Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000609 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000609
Unique NameTCONS_00000609
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3086

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000609 ID=TCONS_00000609|Name=TCONS_00000609|organism=Clytia hemisphaerica|type=transcript|length=3086bp
TTCAGTTTCAGGATTTTGCAAAAATACATTGGGCTAAAAGGTAGAATTGC
TGGTCACTGGAcatcgaacaaaaaaaaaatatcttaaatatCTTCGATAC
TGCTGACTCTCAACTACGCCTAAAATAGAAGGATTcgtttaaaactttca
aatgcTGATCATCGAATCAAGAAATGTGGCATGAATTATGTGGAGAACAA
CTAAACAGTTTATCAACAATTATGTctacaaattaaaattgaacaaaatt
gaACGTTCGAACGTTTTATTACTATACACAATAGCTATTATACTAATCAA
CACAAACACCATATTAGGAATACAAGATAATCACGTGATGTCAATAAACA
ATAACTCGTCAGCGACCGATCATATGAGAGAATTATCAAAGGACAATGGA
ACAATAACACCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGGCA
CGTCAATCATGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGATT
GGTCCATCGAGAAAGGATGCAATATTTCCGCACTATTACAAAAACTATTG
AAAGGATATGATAAAAGATTGCGACCTTTAATGGATTTTCAAGAGCCAGT
GATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCAATAAATGTTA
TAGATATGGATTATCAAATCGACTTCTTCTTTCGTCAAAGTTGGACCGAT
GAACGTTTAAAACATTCCTATCCACAGACTCTAACTCTTTCTAATTCTAT
GCTGGACAAATTATGGGTACCAGATACctattttgaaaactcaaaaaatt
cacaatttcaTTCAGTCACTGTACCaaataaaatgttgaaaatcaaACCG
GACGGCACTGTTTTATATAACGCAAGGATATCGGTACGCGCATCATGTCC
AATGGATTTGCGCATGTTCCCTATGGATTCACAAGAATGTAATCTCAATA
TTGAAAGCTatggTTACAGTGTGTATGACATACGTTTCCAATGGGAAGAG
GATAAACAGAAACGACTTTCTATCGGCACTAAAGTTCGTACACTACCACA
ATACAATCTCACACAATTTGACACAGCTAACAGTACAGAAGCTTATGTCG
TAGGTAATTATTCAAGGTTGACAGCTATTTTCGTATTACAGAGACGCACC
GGTTACTTCTTTCTTCACTTGTACGCGCCATGTGCTCTTATTGTTATGAT
TTCATGGATTAGTTTTTGTATACCAAAAGATTCGACGGCTGCCAGAGTAG
CATTGggaatcacttcagtgttgaccATAACCACTATCTTAAACATGCTC
AATACTGCTATGCCAAAGGTTTCATACATCAAAGCGGTCGATTGGTATTT
GATCGTCAGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTGG
TTTTATACCTcactgataaagaaaaacaaacacaggaagaaaataaaaac
aaattcaaaaagaaaagaccACCAAACATGGACAAACAGTTCGTTGGAGC
AAATGGTCACGTGATCGACCGTAATAACCATCACGAATTACGTTCAAGGG
CGTACCAAAACAACAACTACAAGGAAAATCATTACGATTGTTCTGACGGT
GAATTTCAAACGAAACCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACG
AAATCATCGACAAAACCATCATCACCATACGCGCGCGCATAACGACGACG
ATCATTCGGCGGCGCTACAATCGCACACTGGTAAATTTCTATGTGAGTTC
CGTGTAGATGTTATAGACGAATATTCGAGAATGATTTTCCCACTTGCGTT
TATCATTTTTAACATTGTATATTGGTTACTGTTTTACagtaaaaagaatg
aaaaatgaatggCATGGTTCAAAATTTTGCAGCTTCGGTTTTACAAACAA
AGAAACATTGGAGAGACACCGAAAGAATACTTGGGAGTGATATTTTTTAA
TGGGAATATTATAGAAAGGAAGAAGAATCAAAAATCGTTTCAAAGAGCTC
ACAAAACTCTTTTTATAACGGAGAGACATTTTTTATGGATGAAAATGATA
CATTGTTACTTTATTATGGAGCAAATAGGCATATAACATTAGccaggcac
gacgcaacgggtacggcaggtacggccgccgccgtaccagattttcacaa
aaatacccgaagttttcctcttcgtcggtcaaaTCGCTATAAAGTCGCTT
AAATTTcgtcattcgccgtaccagatataaaaagcttccgtcgtgcctgt
tAGCATTGCTTAGAATTACATGATTTGGTGATATATTTTACAAGTAACGT
GGATATCGATTGACACTTCAACCATTAATTACAAACTGTCTAAAAGCCTA
CCATATTTCCTAGAATACGAAACGCGCTACAGCGCTCTCTGAACGTTTTG
AATTGTTGATTTTAGGTACAGCATTCTCTAGAGGGCGCGCTTGGCGGcat
tatttttaacttttgaaatatccaTTTCCAAACAGCTCTGAATTTAAGTT
TAAAAAACGCATACCGTATAatttcgaataagcgccccgggcgtttataa
aaaattttgtatttaagAAGGGTCGTTTACTCGagagggcgtttaaaaga
aggggcgtttatttgaagtaatacgaTACATGGTTTAAGcctttaaatat
tttatcaCGAGCTCGAAAGCAAAGATAAACCATTCTTTGGGGTTCAGCGC
TTGTTAAAGGGCGGCGCTCTTGCCAGACTTTTTGAAGGGTGGTGCTTATT
GGTGGAAGGCGGTTAAAAATAGGAAATACGTACATCTATGTACATCCAGA
AGATATAGTAAATACAGACTGAAAATACGTATAGGTAACACATTTGACAG
AATAAGaaatactttgaaataaaaaatattaatggacaaattaaaatatt
taaaatttagaaatgctTTATGTACCCCTTCGATATACCTCTTttggttt
tgaattttattggTATACTTTAAGCAAAAATAGGTGCAAAGGTATTTGCG
GACGGTGAGGGTCGGTTTCTTTAACTTCccaagtctctctaaggatgtcc
aaaacaataaaaagtaaaactggtctctctaagggt
Run BLAST on NCBI

protein sequence of TCONS_00000609-protein

>TCONS_00000609-protein ID=TCONS_00000609-protein|Name=TCONS_00000609-protein|organism=Clytia hemisphaerica|type=polypeptide|length=556bp
MWRTTKQFINNYVYKLKLNKIERSNVLLLYTIAIILINTNTILGIQDNHV
MSINNNSSATDHMRELSKDNGTITPLANHNVTHSLKWHVNHERMLWQNKC
TEYDWSIEKGCNISALLQKLLKGYDKRLRPLMDFQEPVMVTVGFWILSID
SINVIDMDYQIDFFFRQSWTDERLKHSYPQTLTLSNSMLDKLWVPDTYFE
NSKNSQFHSVTVPNKMLKIKPDGTVLYNARISVRASCPMDLRMFPMDSQE
CNLNIESYGYSVYDIRFQWEEDKQKRLSIGTKVRTLPQYNLTQFDTANST
EAYVVGNYSRLTAIFVLQRRTGYFFLHLYAPCALIVMISWISFCIPKDST
AARVALGITSVLTITTILNMLNTAMPKVSYIKAVDWYLIVSFLFVFAVLI
EYTLVLYLTDKEKQTQEENKNKFKKKRPPNMDKQFVGANGHVIDRNNHHE
LRSRAYQNNNYKENHYDCSDGEFQTKPLIVVLEEKNLRNHRQNHHHHTRA
HNDDDHSAALQSHTGKFLCEFRVDVIDEYSRMIFPLAFIIFNIVYWLLFY
SKKNEK
Run BLAST on NCBI

transcript from alignment at sc0000002:1497124..1509344-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000609 ID=TCONS_00000609|Name=TCONS_00000609|organism=Clytia hemisphaerica|type=transcript|length=12221bp|location=Sequence derived from alignment at sc0000002:1497124..1509344- (Clytia hemisphaerica)
