Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000514-protein ID=TCONS_00000514-protein|Name=TCONS_00000514-protein|organism=Clytia hemisphaerica|type=polypeptide|length=114bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00000514-protein vs. Swiss-Prot (Human)
Match: SRP14 (Signal recognition particle 14 kDa protein OS=Homo sapiens GN=SRP14 PE=1 SV=2) HSP 1 Score: 114.005 bits (284), Expect = 6.997e-34 Identity = 56/104 (53.85%), Postives = 78/104 (75.00%), Query Frame = 0 Query: 1 MVLLDNDTFLTQLTLLFNKTRSIGTVFVTMKQYHGETKPKPRNLKSTDPNPHATGEPRCLFRATNGKKKLSTVVMHKDVNKFQVAYASLLKTNIDSLKKRDKKS 104 MVLL+++ FLT+LT LF K R+ G+V++T+K+Y G TKP P+ P + +CL RAT+GKKK+STVV K+VNKFQ+AY++LL+ N+D LKKRDKK+ Sbjct: 1 MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEP---ADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKN 101 The following BLAST results are available for this feature:
BLAST of TCONS_00000514-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|