Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000993 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000993
Unique NameTCONS_00000993
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2327

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000993 ID=TCONS_00000993|Name=TCONS_00000993|organism=Clytia hemisphaerica|type=transcript|length=2327bp
TTTCCATATTTTCGCTTTGTTTTAGATAATGAGTCTCAATATTTGAGCAT
AAAAATCTCCACTTTTGCTtatatttgaatctttttttctcACCAGTACA
AAATAAATTATAACAACAATATTACATAATGgcaccaaaaaataagaatg
atGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAG
GCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCACACA
AGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGATT
ATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTTC
TGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGAA
ACCTGACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAGT
GCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGATT
CGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAAT
AGAAAACATCCTTGAACACCACAAGGTTcaacgaaagaaagagaagaatc
TGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGG
TGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACACACATCAAAT
CGTTCAATATCAGAAATCTCATGCATGCACATCATTTGATCTTTCAAATA
ATGTTTGGATGAATGGTCGGGACGTTGATATTCATTACAACCTCAGTTTC
ACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAA
TTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAACG
AAGATATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATAT
TCATGTCGTGTCAATGATCTACACATGTATAATGCTATCAGTTTGGACTT
ATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGTCCTT
TGGGAAGAAATAATGTTTATATtcataatgacgtcatcgttgAAAAAGAT
TGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGA
AAAAACCCATATCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGAA
AAAATGTGACTATAAAAAATTCGTATATTTGGGATAACACTGTGATAGGA
GATGATTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCAA
TAGAAATGTAAAAATGGTTGATGCAATGATATCTTATAACGTTTGCATTG
ATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCA
GATTCTGATGGTTTCGgtgatgacgatgatgatgacAGTGACATcgatga
aaatatgaaaaaattgaaaatccaaGATAAAAAAGATTATGATATCGAGA
TTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTA
GAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGACATCAGATGG
AGAGAGCAAcagtgaagatgaagatgaagactCCACACCAAACTCTCCAC
AACCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAAT
TTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGA
AATCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTC
AGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGATACT
CCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCA
TCCACTgttattgaaatatttcaacacTGCAGAAACACAAACATACGCTA
TAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTAT
TATGTTTTACCATCGATCATCCACAAACTATATGATGCTGACGTTTTGGA
TGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACG
ACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACCT
AATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGA
CagtgatgaagaagaagatgaatgAGAAACTATTTTTTGAGTAAATCGTA
TTTTTTATGTCTAGATTTTTATTTaagatgaattttcaaaatagaaatag
TTAAATAACAAATTGAATCATTTTGCA
Run BLAST on NCBI

protein sequence of TCONS_00000993-protein

>TCONS_00000993-protein ID=TCONS_00000993-protein|Name=TCONS_00000993-protein|organism=Clytia hemisphaerica|type=polypeptide|length=698bp
MAPKNKNDAGSTSWRSEDEKEKVQAVVIADSFNRKFTPITQETPRALLPL
GNKVLIDYTIEYLMNAGVNEIIVFCCAFGERIREYVNNNWKPDKNFTINC
VLSSVTECISLGDALREIDREGLIRSDFLLVPGDLMCNIQIENILEHHKV
QRKKEKNLVMTMLYRELAPGHFSRCKEEDAFIAMDSDTHQIVQYQKSHAC
TSFDLSNNVWMNGRDVDIHYNLSFTHVALCSPQVAPLFTDNFDYQTLDDF
VKGVLINEDIMGDKINGAIIREGYSCRVNDLHMYNAISLDLLGRWTYPIT
VDNTSCPLGRNNVYIHNDVIVEKDCTLKTKVLVGKGTIIGEKTHITQSTI
GANCKIGKNVTIKNSYIWDNTVIGDDCYIVQSIICENCQINRNVKMVDAM
ISYNVCIDEGMELKPCTRLSLKKPDSDGFGDDDDDDSDIDENMKKLKIQD
KKDYDIEIVGANGKGFLWPYDMEVEGNIPSLTGNDYETSDGESNSEDEDE
DSTPNSPQPELSNLHQFHIEVVENLKSGYLEKIAADNIALEINASKFKFN
ISIPELCQTVAKALLEMCLKHDDTPKTEQVKEFGKITKGLHPLLLKYFNT
AETQTYAINSIEEHFLTSIEEVAYYVLPSIIHKLYDADVLDEAVILRWYA
CPHEISDDHIIIREENRTLLRKTPNLLKFVNWLQEAEEEDDSDEEEDE
Run BLAST on NCBI

transcript from alignment at sc0000007:393757..403713+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000993 ID=TCONS_00000993|Name=TCONS_00000993|organism=Clytia hemisphaerica|type=transcript|length=9957bp|location=Sequence derived from alignment at sc0000007:393757..403713+ (Clytia hemisphaerica)
TTTCCATATTTTCGCTTTGTTTTAGATAATGAGTCTCAATATTTGAGCAT AAAAATCTCCACTTTTGCTtatatttgaatctttttttctcACCAGTACA AAATAAATTATAACAACAATATTACATAATGgcaccaaaaaataagaatg atGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAG GCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCACACA AGAAACACCAAGGGTattatattcattgaaaatttgaaatcgatgCAATG TCCCATGGCATATTATTTTGTACTGTGTTAAAAGAGTATCCCTGAAGCTC AAAAAAGCATTTTCGTCTCAAATTCAGCTAAAGTTAATGAAATTATCATt aagaattttggttaattttttGTGTAAAGTCTAATTTCTGTCTCTAAGAA GAAAAATTGCCTTTAGACTGATGCTTATATTTTAGTAATatgattttgaa acttttttgtccGTTCTAGGCATTGTTGCCACTAGGGAATAAAGTGCTGA TAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATT GTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAGTATGT TTACCTTATGTATGTTTACTTTGTACTAAAATGccaaattttaattcact taGAGTGCTTAATCTGCTTACCTGCTTACCTTTTCAACCTGCTTACTCTA TCCATCATAGCTGTCTTGAGTTCTTCTTGAAGCAAGCCAGTGTCAAAAAT TGCttccttaaaaaaaattagggTAGGATTTAaagaatattatttttttc atcttagtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTA TTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAAT TGATAgagaagtaattcttttcatAATGTTTTAATGTCTCATATTTTGTA ATCAGCTGCATTTATGAAAATCTAGTGTCTCCAAAGGCTTTTGATCTTTT TATTCATCTCTTTGCATTACTATTTGCTGTAATTTCAGGGCTTGATTCGT TCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAGA AAACATCCTTGAACACCACAAGTAAGTATGAGTCTGGAAAAGCCATTTAC TACGAGACTTTGCACAGACTAGTGAGTAATGGAAAAAAATCAGTTTCCAC CCATTGATCGGTTTCATTTTAGGGTTcaacgaaagaaagagaagaatcTG GTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTG TGTTGcaaatgattttttctttctttaaaaacatattAACTTGGTAGCAC AATAAAAGGAGGGAAtcactttctttctttctatGATGATATTCTTTACA ATACATTCAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGAC ACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTTGA TCTTTCAAATGTAAGTTGATACTTTCCCAGTCTctatgaaaattttccag ataTTCACTTTGTTTTGGTAGTGAGTATGATTTGTGCATTACAAAATGac gaattttctttcttctcttaGAATGTTTGGATGAATGGTCGGGACGTTGA TATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGG TATAGTTTATGTTTGTAAACGTTCTTGTGTTTAAGCGGTTGTAATTATTT TCACCGTGGAAACGCTACCATTTTAATATAAAAACCTTGTTGAAATCAGA TATCAGAAGAACATATTaacattgtttttcttttctttacttGATAGTGA AAATGATGGATTTCTTCTTTGTTCACAGGTGGCACCTTTGTTTACAGATA ATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAAC GAAGATGTAAGATTAATATTGAAACTAAATTATGATTACATTTTGTTAGT CTATATCTGTTATATTCTTTACTCATCAGAAAGTCTTTAGACTGCATGCT TTGTATTAGCCCAATTGCAATAATTTTGACTGCAAATGCGTTTTTGCAAG ATAAATGGATAATTTTAATGATGTTTTAGATCATGGGTGACAAAATCAAC GGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACAT GTATAATGCTATCAGGTAATGAGAGAGACTGAGAGAAGCTTGAAATTTCA CTTGTAATATACATGTCTGGTCTATTGACTTCATCAATCTTTCTTCCATC GGTCGCTTCTCTTATTGTCCCAtaatgttttgtttactttcagTTTGGAC TTATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGTCC TTTGGGAAGAAATAATGTTTATATtcataatgacgtcatcgttgAAAAGT AAGCCtctaaaattttgatattaaaatgagttttaatttcgcttagTATT ACGTAGTTACTTGTTACGCAATAAACACTTAgagaaaatttcaagaattt ctttATTTGATTCTCTTGGTTGAATGTGCTCATAGCGTTCTGAAATACAG TATAACATGTATGTGTTTAATTTATTCGCTTTattattgctccggcctag gagcctttaattctctcttccgacaacaacggtcaagacatttttttttg tttatctaatccgatgatctattccgatttaataaaaacggattatctgg atttcgataacattgcgaaagtatttagaaaaagatggctgccgaaagtg ggcttAGCTGCAAATCTTCGTGAAAGAtagtgatcattttcatcattatt catgatgttttggacatgatttatgagaagtttgatgcatactggtctat aacaatgtggaaagactttggagaaattttggccgtgaatcgtcagctgc tcgagtgcttaaatcttgcatatgatGACTAACTTCTCTAGACTAGTTTT ATGGAcgcacaaaaccataaaactctgtaacttgacaatggaatgaaact ttcaaacacacatccattggaattcgaaagagaatactaaaattacaaca ttacagtgcaaatttgaaaacgatctgaacAGTTTTTGAGGTGTTATATG Tgatgtgtatggctgaaaatgatcctgtcctgttttgtattcatcatttt ttgactgggcgaccgttccttttgatttttcaaacccgacacagatattt tacaaacatatcactatgagaattcaataaaggatactaaaacacaattc ctgtgtaaatttgaacaagattggaaaagATTTCACAGtatttatggctg aaaatgagcgtttttggactttgttgtaatttcattgcggctggcgaccg ttccttttgatttttcaaacccgacacagatattttacaaacatatcact atgagaattcaataaaggatactaaaacacaattcctgtgtaaatttgaa caagattggaaaagATTTCACAGtatttatggctgaaaatgagcgttttt ggactttgttgtaatttcattgcggctggcgaccgttccttttgattttt caaacccgacacaaatattttacaaacatatcactatgagaactgatgag aattcaataacggatactaaaacacaattcctgtgtaaatttgaacaaga ttgtggactttgtcaaaatttcattgcggctggcgatcgttccttttgat ttttcgaacctggcacagatttttcacaaacatatcactatgagaattca gtaaaggatactacaacacaattcctgtgtaaatttgaacaagatcggag aaattttcactaTATTATCactgaaaatgatcatttttgaactttgtatc gtaccgtcaactgctccaacctGGGGcaagtgtacgcaacatgggacttg ttgatatctggtctgtattttcacttactgtaaaatcgaaagagaaattg tgtattttttaatatgcggtttattaaactcaaatctaatgacttttgag gttcggtgaaatgttGGTGGAATGGCcctcccatgttgcgtaagatagtc ccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgcaataga attattactttgctttctgatctgttctgattagcagtttgtgggcaacg ttctaacacaactaactcaacaagctcatcttttaatctcttaagccgga gcttccagcgcagctggtttatttgtttaaatttttgacTATCTTGATTG TACATGTGCTTAAACTCTCTAGAGATTGTACGTTGAAGACAAAAGTGTTG GTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTAC TATAGGAGCTAATTGTAAAATAGGTATGTCCGCAATATTATAGTTGTCGT TGTTTTTTGTTCAGCATTAAAGATTTTATTCATTTGCTCAGGTTACATAT GAGTGGTCTGAGTGCAACTTGAGAATAATTATGTataaaaaagttcatta tttttataagagtCAGGGGCCTCGTCTTCAAAGTGTTTGCTTCAAAATAA TTCTGCGCCATACtaagtttttgtaaaaagtctTTAGGCTAGTTATCTAG TTTTCTCTTGATTTCAGGAAAAAATGTGACTATAAAAAATTCGTATATTT GGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATT TGTGAAAACTGTCAAATCAATAGGTTGGTATACATTGTTTAACCCATTAA ATGCCATCAATTCAGACTTTCAAGTATTTTTCGACGTCAAATGCGCGTAC AGATTCTTGACTTAGTTTTGTGCTCGGGTAGGGTCAAAAATGGGGTGGGT TGGGTTGCAGGGCTAAGGTACAGATCCGAAAAACTGAACGATCTCATTAT GAAGCCAGTGACACTGAATGTTTTAATCCTACCTTCTTTTTGCAATAGCC TACGTCATAAGGACATAACAAACAAAATACAAACGATGctttttcaatga aatgaaattcTTAAAACTCTTCATTCTAGAAATGTAAAAATGGTTGATGC AATGATATCTTATAACGTgagtaaaatttttctcaatCAACAATATTAAG