TTCAGTTTCAGGATTTTGCAAAAATACATTGGGCTAAAAGGTAGAATTGC TGGTCACTGGACATCGAACAAAAAAAAAATATCTTAAATATCTTCGATAC TGCTGACTCTCAACTACGCCTAAAATAGAAGGATTCGTTTAAAACTTTCA AATGCTGATCATCGAATCAAGAAATGTGGCATGAATTATGTGGAGAACAA CTAAACAGTTTATCAACAATTATGTCTACAAATTAAAATTGAACAAAATT GAACGTTCGAACGTTTTATTACTATACACAATAGCTATTATACTAATCAA CACAAACACCATATTAGGAATACAAGATAATCACGTGATGTCAATAAACA ATAACTCGTCAGCGACCGATCATATGAGAGAATTATCAAAGGACAATGGA ACAATAACACCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGGCA CGTCAATCATGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGATT GGTCCATCGAGAAAGGATGGTAGGTATAATTCACAGGTTTTGAATGTATT CATTGAATGTATGAAAACTTGCAATTATAGTGGAGTCTCCATAACTCGAA CAAGTAGGGGGACACAAATTTGTTCGAGTTATAGAAATTTCCAGTTATGG CGCTCTAAATTTAGAACGCCATGAGTAAGGTCTATAAGGTATTGTTATCA GGGATTATAAAACTTGTTCGATATTTAAGTTACAGAGGTTTGAATTTCAA AGACTAATACTTTAATTGTCGGCACCCATCCCTAATAGAGATTTTGTTAA ATAGACAATTACGCTTAGCGTGATTTTTGAGGCTGTTTGCAGATACAACG CAGAGGGTATGGCAGGTACGGCGGCTGCCGTACCAGATTTTCATGTAAAA CCCCAAAATCTTCCTCTTCGTCGGTAAAATCGCTATAAAATCGCTTGCAT TTCCTCATTCGCCCTACCAGATAAAAAAAGTTTCCGTTGTGCCTGGTTTG GCATACTTCATAGCGAAATAAATCAGAGAAATCCTACTTGACGGTGTCTG TCTGTTTAACATTCGCCAATTAAAGCGAGTGATTAATGGTTTAGTCTGAT GGAATTATCCAAGGGGTTCAATGAGTTCAAGGAGTAATAGTAGATATAAA AGAGGGAACAATTTTAATTTATACAAACTAAATCCCATAACAATAATCGT GATATTATGTAACGCCTATACTACTGTATTACACGCATTATAAACGACCC CATCCTATTCAAGGAGGGGCGGCTTCTTGCCTACTCAAAAAAATTGTGCA AGGTTCAACAAATAAAAATTCTAAAAATATCATTTCCATGAGGCATCAAA AGATAAAATTTTCCTTGTTAGAAAAACGGTATCTAGGATTAAAATACATC TGCTCTGAGACGTTAGTTTCGTTCATATTTCACCATTCGGTGGACCCTAT AGATGAAAATATATATAATCTTCTGAAAACAAAGGCATATGGGTTATGTT ATTTCAAAATTCAGAGAAAAAAAAGTTCCAATCCCTGAAAATCTAGTTTT TTATACGTGTAATCTTTTTTCACCACCACTAAGCTTGGTATTTTTAGTGC AAACCCTTTTTTAGAACCAATGTCCATTTTGACTTGCAAAAACTTTAATT CTAGGAAGTAAGTAGGCCGAAATACATTTTGTTATAAGGGATGTTAAAAA ACTTCCTCTCAGCAAATCTTCGGGATTGGCAAGTTATTATGTCACCTTTA TCATTTATAAACCTTCGTCACTTTTATTGAATAAAAAAGCAATCCTTGCG TACCAAGATATCATTCATAGCTGAAATTGTATTGTCGTCAGCGATTCTAA ACTTGCGGACATCTGTTCTTCATCCCTTGTAACAAAAAAATATCAAAAGA AATTAAATTAAAATTATAGACAATTTTTTGACATTAGCTTCTATTAAAAA TTTCAACTTTTTCGAATAAATTAGGCTTTACCGCTATGGAGCTATATTCC ATAATTTTAACCCCTAATTTCAACAAAGATTTATACTTTCTTCTAAAAAA TTTGACATCAATCCTCAACAGTTTTCTTATCATTCAAACCACAAACCTTC TTATTTTTTGATATTTCTTTCAGCAATATTTCCGCACTATTACAAAAACT ATTGAAAGGATATGATAAAAGATTGCGACCTTTAATGGATTGTAAGTATA TAGAAACAATTTTTTATTCTTCAGACTCTTACACTCTCTTCTTACACCCC TCGAAGACCCGGGTAGGATTTTTCAAGCCACAGGGTGAAAATAATGGACT GAAACTTGATGGGAACTGTTATTCCCGTGTTTTTATACACCCTCTTCTCA CAGGCCCGGTGGGATTTTATCAGCCAGTGGAGGTAAAAAAACGGTCCAGA ACTCGATGAGGATTGATTTTCCCATGTTTTTTATGGCTGTAGATCTGAAT TCCACTGTTTTCAAATTAGAGAATGCATTGGAGATTAAAGAATTAGCACA ATATTTTGTAGTGTAAAGATTTGTTTATTTGATTTTCCCAGAACCATTTT CGGCTAATTTTTTCAGTAGGATCTCACCGGTGCATAAATTCTATGTGAAA ATCACCTAAATACAGTACTCTTAAACAACGCCAAATCTACACCCGTGCGA TTCATTTGTTATGCCGGGGTGGGTGGTAAAACAATGCGCCAAGCCTATGA AATGATCTTCATACTTAAAGAAAACTATCCAATTGGTGAACTTCGTTGTT TCAATGTTTTTCTAACATTCCAATGACACTTTGAACGTTAAAGGAACGTC GTAAAAACGTTGAGGATCAACTGGGAATGAGAAATGCACTTGATTTTCCT TTTGTGAGAACAAATTTTTATAAATCTTTTTCTTTTGTGTCATAGTTCAA GAGCCAGTGATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCAAT AAATGTTATAGATATGGTAAATATTACTGTATTTTTGTTCTACAAAGAAG TTATTCTGTGAATGCCAGTCTAAAACGGTTTAACCGAAACTAATGCAAAC TGCTTTTAACTTTCGATGTCAAGGATCAGTGAAGAAGTTGGTCCAATTAT AAATTCTTTGGCCGGCCTCTAACTCACAAACAAGGCTAATGGACCCGGTA CACCTTTTTTCTAAGAACAAACTATATAAGAGCATAAGGCTTCGAGGGCT AAATTGTTAAGACCTAAGTTAAGAATATCTTAAGGCTTTTTTATAAGACT TAGAACACCCAATTTCTTAGGAAAATGGACAAAAATACTCAAAAATTGGT GAAAATAAGAACATGTTAAGAACATTTTTAGGCTTAAAACTCAAAAAATT AAGAACAGCCGAAGGCTTAAAAAAATTTAGATTTTCTTGTAAAAAACGTG TATTGGGCTTCTATATCCCTCTTTCCCTACAACCGTAATAATTTTCATAT TTTTTAAAGGTCATCCTAGACATATTTTCTTCATTTTTTCTTTGTTTTTC ATTTTCATAAATCTTTTGCTTCCCAGACGTAGTTAAACGATAAACATGGA GAAAAATTTGTAAACTCGAACAGTTTGAAGAAAAATCTACAGTCTGGAGG TCAAGATGTTTGCTTTTTCAAACATAACTACTAATATTTCTAAAATATTC TAGACGTATCATATCAAACAATGATTACGTAATTTCTTAGCTATTAGACA CGTGACTATGTTCAAGTTTAAAATGATGACGTAATTTTCAACATTCAAGA TGGCCACCTTTTTGTTTTCTGTATAGAGAGCTTATGAAAGCACTTAGCCT ACAAATTAAGCCGTAATATTTACTACCGATTTACGAGCCAACCATAGAAT ATCTAAGAATGATCTTTTGCAACGTGTATTAAAATTAGGTCGTAATAAAA TATCAAACCGCTTGGACAGAGACCCATTTTGAAACCACGCCTTATTGACA TTAGCATTACCACTTTTGAGCTTTGGCCTTCAAATCACCACGGCTCAATT TAAAATGGAAACGATGCCTCGTATTAAAAGGATTTTTCCTCAAATTGAGG ACACTAAAAATTCTTTATCGAGCTATTCATAACCACAAAACAAAATACAA TTCCTGTAAAAAATAGCAATTTAATATTCTATTTAGAATCAAAAGTTTTC ACCCCACTATACACCCCATTATCCAGATATATTTCTGTTCAACTATCTCC TTTCAGGAGATTTGGGTGGCAGATTAGCATATGCATTTCATCCTTATTAG GACTCGTCAGCACTGCATACTGCACCCTGGCTAGGCAGACCGAATTGCCT ATATATTTGGTCCTTGAAGGGTTGAAATATCCTTGGTCGAATGTATTTCT TTATCTTTCTATTCCAGGATTATCAAATCGACTTCTTCTTTCGTCAAAGT TGGACCGATGAACGTTTAAAACATTCCTATCCACAGACTCTAACTCTTTC TAATTCTATGCTGGACAAATTATGGGTACCAGATACCTATTTTGAAAACT CAAAAAATTCACAATTTCATTCAGTCACTGTACCAAATAAAATGTTGAAA ATCAAACCGGACGGCACTGTTTTATATAACGCAAGGTGAGACCTGTGAGG ATTCAGGGAAATTCACCCTACCGATACACCGGGCAGCGCCAAATAATGTG CGGTATTAAGAAAAAGTACTTCTGGATACTGGACAAAATGCATCGGTATC CGATGTATCGGCAGGGTCGTATTTAAGTTTGATAAAAGACATTGAACTTA TCTGGGTATAACGGCAGGATAAAAATAAGTCAAGATAGGCTTTTGTTTGA AATTGGTTACCCTTGGATTTACCAATCTTTGCAACTATAATCAATGGGAA TTAAAGTACACTTCAGTACCACGTGCATCAAGGGAGATTGTACGGCCGAG GAGTGCTGTAACTTATGTCGCTCTTCTTTTTTTTACACTGTCCGAGTAGG GAGTAATATTTTATTCCTACTAGTTTAAGGGTAAAACGTGTAATATTTCG ATCACTTTTCAGGATATCGGTACGCGCATCATGTCCAATGGATTTGCGCA TGTTCCCTATGGATTCACAAGAATGTAATCTCAATATTGAAAGCTGTAAG TTTTATCAAACTTCTCTTTCTCGATTTTTTCTTATATCAGAAATTGCATC TCCCGAATAAAGGAAAATGGGTTGATAGCGCCACGGATGGCACTACGAAA AACTTCAAAAAGAAGTTTCTCGGTAGAAAACTCTGCTCAATTCTGGTAGA ATTAACCATTGGTGGATCTTTATAGGGGTCAAAGTGAGAAGATTTATAAG ACATGACAAATTTCCTTCAGTCCCTAGTTTAGTGGAACAAATTGCTACAA AATTTTGAAAAATCAATTAAATTCTTGGCTTCTTGGCTTCCCGGCTTCTC ATATCAAAAATATTCAAATTTCTTTTTCAGATGGTTACAGTGTGTATGAC