Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000488 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000488
Unique NameTCONS_00000488
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2265

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000488 ID=TCONS_00000488|Name=TCONS_00000488|organism=Clytia hemisphaerica|type=transcript|length=2265bp
TTTAGATTGGATACCAATATagatttaaaaagttatttctAGATATCGAA
ATGTGAAGAAACAACATTAAGAGTATGGATTTGCCGGACACTCACAACCT
GACTTCAATTATCGGACAAATAGATACTTGGGACGAAGAGGGGCATTTGA
CGCAACTTTTATTATCGATTTTATCCATTGGAGTGACTATTAGTCCAGAA
TGTTGGTTGAAATTCCCTATCATGtgtaTAGGCTGCAATTGGCACCAAAT
CACAGCATCGCTTCGACAAACTGAATACCACGAAGTTGTCACCACTATAT
GTACACTCTGCAATCTTATCAATGGATTCATACCAGAGAACATAGAATTC
GAAAGAAAAGATTGGTTTGTGTTACAAAAACTTCGAAGATCTGCCCAGTA
TGAACCCAATTTGAGACCAAATTTCCCGAAAATATCCGAAACGGTTAACG
TTACAATACAACTGGTTACTATCGAAAATTTGGACCTGTCACACTCGaGC
TTCAAATTAGATTTCCTATTACGTCAAGAATGGAACGACCATCGATTACG
TCATCACCATCCGGCCGTCTTGGATGGATCCAACCTTCGAATGGGGGTTT
GGGTACCAGATTCGTATTTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGG
GTTGCACATGATGGGCAGACAATTAAAGTCAAAAGTAATGGAGATGTATC
ACACGGTGCAAGaATTACATTGGAGGTGAGCTGTCCCATCGACTTACGAA
ACTTTCCAATGGATATCCAACATTGCAATCTCGACATGGAAAGCTACGCA
TACAGCACAGAAGAAATAACATATAATTGGTCACCTCACGAAGTCATCAT
GAAGAATATCaaagaaacatcaaaatcactttCACAATACACGCTGGAAC
CAATCAAAACCGGCAAAGGATCTTCGGAATATGTGCTCGgtaaTTGGTCC
AAACTACAAATTGAATTCAAGTTTGTTCGGAACAGTATCATATTTATACC
AGCAATGTATTTCCCATGTGCCATGGTCGTCTTCATTACTTGGATCACAT
TCTTAATGGACTCGGCCCAGTACCCTGCCCGTACTTACTTATGTGTGACG
TCACTGTTGACTATCGTTACCCTACAGACGGCAATGAATGCTTCGTTACC
TAAGGTCAGCTACGTTAAAGCAATCGATAAATACATTGTTGGTTGCATTT
TGTTTGTGGCTGGTGCATTCTTGGAGTATGCGGTAGTTCTGCTAATCAAT
ATCAAGAAGAATAGTGTTCTGATGGAAAATTCGTCCCTGGTGAGCAATAA
CCATGACAATaTTTTCAATAACTTTTCGTACGCTCTTCAACCCAGAAGTG
AAAAGTCTAAATCCTCTCTAAAGAAGAAATTACGACGTCGCAAAATCACT
TTCTTACGATCCCGATTAACGAGCCCAAAGGAGTTCCACGACGATCAGAC
GTCATCGGTGAATGACCAACAAATTGTATTAACAAAATTCGGAGCTATTT
TTCATTTCTATCTGAGCGATGCGTGGCCCAAGAAGCTGGATGTTATTTCA
AGAGTTTTCTTCCCGTCCCTGTTTTTAACTTTCAATTTGTTTTACTGGAT
AACTCATGTTGACGATCAGTATTGAGTCACACCAAAGCTGTATAGACGTG
CTATATTGATttcatctgttttttttttcttttgcatgAAGACTGTTCGT
TACCTTCTTGTAAACTGGAATCTGGTTTTTAATACAGTTGACCCTATTGT
TTTTTCGAGCTCGAATGGCATGTCCAATTGTTTAAATTGCAGAAAGATTA
ATATTAGCGTGAGTCTAACGTCCGATTGGACGTGCAAAAAATTACATTGA
CATGGTGATTACAGAACGGTTTCCTccgataaattttgaaaattgcattt
tttaagGAAGTGGGACCATAatgaaagaataacaaaatttgattggatgT
GTTTTCAACTGTCGTTTGGAGCTGAGAACACGTTCTTCATTTCGCCACCa
gtataaaaaagaaataatcaTATAGGATGGGTCTCCAGGGGTTTCCAGGC
TATGCCCGATTGGaagaaagaaatatttaaacTATAGTGTTTGCATTcct
