Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000514 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000514
Unique NameTCONS_00000514
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1304

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000514 ID=TCONS_00000514|Name=TCONS_00000514|organism=Clytia hemisphaerica|type=transcript|length=1304bp
TCTAAAAAAAAGactcacaattttttcaaaacattccaaTATTTTTGAGT
ATAAGTTAGAGTTAGTCAAATTTTGCTAGACTAGACAGTAAGACAGGTCT
GAATTGTACATGGTGGTAATGAAGTctttgatattttcatattttgattg
atCCACTTGTGtaatttcttttgtctttttagaaaaaaaagtgtaaaatt
atcaaaagtgCAAAATGGTTCTTCTTGATAATGATACGtttttgactcAA
CTGACTTTACTGTTCAACAAAACCAGAAGTATTGGAACTGTTTTTGTTAC
AATGAAGCAATaccACGGAGAGACAAAACCAAAACCTCGAAATCTCAAAT
CAACAGACCCCAACCCACATGCAACTGGTGAACCAAGGTGTTTATTTAGA
GCTACCAATGGCAAGAAGAAATTGAGCACCGTTGTGATGCATAAAGATGT
TAATAAATTTCAAGTAGCATACGCATCTCTATTGAAAACGAATATCGACA
GTCTCAAGAAAAGAGACAAGAAATCCAAAAAGTCCAAGAAAACGAAAGCA
ACACAGTAGAAtcgtaaatttaaaaaatcgaaataacataaaaattatat
atatagtCCATCATTTGTCATCATTTTTGTGCGGGATTGAGATTCATGGT
GTTCGATTTTCATGGTGGGATCGTCAAATGGACAAGTAAAAGTTACTTTC
AAGGTACTGACTATGAATTTGGATTCTGTGCATGCATGAAAATGGACTTG
AAATGATTTATCAAATGAACTCATGTATTATGGACAATTTTTTGAGTGAT
GATGTTAAAATTGATGTTTGATAAATAGAATTTATTTATTGGTTGCTTTC
AAGAGACTTGGGGGTCAATGCTAAATAATACTCGAATTTATAACCCTTTG
ACGTGTTTGAAAGTGAATTTTTAGTTCAAAAgcttattcaaaatatttta
aattcgGTCTTTTTATCAGATCATTCtgaatatttcttatattttcttGG
GTTTTTTTTGAAGGCGACTATAATTCTAGAACTTCACAAATGAATCAACT
GTTAGAGctgtattttttatttccaCTACATATATGATAACAAACATCAG
CCCTGGAAATTAAGTTTTGTGTCctttggtttttttattttgggtAGAAA
TTGTAATCGAGTTTATTAGTGAAATTTAGAATTGCAGTATATATAATAAA
ACCATGATTTGGTAAGAATATATTacaataatcttttttttttttaataa
tttttcctcCTTATTAATCTTAAactaaaaaatacaaatgaaatTCTATC
AAGa
Run BLAST on NCBI

protein sequence of TCONS_00000514-protein

>TCONS_00000514-protein ID=TCONS_00000514-protein|Name=TCONS_00000514-protein|organism=Clytia hemisphaerica|type=polypeptide|length=114bp
MVLLDNDTFLTQLTLLFNKTRSIGTVFVTMKQYHGETKPKPRNLKSTDPN
PHATGEPRCLFRATNGKKKLSTVVMHKDVNKFQVAYASLLKTNIDSLKKR
DKKSKKSKKTKATQ
Run BLAST on NCBI

transcript from alignment at sc0000002:217071..222006-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000514 ID=TCONS_00000514|Name=TCONS_00000514|organism=Clytia hemisphaerica|type=transcript|length=4936bp|location=Sequence derived from alignment at sc0000002:217071..222006- (Clytia hemisphaerica)