ATACGTTTCCAATGGGAAGAGGATAAACAGAAACGACTTTCTATCGGCAC TAAAGTTCGTACACTACCACAATACAATCTCACACAATTTGACACAGCTA ACAGTACAGAAGCTTATGTCGTAGGTAAGGTTTAATAACAAAATAATGTT AAAGTAAATTACATCTCTGAACCCTTGAAACTTTAGGGAACTGGGTTAGA GTTTACCAGGGATTTTCAAACGTCAAAAGTATTAAATCTTTGCATTAATT TCATCAAAGACAAAAAATCCTAGCGCTTTAGAGCTCTATAGGAACTTTAG GAAAGACTGGAACACACTGGACTCAGACGGTGAAAAACATACTTTGGGAT CTGGTTAGAGAATTACCCAAGATTCCATTATTAATCCGATATTTTCTCTT TCCAGCTCTGCTGGGCTTGCTGTGAATGGATATCTCCTTAACAATTTATA TCTAAAAATGAAAACGGTCTGTGTTTGAAACAGTAAAACTGTGAAAAGTG TTTACAATCACCGGTTTCACACAGCAGAGTATTAGTCTCCACCATTTCAG ACTACATTTTTGAGATCACTGGGGCTGAAGAATCGCTGCAACTCCTGATA TTGCGCAGGGAGGTTTTTGTTACCTAAGCTTGAAAGATTGAAATCAAAAA TAATTGCGACCCACTCTGGAATTCCAAATAATTTTAAGGGTAAAATAAAA AGAAGTAAAGTCAAGTATTGAATAGTTTGCTCGAAATTCGCCTGAGTTTA AGGTTGATCTAAAGCTTTTGTTACTCCAATTGGAATATTTATATTTTACA TTTTCACCGAAAGAATTTGAAAATATTTTCCCTTGTTTTCAAAAATCTTT CTCTGAAATTTTAGCTAGGTATATATTTTCCCACGAATAACTAGCAAAAC TAGTAGTAGTAGTTTGCCGTACTTTGCGGTTGAAACTGCGAAAGCAAATG CTTTTTTTGACAAAGCAACGTGGGCCTAATTTAAGCGATGTTCTTGCAAA ATAACATCAGAAGGTTGTAATAAGCTATTTTTTAGATATATCAGTAGGCC ACACAGCAGACTACATCTCATAGTCACGGATATATTAAAGAGGGTGCGCA AAATAAAGGAGCCCTGCCCTTGCTTCTGCTACCAGGCAGAAAGTCCCTAG CATGTAGTGAGACCTCAGAACTTGAAACTACGAAATATTGTAGCTAGGTC CTACATTGTCGTAGGTAGTCGTAGTCTTTCACTGTTAAAGTGAAAGATTG GAGCCCAACCCTACCTAAGATGGGTAGCTATCAAACAAAGAGGCTCTTTT ATACTTACCTAAAAAAGCTGAGGTTCTTATTTTCTCTGTGATTTACACGG GGATTTACATAACCTATCTCATCAAAAATTCCCTTTCTCCCTTTTTTTAG GTAATTATTCAAGGTTGACAGCTATTTTCGTATTACAGAGACGCACCGGT TACTTCTTTCTTCACTTGTACGCGCCATGTGCTCTTATTGTTATGATTTC ATGGATTAGTTTTTGTATACCAAAAGATTCGACGGCTGCCAGAGTAGCAT TGGGAATCACTTCAGTGTTGACCATAACCACTATCTTAAACATGCTCAAT ACTGCTATGCCAAAGGTATGACCTCTTTATTTTGTCACCCTCTTCTAACC AGTCAACTAATTCGAACCTCTACTATTCGAACCAAAATAAAGGCTTGGAT TCCGATCAAAGTTTTTGGTCCCTTGAGAATCAATTATAGAGAGAGTCCAT TATATGTACTTCCGTCAACACATGTCTTATCAAAGTATCTCAAGGGGTTG CAAAAATGAAATAACATAGCCTAAGTGAAGAACTCTAAAGGAACTCTTTT GACTGTCTTCTCTCTGGGAAATACTTTTTTCCATCAAAATTTATAGTCTG AATCGCAGACCTCTAAAGATACATTTCCTATAAAAGAAACATTTTTCGCT AGAGGATGAGCAGATACCCACAAAATTTAGGTACTTTTTAGAACTCTTTA GGAGAAGGGTTTGTAAGTGTGGTCCGCACATATCCGACATTCTCCAACCC TAGTATATCCTAGTAGCTCTCAAAACCTTCTCCCTCCAATTGACTGAAAC GGTTCGCGTCTTTGTAACATTGGATAGCTCAACGAAATTTAGGACCATTG AGAGTCAGTTCTCTGTTGCCAATATAGAGAAATATGAAAACTTTGACTTT CTCAGCCAACTAACCGACCAAAGATTACTAAAAGACAATTAGGGAGGGGA GTAAAACTGTAGCCAAAACAACCAAAACTGAACATTTTGTTCCTTTCTCC ATTTCTCTCATTGAATTCTCCTTTGAATCTTCACGTTCACCAGTGTATCC AAAAGAAAAAGAAATGCGGTGTTTCTTCAATTAGTTAAAATTCCTACCAA AAAATATCCATATCGTACAGTGCTCATGTAATAAACAGTCAAGAACACCT TCAAATTAGCCTATCATAGGCTGACTAGCCTATCATAGGCTATTTAGACT ATTTTATATAGGCTATTTAGCCGAAAATTGATAAAAACCTCGATTTCTGA CGAAATATAAATAGTCGCGTCTATTTTTCCCCATTACTTCATTGTCCAAA GCCAAAAGAATCTTTTTCACTTAAACTGATATGACTNTATCCGACATTCT CCAACCCTAGTATATCCTAGTAGCTCTCAAAACCTTCTCCCTCCAATTGA CTGAAACGGTTCGCGTCTTTGTAACATTGGATAGCTCAACGAAATTTAGG ACCATTGAGAGTCAGTTCTCTGTTGCCAATATAGAGAAATATGAAAACTT TGACTTTCTCAGCCAACTAACCGACCAAAGATTACTAAAAGACAATTAGG GAGGGGAGTAAAACTGTAGCCAAAACAACCAAAACTGAACATTTTGTTCC TTTTTCTCCATTTCTCTCAATGAATTCTCCTTCGAATCTTCACGTTCACC AATATATCCAAAAGAAAAAGAAATGCGGCGTTTCTTCAATTAGTTAAAAT TCCTACCAAAAAATATCCATATCATACAGTGCTCATGTAATAAATTTTCT CTAATTCTAACCTGTAGAATTCTCTTTGAAGATCGAACTAAAGCGCTGTA CGAATGTTGGATACCATTACGGGCATTGCAACCCAGCTGGCACGCAACGT TGTTTTAACGTTCATCTAACGTTATATGGACGTTATAAACGTTGAAACAA CGTTGTGTGCCAGCTGGGAAACCAGCCGGGAAACTTACCTCTTTAACTTC ATTGCTCTACACAGGTTTCATACATCAAAGCGGTCGATTGGTATTTGATC GTCAGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTGGTTTT ATACCTCACTGATAAAGAAAAACAAACACAGGAAGAAAATAAAAACAAAT TCAAAAAGAAAAGACCACCAAACATGGACAAACAGGTAAAATACCATTTA CGAGCGTCAATTTCTATGCAGAAAACGGGAAAAAAAGTACCTTAAAAATG ATGTAAATTTGCCTAAATTACAGAAATGAATTACATTTGTATAATATGTA TTTATATGCATTGTTGAGTTGGTAATTTTTCTAAAGCTACGGCTACAATC TTCACCTTTGTATGGAGTGTCCCTTAATTCAAGAGTTTCAAGTTTTCCTC TCTTCCCCTCGAAATAACGAATATGAAAAGGGGGATTACGCATGGGGTGT TTCAGAAGAAAACATAACCCCTGTTGCTAGGGGGTCCAATCTTTTTGGCT TTACCTGGGAATTCCAACTTAAATACTTAACCTTTCTTGTTTCAAGCAGC TCCAGATTTTAAAAATTCACTTTCCCCTGAAACTCCGGTTATTTTTCAAG GAACTTCGCAGACCCTTATTGAATTTAAACAATTTTTAAAAAATCAACTC CATAGAATGGCAATGAATATCCTTAACAGGGATATGTAGAAAGTTTATTT CTGGAAAAACTCATAAAGAAAGTTCATTTTTGGATACTAATTATTCTTTC AGTTCGTTGGAGCAAATGGTCACGTGATCGACCGTAATAACCATCACGAA TTACGTTCAAGGGCGTACCAAAACAACAACTACAAGGAAGTATGTGTCAA TGTCCCCCGTCCATAACGGTTTGCTAGCCTGTACCAAACCCTTTTATCGC TAACTGAAAAGATAAACTCGAAGTTCGGTTTGTTACGGTTAGGCAACATT CCGTGTTTTATGAGATTTTTACGCAAATCTCTGAATGTTTCTGCGGTCAA GCGTAGCTATTTTTAGCATTCAATCTAGCTCAACTAAAGTGACGTTACGT GAGCACTCCTACACTTTTGTTTCGGATTTTGTCCAAGAAAGCTTGGACAG AGTGAGATGCATAATCTCACTAACCGAAACAGACCGACACACAGCAAGTT TTTTCAAAATATGAAAAATGCCCGTTGGAGGGGCGGTTTGCGTGATGATG TGGGTTTTATAGTTGCATGAACGTGCGAAGATCGAAAAACAGAATACATG AAAAAATATTCCAAATTTTCGGAATATATGACGAAAATCTCGAATTTAGA AGAAACTTTCGATCGCAGAATTTATGTTACGTTAGCTTAGACGGTCTGAC CGAATTTGAGGACAAAATTGACGAATATATCCGATTGGGTACACACCCCC TGAAATCCTCCCCTTAAAAGTGGAGCATAAAAACAGAGTAAGAAGTGACC AATCACAGTTGATTCGAAAGGAGAGAAGGGACAATGTTCGAGTGCAGAAG TGTAAAATGTACGATCTTTTGACAAAATTTTAGAAAAAAACAATGAATTT TTATACACCTTTTCGACCGTAGCTGCCAATTGCCGCGTGGGCATTTTTTG TCCGTTTTACCACCCTAAAACCGTCCCAGTCTTTTTTCACACTTAAAGAA AATAGAAAAAGTGTAAAAAAAGGATTGGATCGAGTTTAGGGTGGTAAATT AAATAATAATGTGGCACTTGCCTGACCGCGCGACTACGGTCGAAAAGGTG TATTGCTCTATCATGAGCTAATAAAGTTGAGTATATCAATTCTCTAAACT