Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000635 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000635
Unique NameTCONS_00000635
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1509

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000635 ID=TCONS_00000635|Name=TCONS_00000635|organism=Clytia hemisphaerica|type=transcript|length=1509bp
ATGgaatttttattgtaaaaaatggAGTGTACACataatatttttcagtt
ttctttTAGTCAGGAAGTAcgcaaaaatatcaaagtagATGTAACCTTCG
CAATGGACAACAACACTACGTATTCACCGAGACAATCACCAGAAGTAGTT
GGTGTCACAACAAGCTTAATGGTTTTATTAAGCTTATTCACTGTAGTTGG
GAATCTTATGGTTATTTACATCTTCGTCAAACACAAAAACTTACAGATTG
CAAAAAACTATTTCATATTATCTCTGGCAATTGCTGATGTTTTCATTGGT
acattttcaatcaatttttataACGTCTATCTCGCTTTTGGTGGATGGCC
TTTTGGTAATATTTCATGTGATTTATGGCTTTCTATGGATTATTCTTGTT
GTAATGTTTCAACGTTAACTTTACTAGCCATCTCAATAGAACGATTTGTC
GGTGTACATTACACAGCTTTCCACCGCAACCAATTCACAAAGAAACGATT
AAAGCGAACAATTTTCATCATTTGGCTTATATCATTCTTAGTATGGTTTC
CTGCTATTTTTGCTTATCCATACATTCACGGCGAACGAACAGTAAAAGAC
GGACAATGTTATGTACAATTTTTATATGAAAGCCCGAGTATGACTATTGT
TACTGCCTTCATTAATTTTTATGGGCCAATCATTTTCATGGTGATTATTT
ACATATTAATATCAAGAACACTAATCAAGAGATATAAACGGAAATATCAT
CTAAGAGAGAATTCAATACCACCCGAGACAAGCTCTGAACGACGGCCTTC
CAGTTCGCGAGAACGAAAATATTCAGTACGTCCGTCAATCGCTTCAACAA
CTGTAATTTCACCAGAAAGACGACCAACTATCGCAACCATTATTGGTTCT
CCCTCTGAAATGGATAGAATGAGAAAAAGCTATGAATCCATTGTATCTGG
CGATACGAACTCAAATTCTAAAAGGAAAGCTGATAAGCCGAAAACACAAC
GCGAAAAAGACTACTTATCACATAAAAGAGCAATTACTCTGTTATTACTT
ATCATTGGTGCATTTGCTATCACGTGGTTTCCATATAACCTTATGGCGGT
GATCGCACCATTTTGTAGAAAATGCATCCATGCTGATTGGTGGCATTTTG
GTTACATTTTCTGCTACGTTAACTCCCTATTAAACCCATTGTGCTATGCT
TTTGGTAATcgacatttcaaaaaatatttcaaagagaTTTTCGTAGCAAT
CAAGAAAAGGATCTGTTGTCCAAAAGCTGGTTTAGTAACAATAAAACAAC
ATTAgtttgctctttattttgtaacaTACTTTTGGGATTTTTGTTGTACA
TATAGGGTGTATTCACACTGTTGTTTGAAGGTTGCTTGAAAATATTGGAA
TAAAGAATGCACGATCTTCTCTTTTGCACTTATTATTTAACTTTGCACGA
TCGCGTGATCTTGTTTCAAGCAAACTTCAAGCcaaaaaaacaatgatttt
GTGTTGATG
Run BLAST on NCBI

protein sequence of TCONS_00000635-protein

>TCONS_00000635-protein ID=TCONS_00000635-protein|Name=TCONS_00000635-protein|organism=Clytia hemisphaerica|type=polypeptide|length=427bp
MECTHNIFQFSFSQEVRKNIKVDVTFAMDNNTTYSPRQSPEVVGVTTSLM
VLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADVFIGTFSINFY
NVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIERFVGVHYTAF
HRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERTVKDGQCYVQF
LYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKRKYHLRENSIP
PETSSERRPSSSRERKYSVRPSIASTTVISPERRPTIATIIGSPSEMDRM
RKSYESIVSGDTNSNSKRKADKPKTQREKDYLSHKRAITLLLLIIGAFAI
TWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPLCYAFGNRHFK
KYFKEIFVAIKKRICCPKAGLVTIKQH
Run BLAST on NCBI