taaaacaatgaaatgttATTGGTTCGAAAATACATCACGTGACCTTTCCA
TTTTACTCTTCGTAAgctcaaaatcgaaatttcaagaatgaggattacac
gttttttttataagaacattcaaaatttttgatgccttctgatgttctta
actttttgggaatca
Run BLAST on NCBI

protein sequence of TCONS_00000488-protein

>TCONS_00000488-protein ID=TCONS_00000488-protein|Name=TCONS_00000488-protein|organism=Clytia hemisphaerica|type=polypeptide|length=516bp
MDLPDTHNLTSIIGQIDTWDEEGHLTQLLLSILSIGVTISPECWLKFPIM
CIGCNWHQITASLRQTEYHEVVTTICTLCNLINGFIPENIEFERKDWFVL
QKLRRSAQYEPNLRPNFPKISETVNVTIQLVTIENLDLSHSSFKLDFLLR
QEWNDHRLRHHHPAVLDGSNLRMGVWVPDSYFVQAKRGVFSRVAHDGQTI
KVKSNGDVSHGARITLEVSCPIDLRNFPMDIQHCNLDMESYAYSTEEITY
NWSPHEVIMKNIKETSKSLSQYTLEPIKTGKGSSEYVLGNWSKLQIEFKF
VRNSIIFIPAMYFPCAMVVFITWITFLMDSAQYPARTYLCVTSLLTIVTL
QTAMNASLPKVSYVKAIDKYIVGCILFVAGAFLEYAVVLLINIKKNSVLM
ENSSLVSNNHDNIFNNFSYALQPRSEKSKSSLKKKLRRRKITFLRSRLTS
PKEFHDDQTSSVNDQQIVLTKFGAIFHFYLSDAWPKKLDVISRVFFPSLF
LTFNLFYWITHVDDQY
Run BLAST on NCBI

transcript from alignment at sc0000002:1524677..1533239+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000488 ID=TCONS_00000488|Name=TCONS_00000488|organism=Clytia hemisphaerica|type=transcript|length=8563bp|location=Sequence derived from alignment at sc0000002:1524677..1533239+ (Clytia hemisphaerica)
TTTAGATTGGATACCAATATagatttaaaaagttatttctAGATATCGAA ATGTGAAGAAACAACATTAAGAGTATGGATTTGCCGGACACTCACAACCT GACTTCAATTATCGGACAAATAGATACTTGGGACGAAGAGGGGCATTTGA CGCAACTTTTATTATCGATTTTATCCATTGGAGTGACTATTAGTCCAGAA TGTTGGTTGAAATTCCCTATCATGGTACGAAAGTATTTGATAGATTACAA AAAAGATCGTATATTGTACAAGGAAATAgactgaaattttgaaatgccca aaactttcttttgaagATCAATTGTCCTTGTCGAATTTTTGAATGTCGAG TTTGTTcttgatttgttcttttttttggaaGTGCTTTTACAAAATGGATA AGAAATCACGAAggcattttttagaaaaacgttaacaaattttgaagcct tcgggtgATCTTAGTTTTTTtaggttttaagcctaaaattgttcttaaaa ttgtTCTCAGAAATTACACATTCTAAAGCATGTAAAGCCTTAAACCTTCT AAGAGCGTCATTAACATTGCCCTCGAAGCTCGAAACCTTGTGTTTTTATA AACCTTCTTTTAATAGAAAAATATCATgtatgtttttttcattttcagtg taTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAACTGAAT ACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCAATGGG TGAGCTTTTTGAATAGTCTTTTAACTCGAAGATACATCTTTCTCATTTAT CCATTTATCCATTTATCCAGTTCTGATTTGCTCAGGTTAACCCTTATTTT TTCATCTGTTTATGACAACCCTGTCTCATTCGCTAGACATACCCTTCTCC CTTCTCCCTTCTCCCTTCTCCCTTCTCCCTTCTCCCTTCTCTAAGACGCC TCTTTCCACTTGTTCAAGGTACCAATTAAGTTTTAATATCCTGATGCTCG ACACTATAATACTATAATATTACCCCTCCCCCCCCAATATCTCCAAAGGT TTACCATCTACTTTGGTCGTTGAGCTCCGGCACTTAACCCTCAACTGAAA AGAAACTGAATTTATagataaatagaaaaaaatcaacctggTTCTaaata attccaaaaaatatatggaaATGTAGAAGATAAACGatgaaaaaagaatt aattaaTTTATCCTTTGATTGTTAATATCTATTTTTTGGTAATGAGGAAC