TCTAAAAAAAAGACTCACAATTTTTTCAAAACATTCCAATATTTTTGAGT ATAAGTTAGAGTTAGTCAAATTTTGCTAGACTAGACAGTAAGACAGGTCT GAATTGTACATGGTGGTAATGAAGTCTTTGATATTTTCATATTTTGATTG ATCCACTTGTGTAATTTCTTTTGTCTTTTTAGAAAAAAAAGTGTAAAATT ATCAAAAGTGCAAAATGGTTCTTCTTGATAATGATACGGTATGATTTCTC AGTTGGTTCTTGTGCAGGAACACTTATGTAAAAATAAGACCTTCAACTAA ATGGATGGTCAAGGGGGTGGATAATTCCACTAGAGACAACAGGGGGGGGT CAGGATCCAAATAACCCCAGGGCCGGGGGTGGTGTCAATTTTTTTTTTCA AATTTTAAAAAGTCAAGTTGGTATCGATACCAAAATGAGGGGGTGGGTCC CCCTTTTTTTGAAAATTAGGGAATCTTTAAGTTGGTATTGATACCAAAAT GAGGGGGTGGGTCCCCCTTTTTTTAATTTTTTCTGAATTTGAAATTGGTA TCTGACTTAAAATGTTGTATAATGTAAGTATAAAAACTTATTTGAATCAT TTACATTATTATACTCTGATTCCATATAAAAGCATTCTTCATTCTACAAT TAAAATTAAATTTTTATTTAACTTTCTCTGCTCTCAATCCTTTCAATCAA CCAAAATTCATTCAAAACTAGAGTTGAACAAACTGAATCAAGTCTTAGCA GATTATTAGAACTTTTTTAGTCGTGATAGAATTTTTCTGTACATAACGTT CATCATAATATAGGCTATGTTACAATGCTAATACAATGAGTTTTTTATCT AGTCTAGTTTATCAACTAGTTTTATGAATTTGATACATTTTGCCAATTTA GTTCAAGAAACTTAATTTACGTTGTGTTAGAATGAGAAAAACTTGTTTTC ATTTTCAGGAGTCCAAAGTACATAATATAAGTGACATAGCGTCAGCCTGG GTTAAGGTCCCAGGCAAAAATTAGGTGTTAAGTTTTAAGTCCCCCCAAAG ATTTATGAATTTTTTGTTAGCCCCCAGGACTTTTAACCCTAGACACTTTC AAAAAAGTTGATCCAGTAAAAAAGGTTTTTTCCAAAATGTGAATTGTGTT CAGTCCTAAGTTTAAGATAAAATATTTTGCACGCTTTCTCTAGAAATATT GCACGGCAGGCGAAAATTTTTCAGATTCATGAGCTTCAATTTGAGTAAAT GAAGCCAACTACTAAGCTGAATTATTTTAGCCCCACGTTAAGTGATGAAA TTTTAGCTCCCCCCAAGTACATAGGTCCCCCCAAAAAAGTGGTGTACTTC CAGCCCCCTCCTTTTTTGGGAAAGATTTAAGGTGTAACCCCCCCNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTAGTGTTTCCCCCCCCCCCCCCCAACC AGCAGGGGGGGCTGACACTATGAGTGATTAATAAGAGGAATGTTCTTTGA ATTAAAACATCCACATATTTAGTGTCCTTTGTTTGCAGTATCCTATGCAT TTAACCTCTTGCATTTTTACTGATTGCCAATTTAGGAGGGTGGGTCCCCC TTTTTTTAGAAAATTGGGTTTTTCAAGTTGGTATTGATACCAATTTAGGG GGTGGTGGTGTCTACTACTTTCAAATCTTGAAAAGTCAGGTTTTTGGGCC CTGGGTTGGTATCCTGGACCCTGACCCCCCCCTGGAGACAAGGATGTTTT CATCTCCTTTTATAGTCAAGGCCAAAATATTGAAAGTTATTTCATTATAA TTTTTAAACTAAATTTTTTTTTTAGTTTTTGACTCAACTGACTTTACTGT TCAACAAAACCAGAAGTATTGGAACTGTTTTTGTTACAATGAAGCAATGT AAGTTTTTTTATACCCTCAATCGTGGTCGCAAATAGAAAAGGGGATAGAC TCCCTCACTCTGGCTTCCTGACAGCCACCAAATGATTATACTTATACTTA GTTACTTATACCTTTACCTATACCATCAATTGGAGTATCTTGTTTAGGGG TATATAAGGAGTGTCTCCTTAAAGTATTCCTTTGATCTTTATTTTGCTAT ATTTTTTACCTTTAAATTTGGATGTCATTCTTGTTATTTGCATCAAATTT TCAAAACATAAAAATTGGTAGAATCTTGATTTCCTGTTTTAATTCTAGCT TTTTCTAATCTTTATGCTGTTCTGGACACAGTTTTTGGTTAATTTTGAAA TTAATTGGGTGTTTGTGAATTTTTGCCTTTTTCAAAAGCTAAAATCTACC AAAATTACAAGAGATTTTCTGTGATAACTTCTTTCTATCAGGGTCAAATT TTAGCTTAAAATGTTCAGGCTCTATCATGAATTTTCAATTTTAATACCGG GTGCGCCACAAAAAAGTTTCTCTCTTTGAAACTAATTTTCTCGAAATCTA AAAAATTTAAAAGAACCATTCCTATTTCATTGGAAAGAAGAAAGATAAAC TTAAATTTTGTTGGGTCATTTATTAAATTTGATTCATTAGATCAAAAGTT ATACTCAATTGAATGAAAAAGTTACTTTCAGAAAGTGCTCGAAAACGTTG AAAATCGACCTATCAAATTTTTATTTTAAAATTGGCAATCACAATAGCCT TTGCATGATTAAGAGCATTTTTCAGTAACTAAACACATAAATTTTGAAAC TGAAGGGTTGAAAGGGTTTAAAATATTCATCAAAATCACTTTAATTTACT TTTACCGAAATTTTCCTCCGATTTTTGGTTCTAGACTTGATAAAGTCTAT GTAAGGCTGGATCTACCTCGAAACCCGTATTTGATGTACTTTTATGAATT TTATCAGATTTTTTGGCCTTTTTGGACGAATTCTCTTCATTTCATTGAAA TTCAACCTTCCTTTATACAAAAAAGGTCATTTAGACAGCTAATTATCATT TTTAATAACAGAAACGAAAATACTGATGTATCATGTAATTATGCTTCTGT TTGATTTGATAGGTCGATTTTTAACGTTTTTGAGAACTTTTAGAAAGAAG