TTTTGAATTGAACGATAGAATTCATGGTAAAAACTATACTTTACTTGTTA AATAAACCAACAAATCTTGCATTAAAGTGATTCTTCTGCTCCTTTAAGTG TAGTCAAATTTGTGTCATTCTTGCGCAGGTTTGCATTGATGAAGGAATGG AATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGT TTCGgtgatgacgatgatgatgacAGTGACATcgatgaaaatatgaaaaa attgaaaatccaaGATAAAAAAGGTCTGCTCAATCTCTTAatattttgtt ggttgatattTTCTAATACTAGTCTCCAAATTACTAGTTATCTGCTTTGT TTGGTCTTGGTCAAGTTAATTTCctcaaatttgtattttctgTAGCTTTC AAGAATTAAGGATAGAACATAACAAACTATATTATACTATTGTATGATTT CAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGG CCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGTACAAG AACTAGTTAGTTAGTTGAATCATACTCTCTTTCCTTGTCCATACAGTTCA CAGACTGTAATATCAACGATTTTCTAAATGCTGAAACAAATTTTCACACC CCTTATGAACCGTTTTTAAGTACCCGTTTTCGAAAAATTCGTCTGGTCTG CGAAAAAGTGTTATAGTCTTGAAGATTAGAACTTGGTTAAGGATTGTAAG TGATCGCTGTACACGAAAAGCATTAAACAAACCAACCATGCTGACGTTTT AGGGAACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaag atgaagactCCACACCAAACTCTCCACAACCTGAACTCTCCAATTGTATG CATCTGTTATTTGGGGGAATCTCCTCATCGACTTCGCTGACCTTTCCCTT CAAGTTTTTGATTTCCaagaaaattcttttcaaagttttgcCTCTGTTTT GCCTTAATTCTTTTTATGAGcgtttttcaacattttttttaattcatcac TGACATTCTTTTTCGACTCCCTTAATTGGAATTCATAACATATTTTCTTT TCGTTTACATAATATGCACTTTCTTCGCAAGGTTGCAAGAGAGTCAGAAG AGTTTACAACTCCACTCCAGTGGTCATTTAACGCTCCGTCTGTAGAAGAA CCTTCAAATATATTTCTCCTTCAATTTCACTTCACTTGCTCTTTAGTGCA CCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGA AAATTGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTAAGTC CCACAAATTTATTCGAGACcttaaaattttgagattcgCTGCTGGTGAAT TTGATTGGCTTCCACAATACCAAAAACgtatgaaaaattcttttctacGT GAAGACCTGAAAAAGACTGTCTCATTATAATCTGCAGCAGAATAAAAAAT AGCTATAACTTTTAATAGAATTTAAATTGGAAAGCGGTTTTGTGTTCGTC GAAAAGATAGTCAAGAGTGAAATGTTATCACATTTAAAAAAACCCTCTta tattttatgacttttcgatcacttttaaaggttttatgaGGTGTGAGATT TTTTGCCCACTCCCTCCCAAGATTATTATTCCCAAGAAGCCTGGGCTCTA TTGTTCGTATTGTTAGAATATCTGctttttattggacctaccccggtgga ggtcctataaattaacctctgtgcgttcgttcgtttgttcgttcgtttgt tcgttcgttaccaacttttctcacttggctcattagttttttctgatttt ttgcataaagatgtgtagctataaaccctcgaatgtgacggagcccgatt ttcgaaaaaaaaattttttgggcaaatttgggccaaaaaacggctaaaaa atgggtattttggactttgttataaattgcatcattaattttttctgatt ttttgtatgaaagtagggtaccatcataggtaaaagatggctcaagcaga ttttcgcaaaagaattttgttgactcaaaaaacgcatgtttatctataag aatcactattaataagcatacatcaatgttcttagtcaaattactcaatt tttttatgagacagatgtttttttgctcatgagggcttacttttaaagaa tatgtgtgtttagacataaaattttgtttgcttggcgtgattttattgaa aaactggccaaattcgctatttttttataagcacattatcaataacttag gtattagcttttctcgagattggctgttttattctttatgatatttttgc acaaagatgcataactataaaccctcgaatgtgacggagctcgatttttg agaaaaaatttttggggtagatttcagctaaaaaacggccaaaaaaagag tttttcgGACTTCGTGAAATAtttggatcgttgtttttttctgatttttt gcatgaaattaggtaaaagatggctcaagcagatttttgtaaaaaaaatt tttcagctcaaaaaacgtatctttatccataagaatcactattaataagc ataaattaatgttcttagccaaattggtcaattttttgaaGAGATGAATG tctttttgctcacgaagtcttgaatatgaaagaatatttcacgagcatga aattttagtttctaaatgttttttttataagaaacaaatgacttatttta atagatcgtcaatatttgtgttctgaatgattgtttaatggtcacgtcac gtagatatcaattataaatgtgttaaatgcttaaccaggtaggtccataa aagtatcacttgtttttctcTAGGTTCAAGTTCAACATCAGTATACCAGA GCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACG ACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGGTAAGAAAA TATACCTTAAAATGCTATTCATAGAATACCTCTTGGGTGAATTTGACTGA AAATGAGTGTTAGTTgttggagttttttttttttataaNAGTTTGGAAAG GTAAGAAAATATACCTGTAAAATGCTATTCATAGAATACCTCTAGGGTGA TTTTGACTGAAAATGAGTGTTAGCTGTTGgagttttttttatatagaaaT CATTCCTTTTTCAGATCACCAAAGGTTTGCATCCACTgttattgaaatat ttcaacacTGCAGAAACACAAACATACGCTATAAACTCCATAGAGGTATA ACCACAAACTTCAAATCTCTGTTAGATTCAATCTTTACATATCTACAGTT GGTTGTTCCTtctgtattttaagaaataagatACCGTGCAATAAATAATA TTTCTATTCCAAGGGCATTGGATGACtattaaatttgatattttgtagGA GCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGA TCATCCACAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTG AGGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCATATCATCATCCG TGAAGAAAACAGGACTCTGCTACGAAAAACACCTGTAAGTGAAGTGATTT CTATGAACACTTGCCTCGGTTTTATACTTTACTTTGTTGTAAAATCCTAT TCTTTgccacggcatgacgtcagaactggagtacaacagaacacttacta aagattaattatgtgttttcagtaaacataatctttcagtgagttaaacc atagtgtttgttttaccctcgaaatttttaaatcttattggttgaaaaag atgtcacaCGACTTTCCGTGGCAAAAATCGTTAAAATGTTGACAAAGGTT TTTAAGGAGTTATGGATTAcctttttgattaattttgtaCGATGTTAATT TACACCATTCTCTCTTACCTTCACCATCAGAATTTGTTGAAATTCGTGAA TTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatg aatgAGAAACTATTTTTTGAGTAAATCGTATTTTTTATGTCTAGATTTTT ATTTaagatgaattttcaaaatagaaatagTTAAATAACAAATTGAATCA TTTTGCA

Coding sequence (CDS) from alignment at sc0000007:393757..403713+

>TCONS_00000993 ID=TCONS_00000993|Name=TCONS_00000993|organism=Clytia hemisphaerica|type=CDS|length=44037bp|location=Sequence derived from alignment at sc0000007:393757..403713+ (Clytia hemisphaerica)
ATGgcaccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGA
AGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACA
GAAAATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTA
GGGAATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGG
AGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAG
AATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGT
GTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGA
AATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTG
ACTTGATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTT
caacgaaagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATT
AGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAA
TGGATTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGC
ACATCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGA
TATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGG
TGGCACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTC
GTCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGG
AGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGT
ATAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACA
GTGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataa
tgacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGG
GTAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATA
GGAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATAT
TTGGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCA
TTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATG
ATATCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCAC
GCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatg
atgatgacAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGAT
AAAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTT
ATGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGA
ACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaa
gactCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATT
CCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTG
CTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAAC
ATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAAT
GTGTTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTG
GAAAGATCACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacT
GCAGAAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGAC
GTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAAC
TATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCT
TGCCCTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAG
GACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTAC
AAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATG
gcaccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGA
CGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAA
AATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGG
AATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGT
CAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAAT
ATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTA
TTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAAT
TGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACT
TGATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaa
cgaaagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGC
TCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGG
ATTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACA
TCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATAT
TCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGG
CACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTC
AAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGC
CATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATA
ATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTG
GATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatga
cgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTA
AAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGA
GCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTG
GGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTT
GTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATA
TCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCG
GCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatg
atgacAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAA
AAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATG
GCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACG
ACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagac
tCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCA
TATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTG
CTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATC
AGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTG
TTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAA
AGATCACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCA
GAAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTC
TATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTAT
ATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGC
CCTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGAC
TCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAG
AAGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGgca
ccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGA
AAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAAT
TTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAAT
AAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAA
TGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATG
TTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTA
TCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGA
TAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGA
TGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacga
aagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCC
TGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATT
CTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCA
TTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCA
TTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCAC
CTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAA
GGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCAT
CATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAATG
CTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGAT
AATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgt
catcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAG
GAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCT
AATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGA
TAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTG
AAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCT
TATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCT
TTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatg
acAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAA
GATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCC
TTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACT
ACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCC
ACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATAT
AGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTG
ATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGT
ATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTT
GAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGA
TCACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAGAA
ACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTAT
CGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATATG
ATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCT
CATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCT
GCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAG
CTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGgcacca
aaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAA
AGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTA
CACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAA
GTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGA
AATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTA
AtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTATCT
TCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAg
agaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGT
GTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaaag
aaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGG
TCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTG
ACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTT
GATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCATTA
CAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTT
TGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGT
GTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCATCAT
TAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAATGCTA
TCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATAAT
ACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgtcat
cgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAA
CCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTAAT
TGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGATAA
CACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGAAA
ACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTTAT
AACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTC
ACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatgacA
GTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAAGAT
TATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTA
TGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACG
AGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCCACA
CCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATATAGA
GGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATA
ATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATA
CCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAA
ACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCA
CCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAGAAACA
CAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGA
GGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATATGATG
CTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCAT
GAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCTGCT
ACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTG
AAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGgcaccaaaa
aataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGA
GAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACAC
CAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTG
CTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAAT
TATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtA
ATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTATCTTCT
GTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgaga
aGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTA
ACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaaagaaa
gagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCA
TTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACA
CACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTTGAT
CTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCATTACAA
CCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGT
TTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTT
CTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCATCATTAG
GGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAATGCTATCA
GTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACA
TCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgtcatcgt
tgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCA
TCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTAATTGT
AAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGATAACAC
TGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGAAAACT
GTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTTATAAC
GTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACT
AAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatgacAGTG
ACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAAGATTAT
GATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGA
TATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGA
CATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCCACACCA
AACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGT
CGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATA
TTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCA
GAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACA
CGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCA
AAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAGAAACACAA
ACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGA
AGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATATGATGCTG
ACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAA
ATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTACG
AAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAG
AAGAGGACGACagtgatgaagaagaagatgaatgAATGgcaccaaaaaat
aagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAA
GGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAA
TCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTG
ATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTAT
TGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATA
ATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTA
ACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGG
CTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACA
TTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaaagaaagag
aagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTT
CAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACACAC
ATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTTGATCTT
TCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCATTACAACCT
CAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTA
CAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTC
ATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGA
GGGATATTCATGTCGTGTCAATGATCTACACATGTATAATGCTATCAGTT
TGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCC
TGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgtcatcgttgA
AAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCA
TTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTAATTGTAAA
ATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGATAACACTGT
GATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTC
AAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTTATAACGTT
TGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAA
GAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatgacAGTGACA
TcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAAGATTATGAT
ATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATAT
GGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGACAT
CAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCCACACCAAAC
TCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGT
GGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTG
CCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAG
CTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGA
CGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAG
GTTTGCATCCACTgttattgaaatatttcaacacTGCAGAAACACAAACA
TACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGT
AGCGTATTATGTTTTACCATCGATCATCCACAAACTATATGATGCTGACG
TTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATC
AGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAA
AACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAG
AGGACGACagtgatgaagaagaagatgaatgAATGgcaccaaaaaataag
aatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGT
GCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCA
CACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATA
GATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGT
GTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATT
GGAAACCTGACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTAACA
GAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTT
GATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTC
AAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaaagaaagagaag
aatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAG
TAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACACACATC
AAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTTGATCTTTCA
AATAATGTTTGGATGAATGGTCGGGACGTTGATATTCATTACAACCTCAG
TTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAG
ATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATC
AACGAAGATATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGG
ATATTCATGTCGTGTCAATGATCTACACATGTATAATGCTATCAGTTTGG
ACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGT
CCTTTGGGAAGAAATAATGTTTATATtcataatgacgtcatcgttgAAAA
AGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTG
GAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTAATTGTAAAATA
GGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGATAACACTGTGAT
AGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAA
TCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTTATAACGTTTGC
ATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAA
ACCAGATTCTGATGGTTTCGgtgatgacgatgatgatgacAGTGACATcg
atgaaaatatgaaaaaattgaaaatccaaGATAAAAAAGATTATGATATC
GAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGA
AGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGACATCAG
ATGGAGAGAGCAAcagtgaagatgaagatgaagactCCACACCAAACTCT
CCACAACCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGA
GAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCC
TAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTT
TGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGA
TACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTT
TGCATCCACTgttattgaaatatttcaacacTGCAGAAACACAAACATAC
GCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGC
GTATTATGTTTTACCATCGATCATCCACAAACTATATGATGCTGACGTTT
TGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGT
GACGACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAAC
ACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGG
ACGACagtgatgaagaagaagatgaatgAATGgcaccaaaaaataagaat
gatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCA
GGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCACAC
AAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGAT
TATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTT
CTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGA
AACCTGACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAG
TGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGAT
TCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAA
TAGAAAACATCCTTGAACACCACAAGGTTcaacgaaagaaagagaagaat
cTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAG
GTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACACACATCAAA
TCGTTCAATATCAGAAATCTCATGCATGCACATCATTTGATCTTTCAAAT
AATGTTTGGATGAATGGTCGGGACGTTGATATTCATTACAACCTCAGTTT
CACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATA
ATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAAC
GAAGATATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATA
TTCATGTCGTGTCAATGATCTACACATGTATAATGCTATCAGTTTGGACT
TATTGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGTCCT
TTGGGAAGAAATAATGTTTATATtcataatgacgtcatcgttgAAAAAGA
TTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAG
AAAAAACCCATATCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGA
AAAAATGTGACTATAAAAAATTCGTATATTTGGGATAACACTGTGATAGG
AGATGATTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCA
ATAGAAATGTAAAAATGGTTGATGCAATGATATCTTATAACGTTTGCATT
GATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACC
AGATTCTGATGGTTTCGgtgatgacgatgatgatgacAGTGACATcgatg
aaaatatgaaaaaattgaaaatccaaGATAAAAAAGATTATGATATCGAG
ATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGT
AGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGACATCAGATG
GAGAGAGCAAcagtgaagatgaagatgaagactCCACACCAAACTCTCCA
CAACCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAA
TTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAG
AAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGT
CAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGATAC
TCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGC
ATCCACTgttattgaaatatttcaacacTGCAGAAACACAAACATACGCT
ATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTA
TTATGTTTTACCATCGATCATCCACAAACTATATGATGCTGACGTTTTGG
ATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGAC
GACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACC
TAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACG
ACagtgatgaagaagaagatgaatgAATGgcaccaaaaaataagaatgat
GCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGC
AGTGGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCACACAAG
AAACACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGATTAT
ACGATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTTCTG
TTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGAAAC
CTGACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAGTGC
ATTTCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGATTCG
TTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAG
AAAACATCCTTGAACACCACAAGGTTcaacgaaagaaagagaagaatcTG
GTGATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTG
CAAAGAAGAAGATGCATTCATCGCAATGGATTCTGACACACATCAAATCG
TTCAATATCAGAAATCTCATGCATGCACATCATTTGATCTTTCAAATAAT
GTTTGGATGAATGGTCGGGACGTTGATATTCATTACAACCTCAGTTTCAC
ACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAATT
TTGATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAACGAA
GATATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATATTC
ATGTCGTGTCAATGATCTACACATGTATAATGCTATCAGTTTGGACTTAT
TGGGCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGTCCTTTG
GGAAGAAATAATGTTTATATtcataatgacgtcatcgttgAAAAAGATTG
TACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAA
AAACCCATATCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGAAAA
AATGTGACTATAAAAAATTCGTATATTTGGGATAACACTGTGATAGGAGA
TGATTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCAATA
GAAATGTAAAAATGGTTGATGCAATGATATCTTATAACGTTTGCATTGAT
GAAGGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGA
TTCTGATGGTTTCGgtgatgacgatgatgatgacAGTGACATcgatgaaa
atatgaaaaaattgaaaatccaaGATAAAAAAGATTATGATATCGAGATT
GTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTAGA
AGGAAATATTCCAAGTCTTACAGGGAACGACTACGAGACATCAGATGGAG
AGAGCAAcagtgaagatgaagatgaagactCCACACCAAACTCTCCACAA
CCTGAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAATTT
GAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGAAA
TCAATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTCAG
ACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGATACTCC
AAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATC
CACTgttattgaaatatttcaacacTGCAGAAACACAAACATACGCTATA
AACTCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTA
TGTTTTACCATCGATCATCCACAAACTATATGATGCTGACGTTTTGGATG
AGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACGAC
CATATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACCTAA
TTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGACa
gtgatgaagaagaagatgaatgAATGgcaccaaaaaataagaatgatGCT
GGATCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGT
GGTGATTGCTGATTCATTTAACAGAAAATTTACACCAATCACACAAGAAA
CACCAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGATTATACG
ATTGAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTTCTGTTG
TGCTTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGAAACCTG
ACAAGAATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAGTGCATT
TCTCTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGATTCGTTC
AGACTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAGAAA
ACATCCTTGAACACCACAAGGTTcaacgaaagaaagagaagaatcTGGTG
ATGACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAA
AGAAGAAGATGCATTCATCGCAATGGATTCTGACACACATCAAATCGTTC
AATATCAGAAATCTCATGCATGCACATCATTTGATCTTTCAAATAATGTT
TGGATGAATGGTCGGGACGTTGATATTCATTACAACCTCAGTTTCACACA
TGTCGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAATTTTG
ATTACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAACGAAGAT
ATCATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATATTCATG
TCGTGTCAATGATCTACACATGTATAATGCTATCAGTTTGGACTTATTGG
GCAGATGGACTTATCCGATTACAGTGGATAATACATCCTGTCCTTTGGGA
AGAAATAATGTTTATATtcataatgacgtcatcgttgAAAAAGATTGTAC
GTTGAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAA
CCCATATCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGAAAAAAT
GTGACTATAAAAAATTCGTATATTTGGGATAACACTGTGATAGGAGATGA
TTGTTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCAATAGAA
ATGTAAAAATGGTTGATGCAATGATATCTTATAACGTTTGCATTGATGAA
GGAATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTC
TGATGGTTTCGgtgatgacgatgatgatgacAGTGACATcgatgaaaata
tgaaaaaattgaaaatccaaGATAAAAAAGATTATGATATCGAGATTGTA
GGTGCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTAGAAGG
AAATATTCCAAGTCTTACAGGGAACGACTACGAGACATCAGATGGAGAGA
GCAAcagtgaagatgaagatgaagactCCACACCAAACTCTCCACAACCT
GAACTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAATTTGAA
AAGCGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGAAATCA
ATGCATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTCAGACG
GTAGCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGATACTCCAAA
AACTGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATCCAC
TgttattgaaatatttcaacacTGCAGAAACACAAACATACGCTATAAAC
TCCATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGT
TTTACCATCGATCATCCACAAACTATATGATGCTGACGTTTTGGATGAGG
CTGTCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCAT
ATCATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACCTAATTT
GTTGAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGACagtg
atgaagaagaagatgaatgAATGgcaccaaaaaataagaatgatGCTGGA
TCAACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGT
GATTGCTGATTCATTTAACAGAAAATTTACACCAATCACACAAGAAACAC
CAAGGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGATTATACGATT
GAGTACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGC
TTTTGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGAAACCTGACA
AGAATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAGTGCATTTCT
CTTGGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGATTCGTTCAGA
CTTTTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAGAAAACA
TCCTTGAACACCACAAGGTTcaacgaaagaaagagaagaatcTGGTGATG
ACCATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGA
AGAAGATGCATTCATCGCAATGGATTCTGACACACATCAAATCGTTCAAT
ATCAGAAATCTCATGCATGCACATCATTTGATCTTTCAAATAATGTTTGG
ATGAATGGTCGGGACGTTGATATTCATTACAACCTCAGTTTCACACATGT
CGCTCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAATTTTGATT
ACCAAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAACGAAGATATC
ATGGGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATATTCATGTCG
TGTCAATGATCTACACATGTATAATGCTATCAGTTTGGACTTATTGGGCA
GATGGACTTATCCGATTACAGTGGATAATACATCCTGTCCTTTGGGAAGA
AATAATGTTTATATtcataatgacgtcatcgttgAAAAAGATTGTACGTT
GAAGACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAACCC
ATATCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGAAAAAATGTG
ACTATAAAAAATTCGTATATTTGGGATAACACTGTGATAGGAGATGATTG
TTACATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCAATAGAAATG
TAAAAATGGTTGATGCAATGATATCTTATAACGTTTGCATTGATGAAGGA
ATGGAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGA
TGGTTTCGgtgatgacgatgatgatgacAGTGACATcgatgaaaatatga
aaaaattgaaaatccaaGATAAAAAAGATTATGATATCGAGATTGTAGGT
GCGAACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTAGAAGGAAA
TATTCCAAGTCTTACAGGGAACGACTACGAGACATCAGATGGAGAGAGCA
AcagtgaagatgaagatgaagactCCACACCAAACTCTCCACAACCTGAA
CTCTCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAG
CGGCTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGAAATCAATG
CATCGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTCAGACGGTA
GCAAAAGCATTGCTAGAAATGTGTTTGAAACACGACGATACTCCAAAAAC
TGAACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATCCACTgt
tattgaaatatttcaacacTGCAGAAACACAAACATACGCTATAAACTCC
ATAGAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTT
ACCATCGATCATCCACAAACTATATGATGCTGACGTTTTGGATGAGGCTG
TCATCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCATATC
ATCATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACCTAATTTGTT
GAAATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatg
aagaagaagatgaatgAATGgcaccaaaaaataagaatgatGCTGGATCA
ACTTCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGAT
TGCTGATTCATTTAACAGAAAATTTACACCAATCACACAAGAAACACCAA
GGGCATTGTTGCCACTAGGGAATAAAGTGCTGATAGATTATACGATTGAG
TACTTGATGAATGCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTT
TGGTGAAAGAATACGAGAATATGTTAAtAATAATTGGAAACCTGACAAGA
ATTTCACTATCAACTGTGTATTATCTTCTGTAACAGAGTGCATTTCTCTT
GGGGATGCTTTACGTGAAATTGATAgagaaGGCTTGATTCGTTCAGACTT
TTTACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAGAAAACATCC
TTGAACACCACAAGGTTcaacgaaagaaagagaagaatcTGGTGATGACC
ATGTTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGA
AGATGCATTCATCGCAATGGATTCTGACACACATCAAATCGTTCAATATC
AGAAATCTCATGCATGCACATCATTTGATCTTTCAAATAATGTTTGGATG
AATGGTCGGGACGTTGATATTCATTACAACCTCAGTTTCACACATGTCGC
TCTCTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAATTTTGATTACC
AAACACTGGATGATTTCGTCAAAGGTGTTCTCATCAACGAAGATATCATG
GGTGACAAAATCAACGGAGCCATCATTAGGGAGGGATATTCATGTCGTGT
CAATGATCTACACATGTATAATGCTATCAGTTTGGACTTATTGGGCAGAT
GGACTTATCCGATTACAGTGGATAATACATCCTGTCCTTTGGGAAGAAAT
AATGTTTATATtcataatgacgtcatcgttgAAAAAGATTGTACGTTGAA
GACAAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATA
TCACACAAAGTACTATAGGAGCTAATTGTAAAATAGGAAAAAATGTGACT
ATAAAAAATTCGTATATTTGGGATAACACTGTGATAGGAGATGATTGTTA
CATTGTCCAATCAATCATTTGTGAAAACTGTCAAATCAATAGAAATGTAA
AAATGGTTGATGCAATGATATCTTATAACGTTTGCATTGATGAAGGAATG
GAATTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGG
TTTCGgtgatgacgatgatgatgacAGTGACATcgatgaaaatatgaaaa
aattgaaaatccaaGATAAAAAAGATTATGATATCGAGATTGTAGGTGCG
AACGGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTAGAAGGAAATAT
TCCAAGTCTTACAGGGAACGACTACGAGACATCAGATGGAGAGAGCAAca
gtgaagatgaagatgaagactCCACACCAAACTCTCCACAACCTGAACTC
TCCAATTTGCACCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGG
CTACCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGAAATCAATGCAT
CGAAGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTCAGACGGTAGCA
AAAGCATTGCTAGAAATGTGTTTGAAACACGACGATACTCCAAAAACTGA
ACAAGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATCCACTgttat
tgaaatatttcaacacTGCAGAAACACAAACATACGCTATAAACTCCATA
GAGGAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACC
ATCGATCATCCACAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCA
TCTTGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCATATCATC
ATCCGTGAAGAAAACAGGACTCTGCTACGAAAAACACCTAATTTGTTGAA
ATTCGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaag
aagaagatgaatgAATGgcaccaaaaaataagaatgatGCTGGATCAACT
TCCTGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGC
TGATTCATTTAACAGAAAATTTACACCAATCACACAAGAAACACCAAGGG
CATTGTTGCCACTAGGGAATAAAGTGCTGATAGATTATACGATTGAGTAC
TTGATGAATGCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGG
TGAAAGAATACGAGAATATGTTAAtAATAATTGGAAACCTGACAAGAATT
TCACTATCAACTGTGTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGG
GATGCTTTACGTGAAATTGATAgagaaGGCTTGATTCGTTCAGACTTTTT
ACTGGTTCCTGGTGACTTGATGTGTAACATTCAAATAGAAAACATCCTTG
AACACCACAAGGTTcaacgaaagaaagagaagaatcTGGTGATGACCATG
TTATATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGA
TGCATTCATCGCAATGGATTCTGACACACATCAAATCGTTCAATATCAGA
AATCTCATGCATGCACATCATTTGATCTTTCAAATAATGTTTGGATGAAT
GGTCGGGACGTTGATATTCATTACAACCTCAGTTTCACACATGTCGCTCT
CTGTTCACCCCAGGTGGCACCTTTGTTTACAGATAATTTTGATTACCAAA
CACTGGATGATTTCGTCAAAGGTGTTCTCATCAACGAAGATATCATGGGT
GACAAAATCAACGGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAA
TGATCTACACATGTATAATGCTATCAGTTTGGACTTATTGGGCAGATGGA
CTTATCCGATTACAGTGGATAATACATCCTGTCCTTTGGGAAGAAATAAT
GTTTATATtcataatgacgtcatcgttgAAAAAGATTGTACGTTGAAGAC
AAAAGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCA
CACAAAGTACTATAGGAGCTAATTGTAAAATAGGAAAAAATGTGACTATA
AAAAATTCGTATATTTGGGATAACACTGTGATAGGAGATGATTGTTACAT
TGTCCAATCAATCATTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAA
TGGTTGATGCAATGATATCTTATAACGTTTGCATTGATGAAGGAATGGAA
TTGAAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTT
CGgtgatgacgatgatgatgacAGTGACATcgatgaaaatatgaaaaaat
tgaaaatccaaGATAAAAAAGATTATGATATCGAGATTGTAGGTGCGAAC
GGCAAAGGGTTTTTATGGCCTTATGATATGGAAGTAGAAGGAAATATTCC
AAGTCTTACAGGGAACGACTACGAGACATCAGATGGAGAGAGCAAcagtg
aagatgaagatgaagactCCACACCAAACTCTCCACAACCTGAACTCTCC
AATTTGCACCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTA
CCTCGAGAAAATTGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGA
AGTTCAAGTTCAACATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAA
GCATTGCTAGAAATGTGTTTGAAACACGACGATACTCCAAAAACTGAACA
AGTTAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATCCACTgttattga
aatatttcaacacTGCAGAAACACAAACATACGCTATAAACTCCATAGAG
GAGCACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATC
GATCATCCACAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCT
TGAGGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCATATCATCATC
CGTGAAGAAAACAGGACTCTGCTACGAAAAACACCTAATTTGTTGAAATT
CGTGAATTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaag
aagatgaatgAATGgcaccaaaaaataagaatgatGCTGGATCAACTTCC
TGGAGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGA
TTCATTTAACAGAAAATTTACACCAATCACACAAGAAACACCAAGGGCAT
TGTTGCCACTAGGGAATAAAGTGCTGATAGATTATACGATTGAGTACTTG
ATGAATGCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGA
AAGAATACGAGAATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCA
CTATCAACTGTGTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGAT
GCTTTACGTGAAATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACT
GGTTCCTGGTGACTTGATGTGTAACATTCAAATAGAAAACATCCTTGAAC
ACCACAAGGTTcaacgaaagaaagagaagaatcTGGTGATGACCATGTTA
TATCGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGC
ATTCATCGCAATGGATTCTGACACACATCAAATCGTTCAATATCAGAAAT
CTCATGCATGCACATCATTTGATCTTTCAAATAATGTTTGGATGAATGGT
CGGGACGTTGATATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTG
TTCACCCCAGGTGGCACCTTTGTTTACAGATAATTTTGATTACCAAACAC
TGGATGATTTCGTCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGAC
AAAATCAACGGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGA
TCTACACATGTATAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTT
ATCCGATTACAGTGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTT
TATATtcataatgacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAA
AGTGTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCACAC
AAAGTACTATAGGAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAA
AATTCGTATATTTGGGATAACACTGTGATAGGAGATGATTGTTACATTGT
CCAATCAATCATTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGG
TTGATGCAATGATATCTTATAACGTTTGCATTGATGAAGGAATGGAATTG
AAACCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGg
tgatgacgatgatgatgacAGTGACATcgatgaaaatatgaaaaaattga
aaatccaaGATAAAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGC
AAAGGGTTTTTATGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAG
TCTTACAGGGAACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaag
atgaagatgaagactCCACACCAAACTCTCCACAACCTGAACTCTCCAAT
TTGCACCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCT
CGAGAAAATTGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGT
TCAAGTTCAACATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCA
TTGCTAGAAATGTGTTTGAAACACGACGATACTCCAAAAACTGAACAAGT
TAAAGAGTTTGGAAAGATCACCAAAGGTTTGCATCCACTgttattgaaat
atttcaacacTGCAGAAACACAAACATACGCTATAAACTCCATAGAGGAG
CACTTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGAT
CATCCACAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGA
GGTGGTATGCTTGCCCTCATGAAATCAGTGACGACCATATCATCATCCGT
GAAGAAAACAGGACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGT
GAATTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaag
atgaatgAATGgcaccaaaaaataagaatgatGCTGGATCAACTTCCTGG
AGATCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTC
ATTTAACAGAAAATTTACACCAATCACACAAGAAACACCAAGGGCATTGT
TGCCACTAGGGAATAAAGTGCTGATAGATTATACGATTGAGTACTTGATG
AATGCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAG
AATACGAGAATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTA
TCAACTGTGTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCT
TTACGTGAAATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGT
TCCTGGTGACTTGATGTGTAACATTCAAATAGAAAACATCCTTGAACACC
ACAAGGTTcaacgaaagaaagagaagaatcTGGTGATGACCATGTTATAT
CGTGAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATT
CATCGCAATGGATTCTGACACACATCAAATCGTTCAATATCAGAAATCTC
ATGCATGCACATCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGG
GACGTTGATATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTC
ACCCCAGGTGGCACCTTTGTTTACAGATAATTTTGATTACCAAACACTGG
ATGATTTCGTCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAA
ATCAACGGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCT
ACACATGTATAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATC
CGATTACAGTGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTAT
ATtcataatgacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGT
GTTGGTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAA
GTACTATAGGAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAAT
TCGTATATTTGGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCA
ATCAATCATTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTG
ATGCAATGATATCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAA
CCATGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtga
tgacgatgatgatgacAGTGACATcgatgaaaatatgaaaaaattgaaaa
tccaaGATAAAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAA
GGGTTTTTATGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCT
TACAGGGAACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatg
aagatgaagactCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTG
CACCAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGA
GAAAATTGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCA
AGTTCAACATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTG
CTAGAAATGTGTTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAA
AGAGTTTGGAAAGATCACCAAAGGTTTGCATCCACTgttattgaaatatt
tcaacacTGCAGAAACACAAACATACGCTATAAACTCCATAGAGGAGCAC
TTTTTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCAT
CCACAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGT
GGTATGCTTGCCCTCATGAAATCAGTGACGACCATATCATCATCCGTGAA
GAAAACAGGACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAA
TTGGTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatg
aatgAATGgcaccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGA
TCTGAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATT
TAACAGAAAATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGC
CACTAGGGAATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAAT
GCTGGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAAT
ACGAGAATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCA
ACTGTGTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTA
CGTGAAATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCC
TGGTGACTTGATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACA
AGGTTcaacgaaagaaagagaagaatcTGGTGATGACCATGTTATATCGT
GAATTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCAT
CGCAATGGATTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATG
CATGCACATCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGAC
GTTGATATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACC
CCAGGTGGCACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATG
ATTTCGTCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATC
AACGGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACA
CATGTATAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGA
TTACAGTGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATt
cataatgacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTT
GGTGGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTA
CTATAGGAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCG
TATATTTGGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATC
AATCATTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATG
CAATGATATCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCA
TGCACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatga
cgatgatgatgacAGTGACATcgatgaaaatatgaaaaaattgaaaatcc
aaGATAAAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGG
TTTTTATGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTAC
AGGGAACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaag
atgaagactCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCAC
CAATTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAA
AATTGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGT
TCAACATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTA
GAAATGTGTTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGA
GTTTGGAAAGATCACCAAAGGTTTGCATCCACTgttattgaaatatttca
acacTGCAGAAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTT
TTGACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCA
CAAACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGT
ATGCTTGCCCTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAA
AACAGGACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTG
GTTACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaat
gAATGgcaccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCT
GAAGACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAA
CAGAAAATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCAC
TAGGGAATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCT
GGAGTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACG
AGAATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACT
GTGTATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGT
GAAATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGG
TGACTTGATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGG
TTcaacgaaagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAA
TTAGCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGC
AATGGATTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCAT
GCACATCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTT
GATATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCA
GGTGGCACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATT
TCGTCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAAC
GGAGCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACAT
GTATAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTA
CAGTGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcat
aatgacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGT
GGGTAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTA
TAGGAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTAT
ATTTGGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAAT
CATTTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAA
TGATATCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGC
ACGCGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacga
tgatgatgacAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaG
ATAAAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTT
TTATGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGG
GAACGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatg
aagactCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAA
TTCCATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAAT
TGCTGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCA
ACATCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAA
ATGTGTTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTT
TGGAAAGATCACCAAAGGTTTGCATCCACTgttattgaaatatttcaaca
cTGCAGAAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTG
ACGTCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAA
ACTATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATG
CTTGCCCTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAAC
AGGACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTT
ACAAGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAA
TGgcaccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAA
GACGAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAG
AAAATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAG
GGAATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGA
GTCAATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGA
ATATGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTG
TATTATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAA
ATTGATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGA
CTTGATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTc
aacgaaagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTA
GCTCCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAAT
GGATTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCA
CATCATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGAT
ATTCATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGT
GGCACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCG
TCAAAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGA
GCCATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTA
TAATGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAG
TGGATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataat
gacgtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGG
TAAAGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAG
GAGCTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATT
TGGGATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCAT
TTGTGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGA
TATCTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACG
CGGCTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatga
tgatgacAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATA
AAAAAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTA
TGGCCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAA
CGACTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaag
actCCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTC
CATATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGC
TGCTGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACA
TCAGTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATG
TGTTTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGG
AAAGATCACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTG
CAGAAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACG
TCTATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACT
ATATGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTT
GCCCTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGG
ACTCTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACA
AGAAGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGg
caccaaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGAC
GAAAAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAA
ATTTACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGA
ATAAAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTC
AATGAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATA
TGTTAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTAT
TATCTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATT
GATAgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTT
GATGTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaac
gaaagaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCT
CCTGGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGA
TTCTGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACAT
CATTTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATT
CATTACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGC
ACCTTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCA
AAGGTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCC
ATCATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAA
TGCTATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGG
ATAATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgac
gtcatcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAA
AGGAACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAG
CTAATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGG
GATAACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTG
TGAAAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATAT
CTTATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGG
CTTTCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatga
tgacAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAA
AAGATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGG
CCTTATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGA
CTACGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagact
CCACACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCAT
ATAGAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGC
TGATAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCA
GTATACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGT
TTGAAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAA
GATCACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAG
AAACACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCT
ATCGAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATA
TGATGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCC
CTCATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACT
CTGCTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGA
AGCTGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGgcac
caaaaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAA
AAAGAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATT
TACACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATA
AAGTGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAAT
GAAATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGT
TAAtAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTAT
CTTCTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGAT
AgagaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGAT
GTGTAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaa
agaaagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCT
GGTCATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTC
TGACACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCAT
TTGATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCAT
TACAACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACC
TTTGTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAG
GTGTTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCATC
ATTAGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAATGC
TATCAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATA
ATACATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgtc
atcgttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGG
AACCATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTA
ATTGTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGAT
AACACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGA
AAACTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTT
ATAACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTT
TCACTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatga
cAGTGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAAG
ATTATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCT
TATGATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTA
CGAGACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCCA
CACCAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATATA
GAGGTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGA
TAATATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTA
TACCAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTG
AAACACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGAT
CACCAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAGAAA
CACAAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATC
GAGGAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATATGA
TGCTGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTC
ATGAAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCTG
CTACGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGC
TGAAGAAGAGGACGACagtgatgaagaagaagatgaatgAATGgcaccaa
aaaataagaatgatGCTGGATCAACTTCCTGGAGATCTGAAGACGAAAAA
GAGAAGGTGCAGGCAGTGGTGATTGCTGATTCATTTAACAGAAAATTTAC
ACCAATCACACAAGAAACACCAAGGGCATTGTTGCCACTAGGGAATAAAG
TGCTGATAGATTATACGATTGAGTACTTGATGAATGCTGGAGTCAATGAA
ATTATTGTGTTCTGTTGTGCTTTTGGTGAAAGAATACGAGAATATGTTAA
tAATAATTGGAAACCTGACAAGAATTTCACTATCAACTGTGTATTATCTT
CTGTAACAGAGTGCATTTCTCTTGGGGATGCTTTACGTGAAATTGATAga
gaaGGCTTGATTCGTTCAGACTTTTTACTGGTTCCTGGTGACTTGATGTG
TAACATTCAAATAGAAAACATCCTTGAACACCACAAGGTTcaacgaaaga
aagagaagaatcTGGTGATGACCATGTTATATCGTGAATTAGCTCCTGGT
CATTTCAGTAGGTGCAAAGAAGAAGATGCATTCATCGCAATGGATTCTGA
CACACATCAAATCGTTCAATATCAGAAATCTCATGCATGCACATCATTTG
ATCTTTCAAATAATGTTTGGATGAATGGTCGGGACGTTGATATTCATTAC
AACCTCAGTTTCACACATGTCGCTCTCTGTTCACCCCAGGTGGCACCTTT
GTTTACAGATAATTTTGATTACCAAACACTGGATGATTTCGTCAAAGGTG
TTCTCATCAACGAAGATATCATGGGTGACAAAATCAACGGAGCCATCATT
AGGGAGGGATATTCATGTCGTGTCAATGATCTACACATGTATAATGCTAT
CAGTTTGGACTTATTGGGCAGATGGACTTATCCGATTACAGTGGATAATA
CATCCTGTCCTTTGGGAAGAAATAATGTTTATATtcataatgacgtcatc
gttgAAAAAGATTGTACGTTGAAGACAAAAGTGTTGGTGGGTAAAGGAAC
CATCATTGGAGAAAAAACCCATATCACACAAAGTACTATAGGAGCTAATT
GTAAAATAGGAAAAAATGTGACTATAAAAAATTCGTATATTTGGGATAAC
ACTGTGATAGGAGATGATTGTTACATTGTCCAATCAATCATTTGTGAAAA
CTGTCAAATCAATAGAAATGTAAAAATGGTTGATGCAATGATATCTTATA
ACGTTTGCATTGATGAAGGAATGGAATTGAAACCATGCACGCGGCTTTCA
CTAAAGAAACCAGATTCTGATGGTTTCGgtgatgacgatgatgatgacAG
TGACATcgatgaaaatatgaaaaaattgaaaatccaaGATAAAAAAGATT
ATGATATCGAGATTGTAGGTGCGAACGGCAAAGGGTTTTTATGGCCTTAT
GATATGGAAGTAGAAGGAAATATTCCAAGTCTTACAGGGAACGACTACGA
GACATCAGATGGAGAGAGCAAcagtgaagatgaagatgaagactCCACAC
CAAACTCTCCACAACCTGAACTCTCCAATTTGCACCAATTCCATATAGAG
GTCGTGGAGAATTTGAAAAGCGGCTACCTCGAGAAAATTGCTGCTGATAA
TATTGCCCTAGAAATCAATGCATCGAAGTTCAAGTTCAACATCAGTATAC
CAGAGCTTTGTCAGACGGTAGCAAAAGCATTGCTAGAAATGTGTTTGAAA
CACGACGATACTCCAAAAACTGAACAAGTTAAAGAGTTTGGAAAGATCAC
CAAAGGTTTGCATCCACTgttattgaaatatttcaacacTGCAGAAACAC
AAACATACGCTATAAACTCCATAGAGGAGCACTTTTTGACGTCTATCGAG
GAAGTAGCGTATTATGTTTTACCATCGATCATCCACAAACTATATGATGC
TGACGTTTTGGATGAGGCTGTCATCTTGAGGTGGTATGCTTGCCCTCATG
AAATCAGTGACGACCATATCATCATCCGTGAAGAAAACAGGACTCTGCTA
CGAAAAACACCTAATTTGTTGAAATTCGTGAATTGGTTACAAGAAGCTGA