TTCGCAAATCACACTCTGCGTCGAGTAATTTCGCATGGAATTTCATTTTT TTGGCTACAAAGTTATCTGATAAACACTGTATCACTGATATTCCAAATCT AATACGTCATACAAAAACGTATCTAAAGCGTTGATCACGCCAGTCATACC TGATTTAATTTTTAAAAGATTACGTCATTAAGGATCAATCAAAATTCACT TTTCTCTTTAGAATCATTACGATTGTTCTGACGGTGAATTTCAAACGAAA CCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACGAAATCATCGACAAAA CCATCATCACCATACGCGCGCGCATAACGACGACGATCATTCGGCGGCGC TACAATCGCACACTGGTAAATTTCTATGTGAGTTCCGTGTAGATGTTATA GACGAATATTCGAGAATGATTTTCCCACTTGCGTTTATCATTTTTAACAT TGTATATTGGTTACTGTTTTACAGTAAAAAGAATGAAAAATGAATGGCAT GGTTCAAAATTTTGCAGCTTCGGTTTTACAAACAAAGAAACATTGGAGAG ACACCGAAAGAATACTTGGGAGTGATATTTTTTAATGGGAATATTATAGA AAGGAAGAAGAATCAAAAATCGTTTCAAAGAGCTCACAAAACTCTTTTTA TAACGGAGAGACATTTTTTATGGATGAAAATGATACATTGTTACTTTATT ATGGAGCAAATAGGCATATAACATTAGCCAGGCACGACGCAACGGGTACG GCAGGTACGGCCGCCGCCGTACCAGATTTTCACAAAAATACCCGAAGTTT TCCTCTTCGTCGGTCAAATCGCTATAAAGTCGCTTAAATTTCGTCATTCG CCGTACCAGATATAAAAAGCTTCCGTCGTGCCTGTTAGCATTGCTTAGAA TTACATGATTTGGTGATATATTTTACAAGTAACGTGGATATCGATTGACA CTTCAACCATTAATTACAAACTGTCTAAAAGCCTACCATATTTCCTAGAA TACGAAACGCGCTACAGCGCTCTCTGAACGTTTTGAATTGTTGATTTTAG GTACAGCATTCTCTAGAGGGCGCGCTTGGCGGCATTATTTTTAACTTTTG AAATATCCATTTCCAAACAGCTCTGAATTTAAGTTTAAAAAACGCATACC GTATAATTTCGAATAAGCGCCCCGGGCGTTTATAAAAAATTTTGTATTTA AGAAGGGTCGTTTACTCGAGAGGGCGTTTAAAAGAAGGGGCGTTTATTTG AAGTAATACGATACATGGTTTAAGCCTTTAAATATTTTATCACGAGCTCG AAAGCAAAGATAAACCATTCTTTGGGGTTCAGCGCTTGTTAAAGGGCGGC GCTCTTGCCAGACTTTTTGAAGGGTGGTGCTTATTGGTGGAAGGCGGTTA AAAATAGGAAATACGTACATCTATGTACATCCAGAAGATATAGTAAATAC AGACTGAAAATACGTATAGGTAACACATTTGACAGAATAAGAAATACTTT GAAATAAAAAATATTAATGGACAAATTAAAATATTTAAAATTTAGAAATG CTTTATGTACCCCTTCGATATACCTCTTTTGGTTTTGAATTTTATTGGTA TACTTTAAGCAAAAATAGGTGCAAAGGTATTTGCGGACGGTGAGGGTCGG TTTCTTTAACTTCCCAAGTCTCTCTAAGGATGTCCAAAACAATAAAAAGT AAAACTGGTCTCTCTAAGGGT

Coding sequence (CDS) from alignment at sc0000002:1497124..1509344-

>TCONS_00000609 ID=TCONS_00000609|Name=TCONS_00000609|organism=Clytia hemisphaerica|type=CDS|length=16710bp|location=Sequence derived from alignment at sc0000002:1497124..1509344- (Clytia hemisphaerica)
AATCATTACGATTGTTCTGACGGTGAATTTCAAACGAAACCGTTAATCGT
TGTCTTAGAAGAGAAAAACCTACGAAATCATCGACAAAACCATCATCACC
ATACGCGCGCGCATAACGACGACGATCATTCGGCGGCGCTACAATCGCAC
ACTGGTAAATTTCTATGTGAGTTCCGTGTAGATGTTATAGACGAATATTC
GAGAATGATTTTCCCACTTGCGTTTATCATTTTTAACATTGTATATTGGT
TACTGTTTTACAGTAAAAAGAATGAAAAATGATTCGTTGGAGCAAATGGT
CACGTGATCGACCGTAATAACCATCACGAATTACGTTCAAGGGCGTACCA
AAACAACAACTACAAGGAAGTTTCATACATCAAAGCGGTCGATTGGTATT
TGATCGTCAGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTG
GTTTTATACCTCACTGATAAAGAAAAACAAACACAGGAAGAAAATAAAAA
CAAATTCAAAAAGAAAAGACCACCAAACATGGACAAACAGGTAATTATTC
AAGGTTGACAGCTATTTTCGTATTACAGAGACGCACCGGTTACTTCTTTC
TTCACTTGTACGCGCCATGTGCTCTTATTGTTATGATTTCATGGATTAGT
TTTTGTATACCAAAAGATTCGACGGCTGCCAGAGTAGCATTGGGAATCAC
TTCAGTGTTGACCATAACCACTATCTTAAACATGCTCAATACTGCTATGC
CAAAGATGGTTACAGTGTGTATGACATACGTTTCCAATGGGAAGAGGATA
AACAGAAACGACTTTCTATCGGCACTAAAGTTCGTACACTACCACAATAC
AATCTCACACAATTTGACACAGCTAACAGTACAGAAGCTTATGTCGTAGG
ATATCGGTACGCGCATCATGTCCAATGGATTTGCGCATGTTCCCTATGGA
TTCACAAGAATGTAATCTCAATATTGAAAGCTGATTATCAAATCGACTTC
TTCTTTCGTCAAAGTTGGACCGATGAACGTTTAAAACATTCCTATCCACA
GACTCTAACTCTTTCTAATTCTATGCTGGACAAATTATGGGTACCAGATA
CCTATTTTGAAAACTCAAAAAATTCACAATTTCATTCAGTCACTGTACCA
AATAAAATGTTGAAAATCAAACCGGACGGCACTGTTTTATATAACGCAAG
TTCAAGAGCCAGTGATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGAT
TCAATAAATGTTATAGATATGCAATATTTCCGCACTATTACAAAAACTAT
TGAAAGGATATGATAAAAGATTGCGACCTTTAATGGATTATGTGGAGAAC
AACTAAACAGTTTATCAACAATTATGTCTACAAATTAAAATTGAACAAAA
TTGAACGTTCGAACGTTTTATTACTATACACAATAGCTATTATACTAATC
AACACAAACACCATATTAGGAATACAAGATAATCACGTGATGTCAATAAA
CAATAACTCGTCAGCGACCGATCATATGAGAGAATTATCAAAGGACAATG
GAACAATAACACCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGG
CACGTCAATCATGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGA
TTGGTCCATCGAGAAAGGATGAATCATTACGATTGTTCTGACGGTGAATT
TCAAACGAAACCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACGAAATC
ATCGACAAAACCATCATCACCATACGCGCGCGCATAACGACGACGATCAT
TCGGCGGCGCTACAATCGCACACTGGTAAATTTCTATGTGAGTTCCGTGT
AGATGTTATAGACGAATATTCGAGAATGATTTTCCCACTTGCGTTTATCA
TTTTTAACATTGTATATTGGTTACTGTTTTACAGTAAAAAGAATGAAAAA
TGATTCGTTGGAGCAAATGGTCACGTGATCGACCGTAATAACCATCACGA
ATTACGTTCAAGGGCGTACCAAAACAACAACTACAAGGAAGTTTCATACA
TCAAAGCGGTCGATTGGTATTTGATCGTCAGCTTCTTATTCGTGTTCGCA
GTACTGATAGAGTACACGTTGGTTTTATACCTCACTGATAAAGAAAAACA
AACACAGGAAGAAAATAAAAACAAATTCAAAAAGAAAAGACCACCAAACA
TGGACAAACAGGTAATTATTCAAGGTTGACAGCTATTTTCGTATTACAGA
GACGCACCGGTTACTTCTTTCTTCACTTGTACGCGCCATGTGCTCTTATT
GTTATGATTTCATGGATTAGTTTTTGTATACCAAAAGATTCGACGGCTGC
CAGAGTAGCATTGGGAATCACTTCAGTGTTGACCATAACCACTATCTTAA
ACATGCTCAATACTGCTATGCCAAAGATGGTTACAGTGTGTATGACATAC
GTTTCCAATGGGAAGAGGATAAACAGAAACGACTTTCTATCGGCACTAAA
GTTCGTACACTACCACAATACAATCTCACACAATTTGACACAGCTAACAG
TACAGAAGCTTATGTCGTAGGATATCGGTACGCGCATCATGTCCAATGGA
TTTGCGCATGTTCCCTATGGATTCACAAGAATGTAATCTCAATATTGAAA
GCTGATTATCAAATCGACTTCTTCTTTCGTCAAAGTTGGACCGATGAACG
TTTAAAACATTCCTATCCACAGACTCTAACTCTTTCTAATTCTATGCTGG
ACAAATTATGGGTACCAGATACCTATTTTGAAAACTCAAAAAATTCACAA
TTTCATTCAGTCACTGTACCAAATAAAATGTTGAAAATCAAACCGGACGG
CACTGTTTTATATAACGCAAGTTCAAGAGCCAGTGATGGTTACTGTTGGG
TTTTGGATTTTGTCAATCGATTCAATAAATGTTATAGATATGCAATATTT