transcript from alignment at sc0000002:651966..653474

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000635 ID=TCONS_00000635|Name=TCONS_00000635|organism=Clytia hemisphaerica|type=transcript|length=1509bp|location=Sequence derived from alignment at sc0000002:651966..653474 (Clytia hemisphaerica)
CATCAACACaaaatcattgtttttttgGCTTGAAGTTTGCTTGAAACAAG ATCACGCGATCGTGCAAAGTTAAATAATAAGTGCAAAAGAGAAGATCGTG CATTCTTTATTCCAATATTTTCAAGCAACCTTCAAACAACAGTGTGAATA CACCCTATATGTACAACAAAAATCCCAAAAGTAtgttacaaaataaagag caaacTAATGTTGTTTTATTGTTACTAAACCAGCTTTTGGACAACAGATC CTTTTCTTGATTGCTACGAAAAtctctttgaaatattttttgaaatgtcg ATTACCAAAAGCATAGCACAATGGGTTTAATAGGGAGTTAACGTAGCAGA AAATGTAACCAAAATGCCACCAATCAGCATGGATGCATTTTCTACAAAAT GGTGCGATCACCGCCATAAGGTTATATGGAAACCACGTGATAGCAAATGC ACCAATGATAAGTAATAACAGAGTAATTGCTCTTTTATGTGATAAGTAGT CTTTTTCGCGTTGTGTTTTCGGCTTATCAGCTTTCCTTTTAGAATTTGAG TTCGTATCGCCAGATACAATGGATTCATAGCTTTTTCTCATTCTATCCAT TTCAGAGGGAGAACCAATAATGGTTGCGATAGTTGGTCGTCTTTCTGGTG AAATTACAGTTGTTGAAGCGATTGACGGACGTACTGAATATTTTCGTTCT CGCGAACTGGAAGGCCGTCGTTCAGAGCTTGTCTCGGGTGGTATTGAATT CTCTCTTAGATGATATTTCCGTTTATATCTCTTGATTAGTGTTCTTGATA TTAATATGTAAATAATCACCATGAAAATGATTGGCCCATAAAAATTAATG AAGGCAGTAACAATAGTCATACTCGGGCTTTCATATAAAAATTGTACATA ACATTGTCCGTCTTTTACTGTTCGTTCGCCGTGAATGTATGGATAAGCAA AAATAGCAGGAAACCATACTAAGAATGATATAAGCCAAATGATGAAAATT GTTCGCTTTAATCGTTTCTTTGTGAATTGGTTGCGGTGGAAAGCTGTGTA ATGTACACCGACAAATCGTTCTATTGAGATGGCTAGTAAAGTTAACGTTG AAACATTACAACAAGAATAATCCATAGAAAGCCATAAATCACATGAAATA TTACCAAAAGGCCATCCACCAAAAGCGAGATAGACGTtataaaaattgat tgaaaatgtACCAATGAAAACATCAGCAATTGCCAGAGATAATATGAAAT AGTTTTTTGCAATCTGTAAGTTTTTGTGTTTGACGAAGATGTAAATAACC ATAAGATTCCCAACTACAGTGAATAAGCTTAATAAAACCATTAAGCTTGT TGTGACACCAACTACTTCTGGTGATTGTCTCGGTGAATACGTAGTGTTGT TGTCCATTGCGAAGGTTACATctactttgatatttttgcgTACTTCCTGA CTAaaagaaaactgaaaaatattatGTGTACACTccattttttacaataa aaattcCAT

