Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000609-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000609-protein
Unique NameTCONS_00000609-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length556

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000609-protein ID=TCONS_00000609-protein|Name=TCONS_00000609-protein|organism=Clytia hemisphaerica|type=polypeptide|length=556bp
MWRTTKQFINNYVYKLKLNKIERSNVLLLYTIAIILINTNTILGIQDNHV
MSINNNSSATDHMRELSKDNGTITPLANHNVTHSLKWHVNHERMLWQNKC
TEYDWSIEKGCNISALLQKLLKGYDKRLRPLMDFQEPVMVTVGFWILSID
SINVIDMDYQIDFFFRQSWTDERLKHSYPQTLTLSNSMLDKLWVPDTYFE
NSKNSQFHSVTVPNKMLKIKPDGTVLYNARISVRASCPMDLRMFPMDSQE
CNLNIESYGYSVYDIRFQWEEDKQKRLSIGTKVRTLPQYNLTQFDTANST
EAYVVGNYSRLTAIFVLQRRTGYFFLHLYAPCALIVMISWISFCIPKDST
AARVALGITSVLTITTILNMLNTAMPKVSYIKAVDWYLIVSFLFVFAVLI
EYTLVLYLTDKEKQTQEENKNKFKKKRPPNMDKQFVGANGHVIDRNNHHE
LRSRAYQNNNYKENHYDCSDGEFQTKPLIVVLEEKNLRNHRQNHHHHTRA
HNDDDHSAALQSHTGKFLCEFRVDVIDEYSRMIFPLAFIIFNIVYWLLFY
SKKNEK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000357XLOC_000357Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000609TCONS_00000609Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR006028GABAA/Glycine_rcpt
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006811ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005230 extracellular ligand-gated ion channel activity
molecular_function GO:0005216 ion channel activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 350..371
score: 49.72
coord: 529..549
score: 51.16
coord: 324..344
score: 43.78
coord: 384..405
score: 44.25
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 315..327
score: 31.05
coord: 160..176
score: 37.8
coord: 237..251
score: 52.97
coord: 191..202
score: 46.91
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 114..548
e-value: 3.9E-119
score: 396.3
NoneNo IPR availableGENE3D1.20.58.390coord: 327..556
e-value: 2.0E-51
score: 173.6
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainGENE3D2.70.170.10coord: 99..326
e-value: 3.4E-63
score: 212.6
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 115..321
e-value: 3.0E-49
score: 167.3
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainSUPERFAMILY63712Nicotinic receptor ligand binding domain-likecoord: 114..320
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 328..546
e-value: 3.2E-35
score: 122.2
IPR006029Neurotransmitter-gated ion-channel transmembrane domainSUPERFAMILY90112Neurotransmitter-gated ion-channel transmembrane porecoord: 321..550
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 237..251

Blast
BLAST of TCONS_00000609-protein vs. Swiss-Prot (Human)
Match: GBRB1 (Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens GN=GABRB1 PE=1 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 6.503e-96
Identity = 173/451 (38.36%), Postives = 246/451 (54.55%), Query Frame = 0
Query:  117 LQKLLKGYDKRLRPLMDFQ-EPVMVTVGFWILSIDSINVIDMDYQIDFFFRQSWTDERLKHS-YPQTLTLSNSMLDKLWVPDTYFENSKNSQFHSVTVPNKMLKIKPDGTVLYNARISVRASCPMDLRMFPMDSQECNLNIESYGYSVYDIRFQWEEDKQKRLSIGTKVRTLPQYNLTQFDTANSTEAYVVGNYSRLTAIFVLQRRTGYFFLHLYAPCALIVMISWISFCIPKDSTAARVALGITSVLTITTILNMLNTAMPKVSYIKAVDWYLIVSFLFVFAVLIEYTLVLYL---TDKEKQTQEENKNKFKKKRPPNMDKQFVGANGHV----IDRNNHHELRSRAYQNNNYKENHYDCSDGEFQ-TKPLIVVLEEKNLRNHRQNHHHHTRAHNDDDHSAALQSHTGKFLCEFRVDV--------IDEYSRMIFPLAFIIFNIVYWLLF 549
            + +LLKGYD RLRP  DF   PV V +   + SID ++ ++MDY +  +F+QSW D+RL +S  P  LTL N + D+LWVPDTYF N K S  H VTV N+M+++ PDGTVLY  RI+  A+C MDLR +P+D Q C L IESYGY+  DI F W   +      G     LPQ+++  +   +    +  G Y RL+  F L+R  GYF L  Y P  LI ++SW+SF I  D++AARVALGIT+VLT+TTI   L   +PK+ Y+KA+D YL+  F+FVF  L+EY  V Y+      +K+   +      +K    M+K  V A+G++    ++  N           ++ K   Y       Q  KPL              +   + RA   D H    +    +   + +V +        ID++SRM FP+ F +FN+VYWL +
Sbjct:   41 VDRLLKGYDIRLRP--DFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGA--VTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPL-------------SSREAYGRAL--DRHGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYY 472          
The following BLAST results are available for this feature:
BLAST of TCONS_00000609-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GBRB16.503e-9638.36Gamma-aminobutyric acid receptor subunit beta-1 OS... [more]
back to top