CCGCACTATTACAAAAACTATTGAAAGGATATGATAAAAGATTGCGACCT
TTAATGGATTATGTGGAGAACAACTAAACAGTTTATCAACAATTATGTCT
ACAAATTAAAATTGAACAAAATTGAACGTTCGAACGTTTTATTACTATAC
ACAATAGCTATTATACTAATCAACACAAACACCATATTAGGAATACAAGA
TAATCACGTGATGTCAATAAACAATAACTCGTCAGCGACCGATCATATGA
GAGAATTATCAAAGGACAATGGAACAATAACACCGTTGGCCAATCACAAT
GTGACACACAGTTTGAAATGGCACGTCAATCATGAGAGAATGTTATGGCA
AAATAAATGCACGGAATATGATTGGTCCATCGAGAAAGGATGAATCATTA
CGATTGTTCTGACGGTGAATTTCAAACGAAACCGTTAATCGTTGTCTTAG
AAGAGAAAAACCTACGAAATCATCGACAAAACCATCATCACCATACGCGC
GCGCATAACGACGACGATCATTCGGCGGCGCTACAATCGCACACTGGTAA
ATTTCTATGTGAGTTCCGTGTAGATGTTATAGACGAATATTCGAGAATGA
TTTTCCCACTTGCGTTTATCATTTTTAACATTGTATATTGGTTACTGTTT
TACAGTAAAAAGAATGAAAAATGATTCGTTGGAGCAAATGGTCACGTGAT
CGACCGTAATAACCATCACGAATTACGTTCAAGGGCGTACCAAAACAACA
ACTACAAGGAAGTTTCATACATCAAAGCGGTCGATTGGTATTTGATCGTC
AGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTGGTTTTATA
CCTCACTGATAAAGAAAAACAAACACAGGAAGAAAATAAAAACAAATTCA
AAAAGAAAAGACCACCAAACATGGACAAACAGGTAATTATTCAAGGTTGA
CAGCTATTTTCGTATTACAGAGACGCACCGGTTACTTCTTTCTTCACTTG
TACGCGCCATGTGCTCTTATTGTTATGATTTCATGGATTAGTTTTTGTAT
ACCAAAAGATTCGACGGCTGCCAGAGTAGCATTGGGAATCACTTCAGTGT
TGACCATAACCACTATCTTAAACATGCTCAATACTGCTATGCCAAAGATG
GTTACAGTGTGTATGACATACGTTTCCAATGGGAAGAGGATAAACAGAAA
CGACTTTCTATCGGCACTAAAGTTCGTACACTACCACAATACAATCTCAC
ACAATTTGACACAGCTAACAGTACAGAAGCTTATGTCGTAGGATATCGGT
ACGCGCATCATGTCCAATGGATTTGCGCATGTTCCCTATGGATTCACAAG
AATGTAATCTCAATATTGAAAGCTGATTATCAAATCGACTTCTTCTTTCG
TCAAAGTTGGACCGATGAACGTTTAAAACATTCCTATCCACAGACTCTAA
CTCTTTCTAATTCTATGCTGGACAAATTATGGGTACCAGATACCTATTTT
GAAAACTCAAAAAATTCACAATTTCATTCAGTCACTGTACCAAATAAAAT
GTTGAAAATCAAACCGGACGGCACTGTTTTATATAACGCAAGTTCAAGAG
CCAGTGATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCAATAAA
TGTTATAGATATGCAATATTTCCGCACTATTACAAAAACTATTGAAAGGA
TATGATAAAAGATTGCGACCTTTAATGGATTATGTGGAGAACAACTAAAC
AGTTTATCAACAATTATGTCTACAAATTAAAATTGAACAAAATTGAACGT
TCGAACGTTTTATTACTATACACAATAGCTATTATACTAATCAACACAAA
CACCATATTAGGAATACAAGATAATCACGTGATGTCAATAAACAATAACT
CGTCAGCGACCGATCATATGAGAGAATTATCAAAGGACAATGGAACAATA
ACACCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGGCACGTCAA
TCATGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGATTGGTCCA
TCGAGAAAGGATGAATCATTACGATTGTTCTGACGGTGAATTTCAAACGA
AACCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACGAAATCATCGACAA
AACCATCATCACCATACGCGCGCGCATAACGACGACGATCATTCGGCGGC
GCTACAATCGCACACTGGTAAATTTCTATGTGAGTTCCGTGTAGATGTTA
TAGACGAATATTCGAGAATGATTTTCCCACTTGCGTTTATCATTTTTAAC
ATTGTATATTGGTTACTGTTTTACAGTAAAAAGAATGAAAAATGATTCGT
TGGAGCAAATGGTCACGTGATCGACCGTAATAACCATCACGAATTACGTT
CAAGGGCGTACCAAAACAACAACTACAAGGAAGTTTCATACATCAAAGCG
GTCGATTGGTATTTGATCGTCAGCTTCTTATTCGTGTTCGCAGTACTGAT
AGAGTACACGTTGGTTTTATACCTCACTGATAAAGAAAAACAAACACAGG
AAGAAAATAAAAACAAATTCAAAAAGAAAAGACCACCAAACATGGACAAA
CAGGTAATTATTCAAGGTTGACAGCTATTTTCGTATTACAGAGACGCACC
GGTTACTTCTTTCTTCACTTGTACGCGCCATGTGCTCTTATTGTTATGAT
TTCATGGATTAGTTTTTGTATACCAAAAGATTCGACGGCTGCCAGAGTAG
CATTGGGAATCACTTCAGTGTTGACCATAACCACTATCTTAAACATGCTC
AATACTGCTATGCCAAAGATGGTTACAGTGTGTATGACATACGTTTCCAA
TGGGAAGAGGATAAACAGAAACGACTTTCTATCGGCACTAAAGTTCGTAC
ACTACCACAATACAATCTCACACAATTTGACACAGCTAACAGTACAGAAG
CTTATGTCGTAGGATATCGGTACGCGCATCATGTCCAATGGATTTGCGCA
TGTTCCCTATGGATTCACAAGAATGTAATCTCAATATTGAAAGCTGATTA
TCAAATCGACTTCTTCTTTCGTCAAAGTTGGACCGATGAACGTTTAAAAC
ATTCCTATCCACAGACTCTAACTCTTTCTAATTCTATGCTGGACAAATTA
TGGGTACCAGATACCTATTTTGAAAACTCAAAAAATTCACAATTTCATTC
AGTCACTGTACCAAATAAAATGTTGAAAATCAAACCGGACGGCACTGTTT
TATATAACGCAAGTTCAAGAGCCAGTGATGGTTACTGTTGGGTTTTGGAT
TTTGTCAATCGATTCAATAAATGTTATAGATATGCAATATTTCCGCACTA
TTACAAAAACTATTGAAAGGATATGATAAAAGATTGCGACCTTTAATGGA
TTATGTGGAGAACAACTAAACAGTTTATCAACAATTATGTCTACAAATTA
AAATTGAACAAAATTGAACGTTCGAACGTTTTATTACTATACACAATAGC
TATTATACTAATCAACACAAACACCATATTAGGAATACAAGATAATCACG
TGATGTCAATAAACAATAACTCGTCAGCGACCGATCATATGAGAGAATTA
TCAAAGGACAATGGAACAATAACACCGTTGGCCAATCACAATGTGACACA
CAGTTTGAAATGGCACGTCAATCATGAGAGAATGTTATGGCAAAATAAAT
GCACGGAATATGATTGGTCCATCGAGAAAGGATGAATCATTACGATTGTT
CTGACGGTGAATTTCAAACGAAACCGTTAATCGTTGTCTTAGAAGAGAAA
AACCTACGAAATCATCGACAAAACCATCATCACCATACGCGCGCGCATAA
CGACGACGATCATTCGGCGGCGCTACAATCGCACACTGGTAAATTTCTAT
GTGAGTTCCGTGTAGATGTTATAGACGAATATTCGAGAATGATTTTCCCA
CTTGCGTTTATCATTTTTAACATTGTATATTGGTTACTGTTTTACAGTAA
AAAGAATGAAAAATGATTCGTTGGAGCAAATGGTCACGTGATCGACCGTA
ATAACCATCACGAATTACGTTCAAGGGCGTACCAAAACAACAACTACAAG
GAAGTTTCATACATCAAAGCGGTCGATTGGTATTTGATCGTCAGCTTCTT
ATTCGTGTTCGCAGTACTGATAGAGTACACGTTGGTTTTATACCTCACTG
ATAAAGAAAAACAAACACAGGAAGAAAATAAAAACAAATTCAAAAAGAAA
AGACCACCAAACATGGACAAACAGGTAATTATTCAAGGTTGACAGCTATT
TTCGTATTACAGAGACGCACCGGTTACTTCTTTCTTCACTTGTACGCGCC
ATGTGCTCTTATTGTTATGATTTCATGGATTAGTTTTTGTATACCAAAAG
ATTCGACGGCTGCCAGAGTAGCATTGGGAATCACTTCAGTGTTGACCATA
ACCACTATCTTAAACATGCTCAATACTGCTATGCCAAAGATGGTTACAGT
GTGTATGACATACGTTTCCAATGGGAAGAGGATAAACAGAAACGACTTTC
TATCGGCACTAAAGTTCGTACACTACCACAATACAATCTCACACAATTTG
ACACAGCTAACAGTACAGAAGCTTATGTCGTAGGATATCGGTACGCGCAT
CATGTCCAATGGATTTGCGCATGTTCCCTATGGATTCACAAGAATGTAAT
CTCAATATTGAAAGCTGATTATCAAATCGACTTCTTCTTTCGTCAAAGTT
GGACCGATGAACGTTTAAAACATTCCTATCCACAGACTCTAACTCTTTCT
AATTCTATGCTGGACAAATTATGGGTACCAGATACCTATTTTGAAAACTC
AAAAAATTCACAATTTCATTCAGTCACTGTACCAAATAAAATGTTGAAAA
TCAAACCGGACGGCACTGTTTTATATAACGCAAGTTCAAGAGCCAGTGAT
GGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCAATAAATGTTATAG
ATATGCAATATTTCCGCACTATTACAAAAACTATTGAAAGGATATGATAA
AAGATTGCGACCTTTAATGGATTATGTGGAGAACAACTAAACAGTTTATC
AACAATTATGTCTACAAATTAAAATTGAACAAAATTGAACGTTCGAACGT
TTTATTACTATACACAATAGCTATTATACTAATCAACACAAACACCATAT
TAGGAATACAAGATAATCACGTGATGTCAATAAACAATAACTCGTCAGCG
ACCGATCATATGAGAGAATTATCAAAGGACAATGGAACAATAACACCGTT
GGCCAATCACAATGTGACACACAGTTTGAAATGGCACGTCAATCATGAGA
GAATGTTATGGCAAAATAAATGCACGGAATATGATTGGTCCATCGAGAAA
GGATGAATCATTACGATTGTTCTGACGGTGAATTTCAAACGAAACCGTTA
ATCGTTGTCTTAGAAGAGAAAAACCTACGAAATCATCGACAAAACCATCA
TCACCATACGCGCGCGCATAACGACGACGATCATTCGGCGGCGCTACAAT
CGCACACTGGTAAATTTCTATGTGAGTTCCGTGTAGATGTTATAGACGAA
TATTCGAGAATGATTTTCCCACTTGCGTTTATCATTTTTAACATTGTATA
TTGGTTACTGTTTTACAGTAAAAAGAATGAAAAATGATTCGTTGGAGCAA
ATGGTCACGTGATCGACCGTAATAACCATCACGAATTACGTTCAAGGGCG
TACCAAAACAACAACTACAAGGAAGTTTCATACATCAAAGCGGTCGATTG
GTATTTGATCGTCAGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACA
CGTTGGTTTTATACCTCACTGATAAAGAAAAACAAACACAGGAAGAAAAT
AAAAACAAATTCAAAAAGAAAAGACCACCAAACATGGACAAACAGGTAAT
TATTCAAGGTTGACAGCTATTTTCGTATTACAGAGACGCACCGGTTACTT
CTTTCTTCACTTGTACGCGCCATGTGCTCTTATTGTTATGATTTCATGGA
TTAGTTTTTGTATACCAAAAGATTCGACGGCTGCCAGAGTAGCATTGGGA
ATCACTTCAGTGTTGACCATAACCACTATCTTAAACATGCTCAATACTGC
TATGCCAAAGATGGTTACAGTGTGTATGACATACGTTTCCAATGGGAAGA
GGATAAACAGAAACGACTTTCTATCGGCACTAAAGTTCGTACACTACCAC
AATACAATCTCACACAATTTGACACAGCTAACAGTACAGAAGCTTATGTC
GTAGGATATCGGTACGCGCATCATGTCCAATGGATTTGCGCATGTTCCCT
ATGGATTCACAAGAATGTAATCTCAATATTGAAAGCTGATTATCAAATCG
ACTTCTTCTTTCGTCAAAGTTGGACCGATGAACGTTTAAAACATTCCTAT
CCACAGACTCTAACTCTTTCTAATTCTATGCTGGACAAATTATGGGTACC
AGATACCTATTTTGAAAACTCAAAAAATTCACAATTTCATTCAGTCACTG
TACCAAATAAAATGTTGAAAATCAAACCGGACGGCACTGTTTTATATAAC
GCAAGTTCAAGAGCCAGTGATGGTTACTGTTGGGTTTTGGATTTTGTCAA
TCGATTCAATAAATGTTATAGATATGCAATATTTCCGCACTATTACAAAA
ACTATTGAAAGGATATGATAAAAGATTGCGACCTTTAATGGATTATGTGG
AGAACAACTAAACAGTTTATCAACAATTATGTCTACAAATTAAAATTGAA
CAAAATTGAACGTTCGAACGTTTTATTACTATACACAATAGCTATTATAC
TAATCAACACAAACACCATATTAGGAATACAAGATAATCACGTGATGTCA
ATAAACAATAACTCGTCAGCGACCGATCATATGAGAGAATTATCAAAGGA
CAATGGAACAATAACACCGTTGGCCAATCACAATGTGACACACAGTTTGA
AATGGCACGTCAATCATGAGAGAATGTTATGGCAAAATAAATGCACGGAA
TATGATTGGTCCATCGAGAAAGGATGAATCATTACGATTGTTCTGACGGT
GAATTTCAAACGAAACCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACG
AAATCATCGACAAAACCATCATCACCATACGCGCGCGCATAACGACGACG
ATCATTCGGCGGCGCTACAATCGCACACTGGTAAATTTCTATGTGAGTTC
CGTGTAGATGTTATAGACGAATATTCGAGAATGATTTTCCCACTTGCGTT
TATCATTTTTAACATTGTATATTGGTTACTGTTTTACAGTAAAAAGAATG
AAAAATGATTCGTTGGAGCAAATGGTCACGTGATCGACCGTAATAACCAT
CACGAATTACGTTCAAGGGCGTACCAAAACAACAACTACAAGGAAGTTTC
ATACATCAAAGCGGTCGATTGGTATTTGATCGTCAGCTTCTTATTCGTGT
TCGCAGTACTGATAGAGTACACGTTGGTTTTATACCTCACTGATAAAGAA
AAACAAACACAGGAAGAAAATAAAAACAAATTCAAAAAGAAAAGACCACC
AAACATGGACAAACAGGTAATTATTCAAGGTTGACAGCTATTTTCGTATT
ACAGAGACGCACCGGTTACTTCTTTCTTCACTTGTACGCGCCATGTGCTC
TTATTGTTATGATTTCATGGATTAGTTTTTGTATACCAAAAGATTCGACG
GCTGCCAGAGTAGCATTGGGAATCACTTCAGTGTTGACCATAACCACTAT
CTTAAACATGCTCAATACTGCTATGCCAAAGATGGTTACAGTGTGTATGA
CATACGTTTCCAATGGGAAGAGGATAAACAGAAACGACTTTCTATCGGCA
CTAAAGTTCGTACACTACCACAATACAATCTCACACAATTTGACACAGCT
AACAGTACAGAAGCTTATGTCGTAGGATATCGGTACGCGCATCATGTCCA
ATGGATTTGCGCATGTTCCCTATGGATTCACAAGAATGTAATCTCAATAT
TGAAAGCTGATTATCAAATCGACTTCTTCTTTCGTCAAAGTTGGACCGAT
GAACGTTTAAAACATTCCTATCCACAGACTCTAACTCTTTCTAATTCTAT
GCTGGACAAATTATGGGTACCAGATACCTATTTTGAAAACTCAAAAAATT
CACAATTTCATTCAGTCACTGTACCAAATAAAATGTTGAAAATCAAACCG
GACGGCACTGTTTTATATAACGCAAGTTCAAGAGCCAGTGATGGTTACTG
TTGGGTTTTGGATTTTGTCAATCGATTCAATAAATGTTATAGATATGCAA
TATTTCCGCACTATTACAAAAACTATTGAAAGGATATGATAAAAGATTGC
GACCTTTAATGGATTATGTGGAGAACAACTAAACAGTTTATCAACAATTA
TGTCTACAAATTAAAATTGAACAAAATTGAACGTTCGAACGTTTTATTAC
TATACACAATAGCTATTATACTAATCAACACAAACACCATATTAGGAATA
CAAGATAATCACGTGATGTCAATAAACAATAACTCGTCAGCGACCGATCA
TATGAGAGAATTATCAAAGGACAATGGAACAATAACACCGTTGGCCAATC
ACAATGTGACACACAGTTTGAAATGGCACGTCAATCATGAGAGAATGTTA
TGGCAAAATAAATGCACGGAATATGATTGGTCCATCGAGAAAGGATGAAT
CATTACGATTGTTCTGACGGTGAATTTCAAACGAAACCGTTAATCGTTGT
CTTAGAAGAGAAAAACCTACGAAATCATCGACAAAACCATCATCACCATA
CGCGCGCGCATAACGACGACGATCATTCGGCGGCGCTACAATCGCACACT
GGTAAATTTCTATGTGAGTTCCGTGTAGATGTTATAGACGAATATTCGAG
AATGATTTTCCCACTTGCGTTTATCATTTTTAACATTGTATATTGGTTAC
TGTTTTACAGTAAAAAGAATGAAAAATGATTCGTTGGAGCAAATGGTCAC
GTGATCGACCGTAATAACCATCACGAATTACGTTCAAGGGCGTACCAAAA
CAACAACTACAAGGAAGTTTCATACATCAAAGCGGTCGATTGGTATTTGA
TCGTCAGCTTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTGGTT
TTATACCTCACTGATAAAGAAAAACAAACACAGGAAGAAAATAAAAACAA
ATTCAAAAAGAAAAGACCACCAAACATGGACAAACAGGTAATTATTCAAG
GTTGACAGCTATTTTCGTATTACAGAGACGCACCGGTTACTTCTTTCTTC
ACTTGTACGCGCCATGTGCTCTTATTGTTATGATTTCATGGATTAGTTTT
TGTATACCAAAAGATTCGACGGCTGCCAGAGTAGCATTGGGAATCACTTC
AGTGTTGACCATAACCACTATCTTAAACATGCTCAATACTGCTATGCCAA
AGATGGTTACAGTGTGTATGACATACGTTTCCAATGGGAAGAGGATAAAC
AGAAACGACTTTCTATCGGCACTAAAGTTCGTACACTACCACAATACAAT
CTCACACAATTTGACACAGCTAACAGTACAGAAGCTTATGTCGTAGGATA
TCGGTACGCGCATCATGTCCAATGGATTTGCGCATGTTCCCTATGGATTC
ACAAGAATGTAATCTCAATATTGAAAGCTGATTATCAAATCGACTTCTTC
TTTCGTCAAAGTTGGACCGATGAACGTTTAAAACATTCCTATCCACAGAC
TCTAACTCTTTCTAATTCTATGCTGGACAAATTATGGGTACCAGATACCT
ATTTTGAAAACTCAAAAAATTCACAATTTCATTCAGTCACTGTACCAAAT