Coding sequence (CDS) from alignment at sc0000002:651966..653474

>TCONS_00000635 ID=TCONS_00000635|Name=TCONS_00000635|organism=Clytia hemisphaerica|type=CDS|length=1284bp|location=Sequence derived from alignment at sc0000002:651966..653474 (Clytia hemisphaerica)
cTAATGTTGTTTTATTGTTACTAAACCAGCTTTTGGACAACAGATCCTTT
TCTTGATTGCTACGAAAAtctctttgaaatattttttgaaatgtcgATTA
CCAAAAGCATAGCACAATGGGTTTAATAGGGAGTTAACGTAGCAGAAAAT
GTAACCAAAATGCCACCAATCAGCATGGATGCATTTTCTACAAAATGGTG
CGATCACCGCCATAAGGTTATATGGAAACCACGTGATAGCAAATGCACCA
ATGATAAGTAATAACAGAGTAATTGCTCTTTTATGTGATAAGTAGTCTTT
TTCGCGTTGTGTTTTCGGCTTATCAGCTTTCCTTTTAGAATTTGAGTTCG
TATCGCCAGATACAATGGATTCATAGCTTTTTCTCATTCTATCCATTTCA
GAGGGAGAACCAATAATGGTTGCGATAGTTGGTCGTCTTTCTGGTGAAAT
TACAGTTGTTGAAGCGATTGACGGACGTACTGAATATTTTCGTTCTCGCG
AACTGGAAGGCCGTCGTTCAGAGCTTGTCTCGGGTGGTATTGAATTCTCT
CTTAGATGATATTTCCGTTTATATCTCTTGATTAGTGTTCTTGATATTAA
TATGTAAATAATCACCATGAAAATGATTGGCCCATAAAAATTAATGAAGG
CAGTAACAATAGTCATACTCGGGCTTTCATATAAAAATTGTACATAACAT
TGTCCGTCTTTTACTGTTCGTTCGCCGTGAATGTATGGATAAGCAAAAAT
AGCAGGAAACCATACTAAGAATGATATAAGCCAAATGATGAAAATTGTTC
GCTTTAATCGTTTCTTTGTGAATTGGTTGCGGTGGAAAGCTGTGTAATGT
ACACCGACAAATCGTTCTATTGAGATGGCTAGTAAAGTTAACGTTGAAAC
ATTACAACAAGAATAATCCATAGAAAGCCATAAATCACATGAAATATTAC
CAAAAGGCCATCCACCAAAAGCGAGATAGACGTtataaaaattgattgaa
aatgtACCAATGAAAACATCAGCAATTGCCAGAGATAATATGAAATAGTT
TTTTGCAATCTGTAAGTTTTTGTGTTTGACGAAGATGTAAATAACCATAA
GATTCCCAACTACAGTGAATAAGCTTAATAAAACCATTAAGCTTGTTGTG
ACACCAACTACTTCTGGTGATTGTCTCGGTGAATACGTAGTGTTGTTGTC
CATTGCGAAGGTTACATctactttgatatttttgcgTACTTCCTGACTAa
aagaaaactgaaaaatattatGTGTACACTccat
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000381XLOC_000381Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000635-proteinTCONS_00000635-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000635-exon-sc0000002-1491911889:651966..653474TCONS_00000635-exon-sc0000002-1491911889:651966..653474Clytia hemisphaericaexon
TCONS_00000635-exon-sc0000002-1510915933:651966..653474TCONS_00000635-exon-sc0000002-1510915933:651966..653474Clytia hemisphaericaexon
TCONS_00000635-exon-sc0000002-1575043694:651966..653474TCONS_00000635-exon-sc0000002-1575043694:651966..653474Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:651966..653474 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.535 0.214586 0.126169 0.107966 1.14089 0.536486 3.82693 3.48773 1.41737 1.02055 1.36461 1.09726 1.3029 1.49248 0.319935 0.693842 0.184605 0.577045 0.727257 0.596956 0.196011 0.383129 0.560624 0.339488 0.80059 0.392252 0.0897756 0 0.249056 0.771528
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR000995Musac_Ach_rcpt
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0016907G-protein coupled acetylcholine receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0005887integral component of plasma membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0005887 integral component of plasma membrane
molecular_function GO:0016907 G-protein coupled acetylcholine receptor activity
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
BLAST of TCONS_00000635 vs. Swiss-Prot (Human)
Match: ACM1 (Muscarinic acetylcholine receptor M1 OS=Homo sapiens GN=CHRM1 PE=1 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 5.667e-65
Identity = 138/427 (32.32%), Postives = 202/427 (47.31%), Query Frame = 1
Query:  109 NNTTYSPRQSP---EVVGVTTSLMVLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADVFIGTFSINFYNVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIERFVGVHYTAFHRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERTVKDGQCYVQFLYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKRKYHLRENXXXXXXXXXXXXXXXXXXKYSVRP----------------------------------SIASTTVISPERRPTIATIIGSPSEMDRMRKSYESIVSGDTNSNSKRKADKPKTQ--REKDYLSHKRAITL---------LLLIIGAFAITWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPLCYAFGNRHFKKYFKEIFV 1245
            N T  +P + P     +G+TT L   LSL TV GNL+V+  F  +  L+   NYF+LSLA AD+ IGTFS+N Y  YL  G W  G ++CDLWL++DY   N S + LL IS +R+  V     +R + T +R    I + WL+SF++W PAI  + Y+ GERTV  GQCY+QFL + P +T  TA   FY P+  M  +Y  I R    R +    L+ +  P +       S   +      P                                  S+ S+    P     I   +  P      ++   S  +       K +    K Q  R K+ L+ ++  +L         L  I+ AF +TW PYN+M +++ FC+ C+    W  GY  CYVNS +NP+CYA  N+ F+  F+ + +
Sbjct:   12 NITVLAPGKGPWQVAFIGITTGL---LSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQ-PIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLL 434          
The following BLAST results are available for this feature:
BLAST of TCONS_00000635 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACM15.667e-6532.32Muscarinic acetylcholine receptor M1 OS=Homo sapie... [more]
back to top