CTTTTTTATTCAATTGATCATAACTTTTGATCTAATGAATCGAATTTAAT AAATGACCCATCAAAACTTAAGTTTACCTTTCTCCTTGCCAATGAAATAG GAATGGTTCTTTTAAAATTTTTAGATTTCAAGAAAATTAGTTTCAAAGAG AGAAACTTTTTTGTGGTGCACCCGGTAGAATGGAAATTTATTTGTATGAT CCAATGTAATTTTTTAAGAAATTTTTTTCTTTAGACCACGGAGAGACAAA ACCAAAACCTCGAAATCTCAAATCAACAGACCCCAACCCACATGCAACTG GTGAACCAAGGTGTTTATTTAGAGCTACCAATGGCAAGAAGAAATTGAGC ACCGTTGTAAGTATAACGCTTGAGACAATAATCATGAGAAATTTTTGAAT GCCATCAATGATAATCAATGATAATCAATAAAGTTTTTACTCAAACCTCG TGAGTCAAGAGACAAGATTTTTTCATCATACTATTAGAAACATAATATCC AAAAAAACCTTGATCGACCTTCTGTTTTTTTCTGGAATGAGTAACTAAGA TAGTCACTCGGATTCACTTCAGAATTTTCCAGTGTTTTTGATTGGGAAAA TGATGATGTTTTTATTACACAAGATTTTAAACATCTATTAAATGAGTTTC CAATTTTTTTTCAATGGATTCTACTTGTATGTTCTGGATTGATTATTTTC AGTCGAAAATAATGCATTGAAGAATAAAAAGATATTTTCTTTTATTCCAG GTGATGCATAAAGATGTTAATAAATTTCAAGTAGTAAGTATATGATTTTT GATTTCGCTAGGAAGTGACGGCATTATATAATTCCATTTGATTTTCAAAG AAGGGAGCAAATACATATTTTGAGCTTTTTGTTGTTAATTTGTAGTATCA AACTTTTTCCTTGCCTGTTCTTGAATTGTAGATTTCCCATTTTCTTTCGT ACTTTATTGTCATTTTACTAATCAAATATATTGTTGTTCAAATTTCAGGC ATACGCATCTCTATTGAAAACGAATATCGACAGTCTCAAGAAAAGAGACA AGAAATCCAAAAAGTCCAAGAAAACGAAAGCAACACAGTAGAATCGTAAA TTTAAAAAATCGAAATAACATAAAAATTATATATATAGTCCATCATTTGT CATCATTTTTGTGCGGGATTGAGATTCATGGTGTTCGATTTTCATGGTGG GATCGTCAAATGGACAAGTAAAAGTTACTTTCAAGGTACTGACTATGAAT TTGGATTCTGTGCATGCATGAAAATGGACTTGAAATGATTTATCAAATGA ACTCATGTATTATGGACAATTTTTTGAGTGATGATGTTAAAATTGATGTT TGATAAATAGAATTTATTTATTGGTTGCTTTCAAGAGACTTGGGGGTCAA TGCTAAATAATACTCGAATTTATAACCCTTTGACGTGTTTGAAAGTGAAT TTTTAGTTCAAAAGCTTATTCAAAATATTTTAAATTCGGTCTTTTTATCA GATCATTCTGAATATTTCTTATATTTTCTTGGGTTTTTTTTGAAGGCGAC TATAATTCTAGAACTTCACAAATGAATCAACTGTTAGAGCTGTATTTTTT ATTTCCACTACATATATGATAACAAACATCAGCCCTGGAAATTAAGTTTT GTGTCCTTTGGTTTTTTTATTTTGGGTAGAAATTGTAATCGAGTTTATTA GTGAAATTTAGAATTGCAGTATATATAATAAAACCATGATTTGGTAAGAA TATATTACAATAATCTTTTTTTTTTTTAATAATTTTTCCTCCTTATTAAT CTTAAACTAAAAAATACAAATGAAATTCTATCAAGA

Coding sequence (CDS) from alignment at sc0000002:217071..222006-

>TCONS_00000514 ID=TCONS_00000514|Name=TCONS_00000514|organism=Clytia hemisphaerica|type=CDS|length=1725bp|location=Sequence derived from alignment at sc0000002:217071..222006- (Clytia hemisphaerica)
GCATACGCATCTCTATTGAAAACGAATATCGACAGTCTCAAGAAAAGAGA
CAAGAAATCCAAAAAGTCCAAGAAAACGAAAGCAACACAGTAGGTGATGC
ATAAAGATGTTAATAAATTTCAAGTAACCACGGAGAGACAAAACCAAAAC
CTCGAAATCTCAAATCAACAGACCCCAACCCACATGCAACTGGTGAACCA
AGGTGTTTATTTAGAGCTACCAATGGCAAGAAGAAATTGAGCACCGTTTT
TTTGACTCAACTGACTTTACTGTTCAACAAAACCAGAAGTATTGGAACTG
TTTTTGTTACAATGAAGCAATATGGTTCTTCTTGATAATGATACGGCATA
CGCATCTCTATTGAAAACGAATATCGACAGTCTCAAGAAAAGAGACAAGA
AATCCAAAAAGTCCAAGAAAACGAAAGCAACACAGTAGGTGATGCATAAA
GATGTTAATAAATTTCAAGTAACCACGGAGAGACAAAACCAAAACCTCGA
AATCTCAAATCAACAGACCCCAACCCACATGCAACTGGTGAACCAAGGTG