AAAATGTTGAAAATCAAACCGGACGGCACTGTTTTATATAACGCAAGTTC
AAGAGCCAGTGATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCA
ATAAATGTTATAGATATGCAATATTTCCGCACTATTACAAAAACTATTGA
AAGGATATGATAAAAGATTGCGACCTTTAATGGATTATGTGGAGAACAAC
TAAACAGTTTATCAACAATTATGTCTACAAATTAAAATTGAACAAAATTG
AACGTTCGAACGTTTTATTACTATACACAATAGCTATTATACTAATCAAC
ACAAACACCATATTAGGAATACAAGATAATCACGTGATGTCAATAAACAA
TAACTCGTCAGCGACCGATCATATGAGAGAATTATCAAAGGACAATGGAA
CAATAACACCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGGCAC
GTCAATCATGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGATTG
GTCCATCGAGAAAGGATGAATCATTACGATTGTTCTGACGGTGAATTTCA
AACGAAACCGTTAATCGTTGTCTTAGAAGAGAAAAACCTACGAAATCATC
GACAAAACCATCATCACCATACGCGCGCGCATAACGACGACGATCATTCG
GCGGCGCTACAATCGCACACTGGTAAATTTCTATGTGAGTTCCGTGTAGA
TGTTATAGACGAATATTCGAGAATGATTTTCCCACTTGCGTTTATCATTT
TTAACATTGTATATTGGTTACTGTTTTACAGTAAAAAGAATGAAAAATGA
TTCGTTGGAGCAAATGGTCACGTGATCGACCGTAATAACCATCACGAATT
ACGTTCAAGGGCGTACCAAAACAACAACTACAAGGAAGTTTCATACATCA
AAGCGGTCGATTGGTATTTGATCGTCAGCTTCTTATTCGTGTTCGCAGTA
CTGATAGAGTACACGTTGGTTTTATACCTCACTGATAAAGAAAAACAAAC
ACAGGAAGAAAATAAAAACAAATTCAAAAAGAAAAGACCACCAAACATGG
ACAAACAGGTAATTATTCAAGGTTGACAGCTATTTTCGTATTACAGAGAC
GCACCGGTTACTTCTTTCTTCACTTGTACGCGCCATGTGCTCTTATTGTT
ATGATTTCATGGATTAGTTTTTGTATACCAAAAGATTCGACGGCTGCCAG
AGTAGCATTGGGAATCACTTCAGTGTTGACCATAACCACTATCTTAAACA
TGCTCAATACTGCTATGCCAAAGATGGTTACAGTGTGTATGACATACGTT
TCCAATGGGAAGAGGATAAACAGAAACGACTTTCTATCGGCACTAAAGTT
CGTACACTACCACAATACAATCTCACACAATTTGACACAGCTAACAGTAC
AGAAGCTTATGTCGTAGGATATCGGTACGCGCATCATGTCCAATGGATTT
GCGCATGTTCCCTATGGATTCACAAGAATGTAATCTCAATATTGAAAGCT
GATTATCAAATCGACTTCTTCTTTCGTCAAAGTTGGACCGATGAACGTTT
AAAACATTCCTATCCACAGACTCTAACTCTTTCTAATTCTATGCTGGACA
AATTATGGGTACCAGATACCTATTTTGAAAACTCAAAAAATTCACAATTT
CATTCAGTCACTGTACCAAATAAAATGTTGAAAATCAAACCGGACGGCAC
TGTTTTATATAACGCAAGTTCAAGAGCCAGTGATGGTTACTGTTGGGTTT
TGGATTTTGTCAATCGATTCAATAAATGTTATAGATATGCAATATTTCCG
CACTATTACAAAAACTATTGAAAGGATATGATAAAAGATTGCGACCTTTA
ATGGATTATGTGGAGAACAACTAAACAGTTTATCAACAATTATGTCTACA
AATTAAAATTGAACAAAATTGAACGTTCGAACGTTTTATTACTATACACA
ATAGCTATTATACTAATCAACACAAACACCATATTAGGAATACAAGATAA
TCACGTGATGTCAATAAACAATAACTCGTCAGCGACCGATCATATGAGAG
AATTATCAAAGGACAATGGAACAATAACACCGTTGGCCAATCACAATGTG
ACACACAGTTTGAAATGGCACGTCAATCATGAGAGAATGTTATGGCAAAA
TAAATGCACGGAATATGATTGGTCCATCGAGAAAGGATGAATCATTACGA
TTGTTCTGACGGTGAATTTCAAACGAAACCGTTAATCGTTGTCTTAGAAG
AGAAAAACCTACGAAATCATCGACAAAACCATCATCACCATACGCGCGCG
CATAACGACGACGATCATTCGGCGGCGCTACAATCGCACACTGGTAAATT
TCTATGTGAGTTCCGTGTAGATGTTATAGACGAATATTCGAGAATGATTT
TCCCACTTGCGTTTATCATTTTTAACATTGTATATTGGTTACTGTTTTAC
AGTAAAAAGAATGAAAAATGATTCGTTGGAGCAAATGGTCACGTGATCGA
CCGTAATAACCATCACGAATTACGTTCAAGGGCGTACCAAAACAACAACT
ACAAGGAAGTTTCATACATCAAAGCGGTCGATTGGTATTTGATCGTCAGC
TTCTTATTCGTGTTCGCAGTACTGATAGAGTACACGTTGGTTTTATACCT
CACTGATAAAGAAAAACAAACACAGGAAGAAAATAAAAACAAATTCAAAA
AGAAAAGACCACCAAACATGGACAAACAGGTAATTATTCAAGGTTGACAG
CTATTTTCGTATTACAGAGACGCACCGGTTACTTCTTTCTTCACTTGTAC
GCGCCATGTGCTCTTATTGTTATGATTTCATGGATTAGTTTTTGTATACC
AAAAGATTCGACGGCTGCCAGAGTAGCATTGGGAATCACTTCAGTGTTGA
CCATAACCACTATCTTAAACATGCTCAATACTGCTATGCCAAAGATGGTT
ACAGTGTGTATGACATACGTTTCCAATGGGAAGAGGATAAACAGAAACGA
CTTTCTATCGGCACTAAAGTTCGTACACTACCACAATACAATCTCACACA
ATTTGACACAGCTAACAGTACAGAAGCTTATGTCGTAGGATATCGGTACG
CGCATCATGTCCAATGGATTTGCGCATGTTCCCTATGGATTCACAAGAAT
GTAATCTCAATATTGAAAGCTGATTATCAAATCGACTTCTTCTTTCGTCA
AAGTTGGACCGATGAACGTTTAAAACATTCCTATCCACAGACTCTAACTC
TTTCTAATTCTATGCTGGACAAATTATGGGTACCAGATACCTATTTTGAA
AACTCAAAAAATTCACAATTTCATTCAGTCACTGTACCAAATAAAATGTT
GAAAATCAAACCGGACGGCACTGTTTTATATAACGCAAGTTCAAGAGCCA
GTGATGGTTACTGTTGGGTTTTGGATTTTGTCAATCGATTCAATAAATGT
TATAGATATGCAATATTTCCGCACTATTACAAAAACTATTGAAAGGATAT
GATAAAAGATTGCGACCTTTAATGGATTATGTGGAGAACAACTAAACAGT
TTATCAACAATTATGTCTACAAATTAAAATTGAACAAAATTGAACGTTCG
AACGTTTTATTACTATACACAATAGCTATTATACTAATCAACACAAACAC
CATATTAGGAATACAAGATAATCACGTGATGTCAATAAACAATAACTCGT
CAGCGACCGATCATATGAGAGAATTATCAAAGGACAATGGAACAATAACA
CCGTTGGCCAATCACAATGTGACACACAGTTTGAAATGGCACGTCAATCA
TGAGAGAATGTTATGGCAAAATAAATGCACGGAATATGATTGGTCCATCG
AGAAAGGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000357XLOC_000357Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000609-exon-sc0000002-1575043694:1508826..1509344TCONS_00000609-exon-sc0000002-1575043694:1508826..1509344Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1507154..1507221TCONS_00000609-exon-sc0000002-1575043694:1507154..1507221Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1506379..1506449TCONS_00000609-exon-sc0000002-1575043694:1506379..1506449Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1504760..1504977TCONS_00000609-exon-sc0000002-1575043694:1504760..1504977Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1504250..1504332TCONS_00000609-exon-sc0000002-1575043694:1504250..1504332Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1503771..1503914TCONS_00000609-exon-sc0000002-1575043694:1503771..1503914Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1502280..1502494TCONS_00000609-exon-sc0000002-1575043694:1502280..1502494Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1500460..1500630TCONS_00000609-exon-sc0000002-1575043694:1500460..1500630Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1499806..1499892TCONS_00000