AGAAGAGGACGACagtgatgaagaagaagatgaatgA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000578XLOC_000578Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000993-exon-sc0000007-1491911889:393757..394019TCONS_00000993-exon-sc0000007-1491911889:393757..394019Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:393757..394019TCONS_00000993-exon-sc0000007-1510915933:393757..394019Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:393757..394019TCONS_00000993-exon-sc0000007-1575043694:393757..394019Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:394276..394400TCONS_00000993-exon-sc0000007-1491911889:394276..394400Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:394276..394400TCONS_00000993-exon-sc0000007-1510915933:394276..394400Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:394276..394400TCONS_00000993-exon-sc0000007-1575043694:394276..394400Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:394614..394716TCONS_00000993-exon-sc0000007-1491911889:394614..394716Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:394614..394716TCONS_00000993-exon-sc0000007-1510915933:394614..394716Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:394614..394716TCONS_00000993-exon-sc0000007-1575043694:394614..394716Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:394845..394927TCONS_00000993-exon-sc0000007-1491911889:394845..394927Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:394845..394927TCONS_00000993-exon-sc0000007-1510915933:394845..394927Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:394845..394927TCONS_00000993-exon-sc0000007-1575043694:394845..394927Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:395029..395103TCONS_00000993-exon-sc0000007-1491911889:395029..395103Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:395029..395103TCONS_00000993-exon-sc0000007-1510915933:395029..395103Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:395029..395103TCONS_00000993-exon-sc0000007-1575043694:395029..395103Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:395217..395316TCONS_00000993-exon-sc0000007-1491911889:395217..395316Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:395217..395316TCONS_00000993-exon-sc0000007-1510915933:395217..395316Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:395217..395316TCONS_00000993-exon-sc0000007-1575043694:395217..395316Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:395428..395505TCONS_00000993-exon-sc0000007-1491911889:395428..395505Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:395428..395505TCONS_00000993-exon-sc0000007-1510915933:395428..395505Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:395428..395505TCONS_00000993-exon-sc0000007-1575043694:395428..395505Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:395685..395762TCONS_00000993-exon-sc0000007-1491911889:395685..395762Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:395685..395762TCONS_00000993-exon-sc0000007-1510915933:395685..395762Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:395685..395762TCONS_00000993-exon-sc0000007-1575043694:395685..395762Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:395936..396021TCONS_00000993-exon-sc0000007-1491911889:395936..396021Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:395936..396021TCONS_00000993-exon-sc0000007-1510915933:395936..396021Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:395936..396021TCONS_00000993-exon-sc0000007-1575043694:395936..396021Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:396150..396254TCONS_00000993-exon-sc0000007-1491911889:396150..396254Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:396150..396254TCONS_00000993-exon-sc0000007-1510915933:396150..396254Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:396150..396254TCONS_00000993-exon-sc0000007-1575043694:396150..396254Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:398729..398829TCONS_00000993-exon-sc0000007-1491911889:398729..398829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:398729..398829TCONS_00000993-exon-sc0000007-1510915933:398729..398829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:398729..398829TCONS_00000993-exon-sc0000007-1575043694:398729..398829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:399074..399179TCONS_00000993-exon-sc0000007-1491911889:399074..399179Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:399074..399179TCONS_00000993-exon-sc0000007-1510915933:399074..399179Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:399074..399179TCONS_00000993-exon-sc0000007-1575043694:399074..399179Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:399486..399522TCONS_00000993-exon-sc0000007-1491911889:399486..399522Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:399486..399522TCONS_00000993-exon-sc0000007-1510915933:399486..399522Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:399486..399522TCONS_00000993-exon-sc0000007-1575043694:399486..399522Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:399685..399829TCONS_00000993-exon-sc0000007-1491911889:399685..399829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:399685..399829TCONS_00000993-exon-sc0000007-1510915933:399685..399829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:399685..399829TCONS_00000993-exon-sc0000007-1575043694:399685..399829Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:400010..400099TCONS_00000993-exon-sc0000007-1491911889:400010..400099Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:400010..400099TCONS_00000993-exon-sc0000007-1510915933:400010..400099Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:400010..400099TCONS_00000993-exon-sc0000007-1575043694:400010..400099Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:400359..400451TCONS_00000993-exon-sc0000007-1491911889:400359..400451Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:400359..400451TCONS_00000993-exon-sc0000007-1510915933:400359..400451Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:400359..400451TCONS_00000993-exon-sc0000007-1575043694:400359..400451Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:400803..400899TCONS_00000993-exon-sc0000007-1491911889:400803..400899Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:400803..400899TCONS_00000993-exon-sc0000007-1510915933:400803..400899Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:400803..400899TCONS_00000993-exon-sc0000007-1575043694:400803..400899Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:402430..402547TCONS_00000993-exon-sc0000007-1491911889:402430..402547Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:402430..402547TCONS_00000993-exon-sc0000007-1510915933:402430..402547Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:402430..402547TCONS_00000993-exon-sc0000007-1575043694:402430..402547Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:402771..402851TCONS_00000993-exon-sc0000007-1491911889:402771..402851Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:402771..402851TCONS_00000993-exon-sc0000007-1510915933:402771..402851Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:402771..402851TCONS_00000993-exon-sc0000007-1575043694:402771..402851Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:403005..403190TCONS_00000993-exon-sc0000007-1491911889:403005..403190Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:403005..403190TCONS_00000993-exon-sc0000007-1510915933:403005..403190Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:403005..403190TCONS_00000993-exon-sc0000007-1575043694:403005..403190Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1491911889:403537..403713TCONS_00000993-exon-sc0000007-1491911889:403537..403713Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1510915933:403537..403713TCONS_00000993-exon-sc0000007-1510915933:403537..403713Clytia hemisphaericaexon
TCONS_00000993-exon-sc0000007-1575043694:403537..403713TCONS_00000993-exon-sc0000007-1575043694:403537..403713Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000993-proteinTCONS_00000993-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:393757..403713 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.9365 14.113 3.33799 2.05962 21.55 18.8141 24.9812 25.0202 18.1665 20.3691 18.2943 13.7439 12.9339 16.3243 18.1195 21.4456 20.7355 21.0212 8.93873 7.58361 10.9157 11.0673 25.7359 22.7691 24.4048 25.8254 10.9789 11.0061 18.1456 17.1805
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003307W2_domain
IPR029044Nucleotide-diphossugar_trans
IPR005835NTP_transferase_dom
IPR001451Hexapep
IPR016024ARM-type_fold
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0016779nucleotidyltransferase activity
GO:0005488binding
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0009058 biosynthetic process
molecular_function GO:0005488 binding
molecular_function GO:0016779 nucleotidyltransferase activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000993 vs. Swiss-Prot (Human)
Match: EI2BE (Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3)

HSP 1 Score: 401.749 bits (1031), Expect = 1.055e-127
Identity = 240/689 (34.83%), Postives = 385/689 (55.88%), Query Frame = 3
Query:  177 EDEKEKVQAVVIADSFNRKFTPITQETPRALLPLGNKVLIDYTIEYLMNAGVNEIIVFCCAFGERIREYV-NNNW-KPDKNFTINCVLSSVTECISLGDALREIDREGLIRSDFLLVPGDLMCNIQIENILEHHKVQRKKEKNL-VMTMLYRELAPGHFSRCKEEDAFIAMDSDTHQIVQYQKSHACTSFDLSNNVWMNGRD-VDIHYNLSFTHVALCSPQVAPLFTDNFDYQTLDDFVKGVLINEDIMGDKINGAIIREGYSCRVNDLHMYNAISLDLLGRWTYPIT-----VDNT--SCPLGRNNVYIHNDVIVEKDCTLKTKVLVGKGTIIGEKTHITQSTIGANCKIGKNVTIKNSYIWDNTVIGDDCYIVQSIICENCQINRNVKM-VDAMISYNVCIDEGMELKPCTRLSLKKPXXXXXXXXXXXXXXXXENMKKLKIQDKKDYDIEIVGANGKGFLWPYDMEVEGNIP-------SLTGNDYXXXXXXXXXXXXXXXXXXXXXQPELSNLHQFHIEVVENLKSGYLEKIAADNIALEINASKFKFNISIPELCQTVAKALLEMCLKHDDTP--KTEQVKEFGKITKGLHPLLLKYFNTAETQTYAINSIEEHFLTSIEEVAYYVLPSIIHKLYDADVLDEAVILRWYACPHEISDDHIIIREENRTLLRKTPNLLKFVNWLQ 2180
            E+    +QAV++ADSF+R+F PI+++ PR LLPL N  LIDYT+E+L   GV E  VFCC    +I+E++  + W +P     +  + S +    SLGD LR++D + L+RSDFLLV GD++ NI I   LE H+++RK EKN+ VMTM+++E +P H +RC E++  +A+DS T++++ +QK+     F    +++    D V++ Y+L   H+++CSPQVA LFTDNFDYQT DDFV+G+L+NE+I+G++I+  +  + Y  RV++LHMY+A+  D++ RW YP+T      D+T  SC   R+N+Y   +V +     L+  VL+G GT+IG    IT S IG  C IG NV +  +Y+W    +     I QS++C+N ++   V +   ++++  V +   + L   + +SL  PD++   DD +   D   + +K K++  K Y+   VGA GKG+LW                   L  N  E S+ ES    + E+       P++ ++  F  EV+  L+ G  E I+ DN+ LEIN+ K+ +NIS+ E+ Q ++  +LE  L+  D+P   +        + K   P+   Y   A     A+ +IE+ FL    E     +  ++   Y  ++L E  IL W++   + +D            LRK   L +F+ WL+
Sbjct:   37 EEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYR--SLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVK-MKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLE--HEALGISMAKVLMAFYQLEILAEETILSWFS-QRDTTD--------KGQQLRKNQQLQRFIQWLK 711          
The following BLAST results are available for this feature:
BLAST of TCONS_00000993 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EI2BE1.055e-12734.83Translation initiation factor eIF-2B subunit epsil... [more]
back to top