TTTATTTAGAGCTACCAATGGCAAGAAGAAATTGAGCACCGTTTTTTTGA
CTCAACTGACTTTACTGTTCAACAAAACCAGAAGTATTGGAACTGTTTTT
GTTACAATGAAGCAATATGGTTCTTCTTGATAATGATACGGCATACGCAT
CTCTATTGAAAACGAATATCGACAGTCTCAAGAAAAGAGACAAGAAATCC
AAAAAGTCCAAGAAAACGAAAGCAACACAGTAGGTGATGCATAAAGATGT
TAATAAATTTCAAGTAACCACGGAGAGACAAAACCAAAACCTCGAAATCT
CAAATCAACAGACCCCAACCCACATGCAACTGGTGAACCAAGGTGTTTAT
TTAGAGCTACCAATGGCAAGAAGAAATTGAGCACCGTTTTTTTGACTCAA
CTGACTTTACTGTTCAACAAAACCAGAAGTATTGGAACTGTTTTTGTTAC
AATGAAGCAATATGGTTCTTCTTGATAATGATACGGCATACGCATCTCTA
TTGAAAACGAATATCGACAGTCTCAAGAAAAGAGACAAGAAATCCAAAAA
GTCCAAGAAAACGAAAGCAACACAGTAGGTGATGCATAAAGATGTTAATA
AATTTCAAGTAACCACGGAGAGACAAAACCAAAACCTCGAAATCTCAAAT
CAACAGACCCCAACCCACATGCAACTGGTGAACCAAGGTGTTTATTTAGA
GCTACCAATGGCAAGAAGAAATTGAGCACCGTTTTTTTGACTCAACTGAC
TTTACTGTTCAACAAAACCAGAAGTATTGGAACTGTTTTTGTTACAATGA
AGCAATATGGTTCTTCTTGATAATGATACGGCATACGCATCTCTATTGAA
AACGAATATCGACAGTCTCAAGAAAAGAGACAAGAAATCCAAAAAGTCCA
AGAAAACGAAAGCAACACAGTAGGTGATGCATAAAGATGTTAATAAATTT
CAAGTAACCACGGAGAGACAAAACCAAAACCTCGAAATCTCAAATCAACA
GACCCCAACCCACATGCAACTGGTGAACCAAGGTGTTTATTTAGAGCTAC
CAATGGCAAGAAGAAATTGAGCACCGTTTTTTTGACTCAACTGACTTTAC
TGTTCAACAAAACCAGAAGTATTGGAACTGTTTTTGTTACAATGAAGCAA
TATGGTTCTTCTTGATAATGATACG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000318XLOC_000318Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000514-exon-sc0000002-1575043694:221769..222006TCONS_00000514-exon-sc0000002-1575043694:221769..222006Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1575043694:220059..220131TCONS_00000514-exon-sc0000002-1575043694:220059..220131Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1575043694:218551..218672TCONS_00000514-exon-sc0000002-1575043694:218551..218672Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1575043694:218124..218156TCONS_00000514-exon-sc0000002-1575043694:218124..218156Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1575043694:217071..217908TCONS_00000514-exon-sc0000002-1575043694:217071..217908Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1510915933:221769..222006TCONS_00000514-exon-sc0000002-1510915933:221769..222006Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1510915933:220059..220131TCONS_00000514-exon-sc0000002-1510915933:220059..220131Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1510915933:218551..218672TCONS_00000514-exon-sc0000002-1510915933:218551..218672Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1510915933:218124..218156TCONS_00000514-exon-sc0000002-1510915933:218124..218156Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1510915933:217071..217908TCONS_00000514-exon-sc0000002-1510915933:217071..217908Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1491911889:221769..222006TCONS_00000514-exon-sc0000002-1491911889:221769..222006Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1491911889:220059..220131TCONS_00000514-exon-sc0000002-1491911889:220059..220131Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1491911889:218551..218672TCONS_00000514-exon-sc0000002-1491911889:218551..218672Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1491911889:218124..218156TCONS_00000514-exon-sc0000002-1491911889:218124..218156Clytia