Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000514-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000514-protein
Unique NameTCONS_00000514-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length114

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000514-protein ID=TCONS_00000514-protein|Name=TCONS_00000514-protein|organism=Clytia hemisphaerica|type=polypeptide|length=114bp
MVLLDNDTFLTQLTLLFNKTRSIGTVFVTMKQYHGETKPKPRNLKSTDPN
PHATGEPRCLFRATNGKKKLSTVVMHKDVNKFQVAYASLLKTNIDSLKKR
DKKSKKSKKTKATQ
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000318XLOC_000318Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000514TCONS_00000514Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003210Signal_recog_particle_SRP14
IPR009018Signal_recog_particle_SRP9/14
Vocabulary: Cellular Component
TermDefinition
GO:0005786signal recognition particle, endoplasmic reticulum targeting
GO:0048500signal recognition particle
Vocabulary: Molecular Function
TermDefinition
GO:0030942endoplasmic reticulum signal peptide binding
GO:00083127S RNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006614SRP-dependent cotranslational protein targeting to membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006614 SRP-dependent cotranslational protein targeting to membrane
cellular_component GO:0048500 signal recognition particle
cellular_component GO:0005786 signal recognition particle, endoplasmic reticulum targeting
molecular_function GO:0008312 7S RNA binding
molecular_function GO:0030942 endoplasmic reticulum signal peptide binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003210Signal recognition particle, SRP14 subunitPFAMPF02290SRP14coord: 4..97
e-value: 2.0E-24
score: 85.7
IPR003210Signal recognition particle, SRP14 subunitPRODOMPD009170coord: 1..74
e-value: 3.0E-16
score: 202.0
NoneNo IPR availableGENE3D3.30.720.10coord: 1..114
e-value: 1.3E-39
score: 135.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 34..58
IPR009018Signal recognition particle, SRP9/SRP14 subunitSUPERFAMILY54762Signal recognition particle alu RNA binding heterodimer, SRP9/14coord: 1..100

Blast
BLAST of TCONS_00000514-protein vs. Swiss-Prot (Human)
Match: SRP14 (Signal recognition particle 14 kDa protein OS=Homo sapiens GN=SRP14 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 6.997e-34
Identity = 56/104 (53.85%), Postives = 78/104 (75.00%), Query Frame = 0
Query:    1 MVLLDNDTFLTQLTLLFNKTRSIGTVFVTMKQYHGETKPKPRNLKSTDPNPHATGEPRCLFRATNGKKKLSTVVMHKDVNKFQVAYASLLKTNIDSLKKRDKKS 104
            MVLL+++ FLT+LT LF K R+ G+V++T+K+Y G TKP P+        P    + +CL RAT+GKKK+STVV  K+VNKFQ+AY++LL+ N+D LKKRDKK+
Sbjct:    1 MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEP---ADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKN 101          
The following BLAST results are available for this feature:
BLAST of TCONS_00000514-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SRP146.997e-3453.85Signal recognition particle 14 kDa protein OS=Homo... [more]
back to top