609-exon-sc0000002-1575043694:1499806..1499892Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1575043694:1497124..1498633TCONS_00000609-exon-sc0000002-1575043694:1497124..1498633Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1508826..1509344TCONS_00000609-exon-sc0000002-1510915933:1508826..1509344Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1507154..1507221TCONS_00000609-exon-sc0000002-1510915933:1507154..1507221Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1506379..1506449TCONS_00000609-exon-sc0000002-1510915933:1506379..1506449Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1504760..1504977TCONS_00000609-exon-sc0000002-1510915933:1504760..1504977Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1504250..1504332TCONS_00000609-exon-sc0000002-1510915933:1504250..1504332Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1503771..1503914TCONS_00000609-exon-sc0000002-1510915933:1503771..1503914Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1502280..1502494TCONS_00000609-exon-sc0000002-1510915933:1502280..1502494Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1500460..1500630TCONS_00000609-exon-sc0000002-1510915933:1500460..1500630Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1499806..1499892TCONS_00000609-exon-sc0000002-1510915933:1499806..1499892Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1510915933:1497124..1498633TCONS_00000609-exon-sc0000002-1510915933:1497124..1498633Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1508826..1509344TCONS_00000609-exon-sc0000002-1491911889:1508826..1509344Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1507154..1507221TCONS_00000609-exon-sc0000002-1491911889:1507154..1507221Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1506379..1506449TCONS_00000609-exon-sc0000002-1491911889:1506379..1506449Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1504760..1504977TCONS_00000609-exon-sc0000002-1491911889:1504760..1504977Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1504250..1504332TCONS_00000609-exon-sc0000002-1491911889:1504250..1504332Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1503771..1503914TCONS_00000609-exon-sc0000002-1491911889:1503771..1503914Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1502280..1502494TCONS_00000609-exon-sc0000002-1491911889:1502280..1502494Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1500460..1500630TCONS_00000609-exon-sc0000002-1491911889:1500460..1500630Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1499806..1499892TCONS_00000609-exon-sc0000002-1491911889:1499806..1499892Clytia hemisphaericaexon
TCONS_00000609-exon-sc0000002-1491911889:1497124..1498633TCONS_00000609-exon-sc0000002-1491911889:1497124..1498633Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000609-proteinTCONS_00000609-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1497124..1509344 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0306635 0.0401411 0.03691 0.0156834 6.44302 4.80261 26.6751 27.6834 19.5111 20.6748 15.8264 13.8351 6.16678 5.32195 1.43205 1.19585 1.59125 1.74784 6.19262 7.4759 2.46375 2.45232 1.37364 2.07666 1.4879 2.44248 6.95422 6.90362 0.0562774 0.0928801
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006028GABAA/Glycine_rcpt
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006811ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005230 extracellular ligand-gated ion channel activity
molecular_function GO:0005216 ion channel activity
Blast
BLAST of TCONS_00000609 vs. Swiss-Prot (Human)
Match: GBRB3 (Gamma-aminobutyric acid receptor subunit beta-3 OS=Homo sapiens GN=GABRB3 PE=1 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.391e-78
Identity = 168/454 (37.00%), Postives = 240/454 (52.86%), Query Frame = 2
Query:  524 ISALLQKLLKGYDKRLRPLMDFQ-EPVMVTVGFWILSIDSINVIDMDYQIDFFFRQSWTDERLKHS-YPQTLTLSNSMLDKLWVPDTYFENSKNSQFHSVTVPNKMLKIKPDGTVLYNARISVRASCPMDLRMFPMDSQECNLNIESYGYSVYDIRFQWEEDKQKRLSIGTKVRTLPQYNLTQFDTANSTEAYVVGNYSRLTAIFVLQRRTGYFFLHLYAPCALIVMISWISFCIPKDSTAARVALGITSVXXXXXXXXXXXXAMPKVSYIKAVDWYLIVSFLFVFAVLIEYTLVLYLTDXXXXXXXXXXXXXXXXRPPNMDKQFVGANGHVI-DRNNHHELRSRAYQNN-----NYKENHYDCSDGEFQTKPLIVVLEEKNLXXXXXXXXXXXXXXXXXXXSAA-LQSHTGKFLCEFRVDVID--------EYSRMIFPLAFIIFNIVYWLLF 1834
            +   + KLLKGYD RLRP  DF   PV V +   I SID ++ ++MDY +  +F+Q W D+RL +S  P  LTL N + D+LWVPDTYF N K S  H VTV N+M+++ PDGTVLY  RI+  A+C MDLR +P+D Q C L IESYGY+  DI F W    +     G +   LPQ+++ +    +    +  G Y RL+  F L+R  GYF L  Y P  LI ++SW+SF I  D++AARVALGIT+VLT+TTI   L   +PK+ Y+KA+D YL+  F+FVF  L+EY  V Y+                  R P   K+          DR+     R  A+ N             + S G   T+   +  +   ++  +Q+           D S    ++H  +   + ++ + D         +SR++FP  F +FN+VYWL +
Sbjct:   37 VKETVDKLLKGYDIRLRP--DFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKA--VTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI---------------FFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471          
The following BLAST results are available for this feature:
BLAST of TCONS_00000609 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GBRB31.391e-7837.00Gamma-aminobutyric acid receptor subunit beta-3 OS... [more]
back to top