TCONS_00000635-protein (polypeptide) - C. hemisphaerica

Overview


Name	TCONS_00000635-protein
Unique Name	TCONS_00000635-protein
Type	polypeptide
Organism	Clytia hemisphaerica (Jellyfish)
Sequence length	427

Sequence

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>TCONS_00000635-protein ID=TCONS_00000635-protein|Name=TCONS_00000635-protein|organism=Clytia hemisphaerica|type=polypeptide|length=427bp
MECTHNIFQFSFSQEVRKNIKVDVTFAMDNNTTYSPRQSPEVVGVTTSLM
VLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADVFIGTFSINFY
NVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIERFVGVHYTAF
HRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERTVKDGQCYVQF
LYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKRKYHLRENSIP
PETSSERRPSSSRERKYSVRPSIASTTVISPERRPTIATIIGSPSEMDRM
RKSYESIVSGDTNSNSKRKADKPKTQREKDYLSHKRAITLLLLIIGAFAI
TWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPLCYAFGNRHFK
KYFKEIFVAIKKRICCPKAGLVTIKQH

Run BLAST on NCBI

Gene-mRNA-Prot

This polypeptide comes from the following gene feature:


Feature Name	Unique Name	Species	Type
XLOC_000381	XLOC_000381	Clytia hemisphaerica	gene

This polypeptide derives from the following transcript feature(s):


Feature Name	Unique Name	Species	Type
TCONS_00000635	TCONS_00000635	Clytia hemisphaerica	transcript

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR000276	GPCR_Rhodpsn
IPR000995	Musac_Ach_rcpt
IPR017452	GPCR_Rhodpsn_7TM

Vocabulary: **Biological Process**
Term	Definition
GO:0007186	G-protein coupled receptor signaling pathway

Vocabulary: **Molecular Function**
Term	Definition
GO:0004930	G-protein coupled receptor activity
GO:0016907	G-protein coupled acetylcholine receptor activity

Vocabulary: **Cellular Component**
Term	Definition
GO:0016021	integral component of membrane
GO:0005887	integral component of plasma membrane

GO Annotation

GO Assignments

This polypeptide is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0007186	G-protein coupled receptor signaling pathway
cellular_component	GO:0016021	integral component of membrane
cellular_component	GO:0005887	integral component of plasma membrane
molecular_function	GO:0016907	G-protein coupled acetylcholine receptor activity
molecular_function	GO:0004930	G-protein coupled receptor activity

InterPro

Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR000276	G protein-coupled receptor, rhodopsin-like	PRINTS	PR00237	GPCRRHODOPSN	coord: 45..69 score: 25.27 coord: 78..99 score: 30.89 coord: 208..231 score: 22.52 coord: 374..400 score: 29.65 coord: 123..145 score: 28.18 coord: 159..180 score: 24.93 coord: 337..361 score: 26.45
IPR000276	G protein-coupled receptor, rhodopsin-like	SMART	SM01381	7TM_GPCR_Srsx_2	coord: 54..407 e-value: 0.008 score: -68.0
IPR000276	G protein-coupled receptor, rhodopsin-like	PFAM	PF00001	7tm_1	coord: 60..392 e-value: 2.0E-62 score: 210.8
IPR000276	G protein-coupled receptor, rhodopsin-like	PROSITE	PS00237	G_PROTEIN_RECEP_F1_1	coord: 129..145
IPR000995	Muscarinic acetylcholine receptor family	PRINTS	PR00243	MUSCARINICR	coord: 364..382 score: 45.77 coord: 42..54 score: 19.4 coord: 93..103 score: 52.57 coord: 395..409 score: 31.01
None	No IPR available	GENE3D	1.20.1070.10		coord: 13..421 e-value: 3.6E-82 score: 275.4
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 249..270
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 308..328
None	No IPR available	SUPERFAMILY	81321	Family A G protein-coupled receptor-like	coord: 28..266 coord: 333..413
IPR017452	GPCR, rhodopsin-like, 7TM	PROSITE	PS50262	G_PROTEIN_RECEP_F1_2	coord: 60..392 score: 36.701

Blast

[Close]

BLAST of TCONS_00000635-protein vs. Swiss-Prot (Human)
Match: ACM1 (Muscarinic acetylcholine receptor M1 OS=Homo sapiens GN=CHRM1 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 3.474e-72
Identity = 146/432 (33.80%), Postives = 205/432 (47.45%), Query Frame = 0

Query:   30 NNTTYSPRQSP---EVVGVTTSLMVLLSLFTVVGNLMVIYIFVKHKNLQIAKNYFILSLAIADVFIGTFSINFYNVYLAFGGWPFGNISCDLWLSMDYSCCNVSTLTLLAISIERFVGVHYTAFHRNQFTKKRLKRTIFIIWLISFLVWFPAIFAYPYIHGERTVKDGQCYVQFLYESPSMTIVTAFINFYGPIIFMVIIYILISRTLIKRYKRKYHLRENSIP--------------------PET-----------------------------SSERRPSSSRERKYSVRPSIASTTVISPE-RRPTIATIIGSPSEMDRMRKSYESIVSGDTNSNSKRKADKPKTQREKDYLSHKRAITLLLLIIGAFAITWFPYNLMAVIAPFCRKCIHADWWHFGYIFCYVNSLLNPLCYAFGNRHFKKYFKEIFV 408
            N T  +P + P     +G+TT L   LSL TV GNL+V+  F  +  L+   NYF+LSLA AD+ IGTFS+N Y  YL  G W  G ++CDLWL++DY   N S + LL IS +R+  V     +R + T +R    I + WL+SF++W PAI  + Y+ GERTV  GQCY+QFL + P +T  TA   FY P+  M  +Y  I R    R +    L+ +  P                    PET                             S E   SS  E   S    +    ++ PE + PT      SP+ + R  K              K +  K KT      +  K+A   L  I+ AF +TW PYN+M +++ FC+ C+    W  GY  CYVNS +NP+CYA  N+ F+  F+ + +
Sbjct:   12 NITVLAPGKGPWQVAFIGITTGL---LSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQ-PIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGS--EVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKT---FSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLL 434

The following BLAST results are available for this feature:

BLAST of TCONS_00000635-protein vs. Swiss-Prot (Human)

BLAST of TCONS_00000635-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1


Match Name	E-value	Identity	Description
ACM1	3.474e-72	33.80	Muscarinic acetylcholine receptor M1 OS=Homo sapie...	[more]

You are here

TCONS_00000635-protein (polypeptide) - C. hemisphaerica