Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001006-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001006-protein
Unique NameTCONS_00001006-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length802

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001006-protein ID=TCONS_00001006-protein|Name=TCONS_00001006-protein|organism=Clytia hemisphaerica|type=polypeptide|length=802bp
MATDQNTHKSGPLKQQNKSHKHGRHRTKGQVDKSHKGKVDVKSLSKKNKN
LDKQQRRHQAKQVRKNKREEVLEKKRKLGTEHSPPHLIVIFPLSSNCNCE
EALEYLVESDDTIIPIRNENTTTIISPRHRQRFQVIIPQRNFFSVLNAAK
VADSFLFLHPANNEIDEIGQKCLTCILAQGLPTNIHAVQGLRNVKKQGDV
KKNIQKSLEKWMPSVKLHSLDSKQDGELVLRLLSNQKQKRIFYRENRPYI
VADKVQFESNQDDESKGTLKISGFIRGQSLSVNRLVHLPQLGDFQLKKID
LPRDPYSMKRKDSNSNNMEGDEDNSMEEDVKTIAVADPSKQETLVTEAEV
DPMDAEQTWPTEEEIKQAQDEATAQMETERKIKRVPKGTSEYQAAWIDDE
DDDSGESEYEDSEDSEEEDMQYAQMQQSDDEQEAAEDKEDFDTISVAATT
VINDEKYDAQFDEDEEQRQLEKYRDEHENEMFPDEIDTPQDIDARVRFQK
YRGLKSFRTSPWDPKENLPLDYARIFQFQNFNRTKKRIMKQLQDDEDCAL
GGWYVTIHVKDVPKVYYENRDTSDPLVVFGLIPYEQKMTVMNFVLKRHPS
CGVPIKSKERLIFHVGYRMFSACPIFSQHTNSDKFKGERFLPHDAVTMAT
VYAPIFFPPAPVLVFTENCELLATGTVAGSNPDRVVVKKIVLSGHPFKIN
KKSSVVRYMFFSREDILWFKPVEVWTKYGRRGNIKEALGTHGHMKCVFDG
QLKAQDTVCMNLFKRLFPKWTYDPNIDIRNFKMITSSSVMTSHEDNEGDV
EM
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000582XLOC_000582Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001006TCONS_00001006Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR012948AARP2CN
IPR007034BMS1_TSR1_C
IPR015943WD40/YVTN_repeat-like_dom
IPR030387G_Bms1/Tsr1_dom
Vocabulary: Biological Process
TermDefinition
GO:0042254ribosome biogenesis
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0042254 ribosome biogenesis
cellular_component GO:0005634 nucleus
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 41..61
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..326
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..439
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..70
IPR012948AARP2CNSMARTSM00785aarp2cn2coord: 225..306
e-value: 8.6E-27
score: 105.0
IPR012948AARP2CNPFAMPF08142AARP2CNcoord: 229..305
e-value: 1.2E-23
score: 82.8
IPR007034Ribosome biogenesis protein BMS1/TSR1, C-terminalSMARTSM01362DUF663_2coord: 485..766
e-value: 7.3E-174
score: 593.6
IPR007034Ribosome biogenesis protein BMS1/TSR1, C-terminalPFAMPF04950RIBIOP_Ccoord: 486..768
e-value: 2.1E-121
score: 404.8
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 2..701
e-value: 0.066
score: 11.3
IPR030387Bms1/Tsr1-type G domainPROSITEPS51714G_BMS1coord: 84..248
score: 21.146

Blast
BLAST of TCONS_00001006-protein vs. Swiss-Prot (Human)
