGGATGATGATAGTGGGGAGAG
TGAGTACGAAGATAGCGAGGACAGCGAAGAGGAGGACATGCAGTATGCTC
AAATGCAACAAAGTGACGATGAACAAGAAGCTGCGGAAGATAAAGAAGAT
TTTGATACCATCAGTGTGGCTGCAACGACGGTgatcaatgatgaaaaata
tGACGCTCAGTTCgatgaagatgaagaacaaAGAcaGTTAGAGAAATACA
GAGACGAGCATGAGAATGAAATGTTCCCCGATGAAATTGATACTCCACAA
GATATCGATGCTAGGGTTCGCTTTCAAAAATACAGAGGACTGAAAAGCTT
TAGAACTTCTCCTTGGGATCCTAAGGAAAACCTTCCATTAGATTATGCAC
GGATtttccagtttcaaaatttcaatcgCACGAAGAAAAGAATCATGAAA
CAATTACAGGATGATGAAGACTGTGCCCTTGGTGGTTGGTATGTGACCAT
ACACGTTAAAGATGTACCAAAAGTGTATTATGAGAATAGAGATACTTCTG
ATCCTCTGGTTGTTTTTGGTCTCATACCTTACGAACAAAAGATGACAGTA
ATGAACTTCGTTTTGAAGAGACATCCTTCTTGTGGAGTACCGATCAAATC
CAAGGAGCGCTTGATCTTCCACGTTGGATATCGAATGTTCAGTGCATGTC
CCATTTTCTCCCAACATACCAACAGTGACAAGTTTAAGGGTGAAAGGTTT
TTACCGCATGATGCTGTTACCATGGCTACAGTATACGCCCCTATTTTCTT
CCCGCCTGCTCCAGTGCTTGTGTTCACAGAGAATTGTGAGCTTCTTGCCA
CTGGAACAGTAGCTGGCTCAAATCCTGATCGGGTGGTCGTCAAAAAGATT
GTATTAAGTGGACATCCcttcaaaatcaataaaaaatccagtgtCGTTCG
ATACATGTTCTTTAGCAGAGagGACATATTATGGTTTAAACCAGTAGAAG
TGTGGACAAAATATGGTCGCAGAGGAAACATCAAAGAAGCCCTAGGAACG
CACGGACACATGAAATGCGTGTTTGACGGTCAGTTGAAAGCGCAGGACAC
TGTTTGTATGAACCTCTTCAAAAGACTCTTCCCCAAATGGACTTATGATC
CTAACATTGATATTCGAAACTTCAAAATGATTACGTCATCAtcagtgatg
acgtcacatgagGACAATGAAGGTGATGTCGAAATGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000582XLOC_000582Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001006-exon-sc0000007-1491911889:630440..630884TCONS_00001006-exon-sc0000007-1491911889:630440..630884Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:630440..630884TCONS_00001006-exon-sc0000007-1510915933:630440..630884Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:630440..630884TCONS_00001006-exon-sc0000007-1575043694:630440..630884Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:633254..633408TCONS_00001006-exon-sc0000007-1491911889:633254..633408Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:633254..633408TCONS_00001006-exon-sc0000007-1510915933:633254..633408Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:633254..633408TCONS_00001006-exon-sc0000007-1575043694:633254..633408Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:633603..633712TCONS_00001006-exon-sc0000007-1491911889:633603..633712Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:633603..633712TCONS_00001006-exon-sc0000007-1510915933:633603..633712Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:633603..633712TCONS_00001006-exon-sc0000007-1575043694:633603..633712Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:634023..634098TCONS_00001006-exon-sc0000007-1491911889:634023..634098Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:634023..634098TCONS_00001006-exon-sc0000007-1510915933:634023..634098Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:634023..634098TCONS_00001006-exon-sc0000007-1575043694:634023..634098Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:634188..634304TCONS_00001006-exon-sc0000007-1491911889:634188..634304Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:634188..634304TCONS_00001006-exon-sc0000007-1510915933:634188..634304Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:634188..634304TCONS_00001006-exon-sc0000007-1575043694:634188..634304Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:634413..634477TCONS_00001006-exon-sc0000007-1491911889:634413..634477Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:634413..634477TCONS_00001006-exon-sc0000007-1510915933:634413..634477Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:634413..634477TCONS_00001006-exon-sc0000007-1575043694:634413..634477Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:634564..634603TCONS_00001006-exon-sc0000007-1491911889:634564..634603Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:634564..634603TCONS_00001006-exon-sc0000007-1510915933:634564..634603Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:634564..634603TCONS_00001006-exon-sc0000007-1575043694:634564..634603Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:635198..635308TCONS_00001006-exon-sc0000007-1491911889:635198..635308Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:635198..635308TCONS_00001006-exon-sc0000007-1510915933:635198..635308Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:635198..635308TCONS_00001006-exon-sc0000007-1575043694:635198..635308Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:635640..635750TCONS_00001006-exon-sc0000007-1491911889:635640..635750Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:635640..635750TCONS_00001006-exon-sc0000007-1510915933:635640..635750Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:635640..635750TCONS_00001006-exon-sc0000007-1575043694:635640..635750Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:635919..635978TCONS_00001006-exon-sc0000007-1491911889:635919..635978Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:635919..635978TCONS_00001006-exon-sc0000007-1510915933:635919..635978Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:635919..635978TCONS_00001006-exon-sc0000007-1575043694:635919..635978Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:636140..636293TCONS_00001006-exon-sc0000007-1491911889:636140..636293Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:636140..636293TCONS_00001006-exon-sc0000007-1510915933:636140..636293Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:636140..636293TCONS_00001006-exon-sc0000007-1575043694:636140..636293Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:638228..638418TCONS_00001006-exon-sc0000007-1491911889:638228..638418Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:638228..638418TCONS_00001006-exon-sc0000007-1510915933:638228..638418Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:638228..638418TCONS_00001006-exon-sc0000007-1575043694:638228..638418Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:640134..640163TCONS_00001006-exon-sc0000007-1491911889:640134..640163Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:640134..640163TCONS_00001006-exon-sc0000007-1510915933:640134..640163Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:640134..640163TCONS_00001006-exon-sc0000007-1575043694:640134..640163Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:640320..640396TCONS_00001006-exon-sc0000007-1491911889:640320..640396Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:640320..640396TCONS_00001006-exon-sc0000007-1510915933:640320..640396Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:640320..640396TCONS_00001006-exon-sc0000007-1575043694:640320..640396Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:640786..641029TCONS_00001006-exon-sc0000007-1491911889:640786..641029Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:640786..641029TCONS_00001006-exon-sc0000007-1510915933:640786..641029Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:640786..641029TCONS_00001006-exon-sc0000007-1575043694:640786..641029Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:642849..642959TCONS_00001006-exon-sc0000007-1491911889:642849..642959Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:642849..642959TCONS_00001006-exon-sc0000007-1510915933:642849..642959Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:642849..642959TCONS_00001006-exon-sc0000007-1575043694:642849..642959Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:643157..643219TCONS_00001006-exon-sc0000007-1491911889:643157..643219Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:643157..643219TCONS_00001006-exon-sc0000007-1510915933:643157..643219Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:643157..643219TCONS_00001006-exon-sc0000007-1575043694:643157..643219Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:643499..643582TCONS_00001006-exon-sc0000007-1491911889:643499..643582Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:643499..643582TCONS_00001006-exon-sc0000007-1510915933:643499..643582Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:643499..643582TCONS_00001006-exon-sc0000007-1575043694:643499..643582Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:644224..644455TCONS_00001006-exon-sc0000007-1491911889:644224..644455Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:644224..644455TCONS_00001006-exon-sc0000007-1510915933:644224..644455Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:644224..644455TCONS_00001006-exon-sc0000007-1575043694:644224..644455Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:644783..644857TCONS_00001006-exon-sc0000007-1491911889:644783..644857Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:644783..644857TCONS_00001006-exon-sc0000007-1510915933:644783..644857Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:644783..644857TCONS_00001006-exon-sc0000007-1575043694:644783..644857Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1491911889:645190..645717TCONS_00001006-exon-sc0000007-1491911889:645190..645717Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1510915933:645190..645717TCONS_00001006-exon-sc0000007-1510915933:645190..645717Clytia hemisphaericaexon
TCONS_00001006-exon-sc0000007-1575043694:645190..645717TCONS_00001006-exon-sc0000007-1575043694:645190..645717Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001006-proteinTCONS_00001006-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:630440..645717 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
53.1177 51.2195 25.9214 20.4304 105.39 82.6874 62.1566 67.5489 44.3238 52.2183 49.0563 45.4859 80.0261 94.6853 67.7925 77.166 55.9943 61.4728 34.6913 42.146 82.2767 81.1845 67.0834 68.0757 101.744 122.11 37.0362 49.9456 46.7317 57.1877
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012948AARP2CN
IPR007034BMS1_TSR1_C
IPR015943WD40/YVTN_repeat-like_dom
IPR030387G_Bms1/Tsr1_dom
Vocabulary: Biological Process
TermDefinition
GO:0042254ribosome biogenesis
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0042254 ribosome biogenesis
cellular_component GO:0005634 nucleus
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001006 vs. Swiss-Prot (Human)
Match: TSR1 (Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 385/791 (48.67%), Postives = 530/791 (67.00%), Query Frame = 1
Query:  355 THKSGPLKQQNKSHKHGRHRTKGQVDKSHKGXXXXXXXXXXXXXXXXXX-RRHQAKQXXXXXXXXXXXXXXXXGTEHSPPHLIVIFPLSSNCNCEEALEYLVESDDTIIPIR---NENTTTIISPR--HRQRFQVIIPQRNFFSVLNAAKVADSFLFLHPANNEIDEIGQKCLTCILAQGLPTNIHAVQGLRNV--KKQGDVKKNIQKSLEKWMPSVKLHSLDSKQDGELVLRLLSNQKQKRIFYRENRPYIVADKVQFESNQDDESKGTLKISGFIRGQSLSVNRLVHLPQLGDFQLKKIDLPRDPYSM--------KRKDSNSNNMEGDEDNSMEEDVKTIAVADPSKQETLVTEAEVDPMDAEQTWPTEEEIKQAQDEATAQMETERKIKRVPKGTSEYQAAWIXXXXXXXXXXXXXXXXXXXXXXMQYXXXXXXXXXXXXXXXXXXFDTISVAATTVINDEKYDAQFDEDEEQRQLEKYRDEHENEMFPDEIDTPQDIDARVRFQKYRGLKSFRTSPWDPKENLPLDYARIFQFQNFNRTKKRIMKQLQDDED-CALGGWYVTIHVKDVPKVYYENRDTSDPLVVFGLIPYEQKMTVMNFVLKRHPSCGVPIKSKERLIFHVGYRMFSACPIFSQHTNSDKFKGERFLPHDAVTMATVYAPIFFPPAPVLVFTENC----ELLATGTVAGSNPDRVVVKKIVLSGHPFKINKKSSVVRYMFFSREDILWFKPVEVWTKYGRRGNIKEALGTHGHMKCVFDGQLKAQDTVCMNLFKRLFPKWTYDPNI 2664
             H+ GPLKQQNK+HK GRHR +G   +  KG++ +K+LSKK +    +  +RH+A Q+RK K+E VL +KR+LG +  PPH +++ PL S  +  EA++ L + D   + +    N     ++ PR  HR  F    P  +   VL+ AKVAD+ LFL       D  G  CL+C+ AQGLPT   AVQG+  +  KKQ D +K + K++EK  P  KL  LD++Q+  ++LR L+NQKQ+ + +R+ R Y+ A  V F  ++++   GTLKISG++RGQ+L+VNRL+H+   GDFQ+K+ID P DP+ +        K  D        D  + MEE +K +  ADP +QE+L  E   DPM+ EQTWPTEEE+ +A+D      E+ + +K+VPKGTS YQA WI D    SG    E   D     M++    + + + E++E++E+++T+++  +  ++D+ YD + DE+ E + LEKY+ E   EMFPDE+DTP+D+ AR+RFQKYRGLKSFRTSPWDPKENLP DYARIFQFQNF  T+K I K++++ E   A  GWYVT+HV +VP    E      PL+ F L+P+EQKM+V+N V++R P    P+K+KE LIFH G+R F A P+FSQHT +DK K +RFL  D   +ATVYAPI FPPA VL+F +       L+ATG +   +PDR+V+K++VLSGHPFKI  K +VVRYMFF+RED+LWFKPVE+ TK+GRRG+IKE LGTHGHMKC FDG+LK+QDTV MNL+KR+FPKWTYDP +
Sbjct:    3 AHRPGPLKQQNKAHKGGRHRGRGSAQRDGKGRLALKTLSKKVRKELSRVDQRHRASQLRKQKKEAVLAEKRQLGGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNFMLLCPRLKHRWFFTSARPG-DLHVVLDMAKVADTILFLLDPLEGWDSTGDYCLSCLFAQGLPTYTLAVQGISGLPLKKQIDTRKKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDRRAYLFAHAVDFVPSEENNLVGTLKISGYVRGQTLNVNRLLHIVGYGDFQMKQIDAPGDPFPLNPRGIKPQKDPDMAMEICATDAVDDMEEGLKVLMKADPGRQESLQAEVIPDPMEGEQTWPTEEELSEAKDFLK---ESSKVVKKVPKGTSSYQAEWILDGGSQSGGEGDEYEYDD----MEHEDFMEEESQDESSEEEEEYETMTIGES--VHDDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYV 783          
The following BLAST results are available for this feature:
BLAST of TCONS_00001006 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TSR10.000e+048.67Pre-rRNA-processing protein TSR1 homolog OS=Homo s... [more]
back to top