hemisphaericaexon
TCONS_00000514-exon-sc0000002-1491911889:217071..217908TCONS_00000514-exon-sc0000002-1491911889:217071..217908Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000514-proteinTCONS_00000514-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:217071..222006 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
76.2042 73.1737 38.6656 35.3519 44.7415 29.3477 59.0668 59.1973 48.2165 44.4717 38.34 33.1439 25.6207 27.9276 32.1223 30.9183 33.7108 32.5831 17.152 18.6691 34.7405 33.6917 47.2906 42.6563 21.6718 27.1341 35.1414 28.2108 35.9972 33.1947
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003210Signal_recog_particle_SRP14
IPR009018Signal_recog_particle_SRP9/14
Vocabulary: Cellular Component
TermDefinition
GO:0005786signal recognition particle, endoplasmic reticulum targeting
GO:0048500signal recognition particle
Vocabulary: Molecular Function
TermDefinition
GO:0030942endoplasmic reticulum signal peptide binding
GO:00083127S RNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006614SRP-dependent cotranslational protein targeting to membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006614 SRP-dependent cotranslational protein targeting to membrane
cellular_component GO:0048500 signal recognition particle
cellular_component GO:0005786 signal recognition particle, endoplasmic reticulum targeting
molecular_function GO:0008312 7S RNA binding
molecular_function GO:0030942 endoplasmic reticulum signal peptide binding
Blast
BLAST of TCONS_00000514 vs. Swiss-Prot (Human)
Match: SRP14 (Signal recognition particle 14 kDa protein OS=Homo sapiens GN=SRP14 PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 1.974e-25
Identity = 49/95 (51.58%), Postives = 70/95 (73.68%), Query Frame = 2
Query:  215 MVLLDNDTFLTQLTLLFNKTRSIGTVFVTMKQYHGETKPKPRNLKSTDPNPHATGEPRCLFRATNGKKKLSTVVMHKDVNKFQVAYASLLKTNID 499
            MVLL+++ FLT+LT LF K R+ G+V++T+K+Y G TKP P+        P    + +CL RAT+GKKK+STVV  K+VNKFQ+AY++LL+ N+D
Sbjct:    1 MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEP---ADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMD 92          
The following BLAST results are available for this feature:
BLAST of TCONS_00000514 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SRP141.974e-2551.58Signal recognition particle 14 kDa protein OS=Homo... [more]
back to top