Match: TSR1 (Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 387/791 (48.93%), Postives = 535/791 (67.64%), Query Frame = 0
Query:    7 THKSGPLKQQNKSHKHGRHRTKGQVDKSHKGKVDVKSLSKK-NKNLDKQQRRHQAKQVRKNKREEVLEKKRKLGTEHSPPHLIVIFPLSSNCNCEEALEYLVESDDTIIPIR---NENTTTIISPR--HRQRFQVIIPQRNFFSVLNAAKVADSFLFLHPANNEIDEIGQKCLTCILAQGLPTNIHAVQGLRNV--KKQGDVKKNIQKSLEKWMPSVKLHSLDSKQDGELVLRLLSNQKQKRIFYRENRPYIVADKVQFESNQDDESKGTLKISGFIRGQSLSVNRLVHLPQLGDFQLKKIDLPRDPYSM--------KRKDSNSNNMEGDEDNSMEEDVKTIAVADPSKQETLVTEAEVDPMDAEQTWPTEEEIKQAQDEATAQMETERKIKRVPKGTSEYQAAWIDDEDDDSGESEYEDSEDSEEEDMQYAQMQQSDDEQEAAEDKEDFDTISVAATTVINDEKYDAQFDEDEEQRQLEKYRDEHENEMFPDEIDTPQDIDARVRFQKYRGLKSFRTSPWDPKENLPLDYARIFQFQNFNRTKKRIMKQLQDDED-CALGGWYVTIHVKDVPKVYYENRDTSDPLVVFGLIPYEQKMTVMNFVLKRHPSCGVPIKSKERLIFHVGYRMFSACPIFSQHTNSDKFKGERFLPHDAVTMATVYAPIFFPPAPVLVFTENC----ELLATGTVAGSNPDRVVVKKIVLSGHPFKINKKSSVVRYMFFSREDILWFKPVEVWTKYGRRGNIKEALGTHGHMKCVFDGQLKAQDTVCMNLFKRLFPKWTYDPNI 776
             H+ GPLKQQNK+HK GRHR +G   +  KG++ +K+LSKK  K L +  +RH+A Q+RK K+E VL +KR+LG +  PPH +++ PL S  +  EA++ L + D   + +    N     ++ PR  HR  F    P  +   VL+ AKVAD+ LFL       D  G  CL+C+ AQGLPT   AVQG+  +  KKQ D +K + K++EK  P  KL  LD++Q+  ++LR L+NQKQ+ + +R+ R Y+ A  V F  ++++   GTLKISG++RGQ+L+VNRL+H+   GDFQ+K+ID P DP+ +        K  D        D  + MEE +K +  ADP +QE+L  E   DPM+ EQTWPTEEE+ +A+D      E+ + +K+VPKGTS YQA WI D    SG     + ++ E +DM++    + + + E++E++E+++T+++  +  ++D+ YD + DE+ E + LEKY+ E   EMFPDE+DTP+D+ AR+RFQKYRGLKSFRTSPWDPKENLP DYARIFQFQNF  T+K I K++++ E   A  GWYVT+HV +VP    E      PL+ F L+P+EQKM+V+N V++R P    P+K+KE LIFH G+R F A P+FSQHT +DK K +RFL  D   +ATVYAPI FPPA VL+F +       L+ATG +   +PDR+V+K++VLSGHPFKI  K +VVRYMFF+RED+LWFKPVE+ TK+GRRG+IKE LGTHGHMKC FDG+LK+QDTV MNL+KR+FPKWTYDP +
Sbjct:    3 AHRPGPLKQQNKAHKGGRHRGRGSAQRDGKGRLALKTLSKKVRKELSRVDQRHRASQLRKQKKEAVLAEKRQLGGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNFMLLCPRLKHRWFFTSARPG-DLHVVLDMAKVADTILFLLDPLEGWDSTGDYCLSCLFAQGLPTYTLAVQGISGLPLKKQIDTRKKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDRRAYLFAHAVDFVPSEENNLVGTLKISGYVRGQTLNVNRLLHIVGYGDFQMKQIDAPGDPFPLNPRGIKPQKDPDMAMEICATDAVDDMEEGLKVLMKADPGRQESLQAEVIPDPMEGEQTWPTEEELSEAKDFLK---ESSKVVKKVPKGTSSYQAEWILDGGSQSGG----EGDEYEYDDMEHEDFMEEESQDESSEEEEEYETMTIGES--VHDDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYV 783          
The following BLAST results are available for this feature:
BLAST of TCONS_00001006-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TSR10.000e+048.93Pre-rRNA-processing protein TSR1 homolog OS=Homo s... [more]
back to top