TTTGACAcccgggaggggggggggtactacaaTTGCTGACCGACATGAAT GCTCTGCGAAAGGTTCGAAAAATAGAcactacgtgggactcgttttttca aaaattttgccaaaatttgtgaaaaaagttaccctgaatgggactgaaat tgcaaaatgttctcgaattttctactttttccccaaattttccaaaaaag gcaccctacgagagacttatttttctattttggtgtttttgcgaccctac ctgcgACTTgtagaggttaaaaaaggtaccctgaccagcggtgCATCCCC GTAATCAATCTTGCTCTAGTACCCCCCGCCCCGCTTTGACAATCAAGAAT TTGTGTATGCCTAAAATGAATAAGGAATTTAACATCAAACTCGATGACAA TTCTCACCTTTCATAAAGCAATTccaaattttatgaatttctttatagtt ttctGATATTTATACTGCCAAAAATTCTAGCAAGTTAAAAATTATCCGGT CAAATGACGCATTATTCAAACAAAagttacaaaatgaaaattacccCAAT GGGAAATCGTGTCATCTAAAAGCAATATTGTTTATATGATGATGACTTCA ACATATTATTaataatatgtttttttttgttttgttaaaacAAGTTACAT GTTTGATTAATTATTTGTTATGAATCGTATGAAATTGTATAATTAATGAA GTCATTAGATTAATAAGTAAGCATCAGGTCTATCGATTACTGTATTTTCA ATATCAAAATCAACTTTATCCTAGGTTTGGGGGACTGCCTTTTAAAGGCC TttccagcggtttgcgtgaatgcgtgaattggctttttcacttgcgtcaT GAAGGTAAATGCGTGAATTAGGGAGGAAAATTAGGGAGGAAGTCTCCCCA GTCATTTCACTTCCGCTGGGACTTAATAAGGTTACTTTTTATCTCTTTGA TTTATACAGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGT TTGTGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGA CCAAATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGT TACTATCGAAAATTTGGACCTGTCACACTCGGTATGTATGCGGATTCTTT TAAGATGGATTTTTGGGTTTGGTTTTCAGTTTTAAAATGAAGTGACACAT TACTACATTCAAACACACAACATTCGCCTAGAATTGAAAAGATACCCAAT TTTATGTTCAAAGGTATGATTGGTAATCAAAGAATCAGGCTCAAtgatgt gccgctggtcagggtaccttttttccacgtagggtcgcaaaagcaccaaa atagaaaaataagaaattccTCGTTTTGGGGGGATTNTGGTCTCAAAagc accaaaatagaaaaataagaaattccTCGTTTTGGGGGatttggatttca aaaaaacaagTCCCTTGTGCATGTAGGGTCCATTTCTCGGACCTCAGTGG TACACCCCCGTCGATCCGGGGTCACAAGTCCTATCCCAGTCTGTAAATCT CACTTTAGGTACCttcttgattttcttcttctttagaGCTTCAAATTAGA TTTCCTATTACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATC CGGCCGTCTTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGAT TCGTATTTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGA TGGGCAGACAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAA GGTAGTTTGTTTGTCTCGATTTTCCAATTCATATTATTTTCTTACGTGAA GAAGAAGGCAATTCGCCCACCCTCAACTCCAGGCCTTACCTGACCCCCTT ACACTATTGATAATTCTGATGGATGCGTTGACGGGGGATGTAAAGGACTC CTCCAATTTTACGGCACTTACCTCTTTacgtcgcagaatcgtttaatGGC CCTGACTCACGAGGGTGGCAATTCGTCAAGTCAAAAAAAGAGGATGTTTG CGTTGAATTTCAACTTGAATTTCAAGTTTACGGATCTAACCTATACTGAC TGTATAGATGAGATTTGATATTCTTTCTAAAAGGGTtaccattaaaaaaa atttgtagcTCAAGAGTTAGTTTTTACTAAATTTCTTTCATAGAAACTTT GATGTTGACTCAGagtcagaaaaaatcatttctcgGTTATCAAAAGATTT AGTTTCCTCATCGTCGATAACGTCAAAATTCAATCAAGCTTGGCGATCGA AGTGATTATACTTATGATTGTAATCTTGcatgaaatattctttcagaATT ACATTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATAT CCAACATTGCAATCTCGACATGGAAAGCTGTAAGTAACAAGAAGAACCTT TCAAAAATCGTCGATGGTTTCAACAATCGAAAAAAAAGCACTCGatattg gcacttaaagggacattacagtacttgcgaaatttgtaaacaaactgtat gcagcagatacaaaatcaaaacaaatgtcacatgtcaaaataaaaaatca aaccaaatacNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNtttacaagtttgttttggacacgtgattttaattgttctct ttaatgacacgtggtttgcgcaatgtttacattttactacttttatgtcc ctttaaagggTTGACCGTCCCCGATTTTGCAGCTGAAAACtacgggttat tccaaatcgcttcagtcactcactgtcctcaaaagtgcaaatacataaac tcgcttatCTCCAAGCGTTTAGCGTAAATGAAAAAGGGGGATAGACTTTG CTCACTAACGGCACTCTTCTTCAGAAAGTCACGTAGTCTAGCATGCTATG TGAAATAATCCAAACATAgtgaaaaataagcaaaaaatagatcttatttt tctaaaaaacgatacattgtgggattgtttcgggggtattacaatagaaa tctcttaggaattcctcgagagaattctattgtaacacccaatgaagtat aagcccgaagggctagaagtcaatctccttggtaggatttgaagccaaca aatcctaccaaagttgcgcggccttgagcggctcNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNtatcaatcgtaaacaaaagaattgctagattcaatctgtcgtcaa aaatacagcgcattttttaaggcttcactttttcttgcctgagaaaggtt agagattgaactctagcccttcgggctttaaactcaatggtaacaccccc gaaacaatcccacaatgcatcgcttttttagaaaaatcaaaagctcTGAT TAGGTCTATTATGGAAGAGACAAAATTGTAATTTATGCAAACTGACATTA TCCCGTATTATCCCGTATTATCATATATAACACCCATATCACTGTATATT ATGTATTATAAACGAAACCATATCCTTCTTTACATTTCAGACGCATACAG CACAGAAGAAATAACATATAATTGGTCACCTCACGAAGTCATCATGAAGA ATATCaaagaaacatcaaaatcactttCACAATACACGCTGGAACCAATC AAAACCGGCAAAGGATCTTCGGAATATGTGCTCGGTAAAGCGACTACATC ATTTTTGACATCCCTGATTAGTCACACAGCGTTTTTATAGACGTTATTTA GGCCTTAGGCACGTAAAGTGAACGAGTTTTCCGCCTTATTTGTCTTTGTC ATGAATCATAGAAAATTTTATACGATAATTCTTAAATGAACATATTTTGT GTAAAATTATTTGCTGAcgttttaaacaaaagaacaacCCTCTCCGAGAT CTTCttcaaattaatgaaaaattcgaataacgGAGGGGATTTGTAAGATG AAAGGACCAATGATtatgttcgaattacagaaaactCGAATAAGAGgaaa tttgatattattttgcTTAAGACAGCATAAGAAGCGCTTCATTTCTATGt cataaaaaataatatcttCAATAGGGCCAAACAGGAAACTAAGATTCGCA CAAAATAcactaaaattgacattctatGATTTGGTCTAAGTTAAAATAta gggaattttattttcaggtaaTTGGTCCAAACTACAAATTGAATTCAAGT TTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGCC ATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGTA CCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACCC TACAGACGGCAATGAATGCTTCGTTACCTAAGGTAGAATcttaattcttg atattcatgatgtattGTCGGAGACACCACGAACATATATAAACGACTGA ACGTCTATCTTCTTTTGTGTCTTTGAagcaataaaaaacaaaaacggaat aaaaaatccgacttaattccgtcataattttatttatttggattacTTCt ctaaaaggattgatagagcttgaacattactagCAATTCACAAAAAATTT GTCCTCCTATTCTTTTATAAATTTGCTatattttaaaagcatttttcaac GCTAAagtgcagaatttcaactgcgtgtatacttttgaatctctTTTATC GCTGGAATAAATTGTTCTATGGCTTAAAAAAAATGGCATGTTAAAGTTCA GAGCCTGTGCTATAAGAATATCCTTATGTGAATCccatactctctaaaat tattccatactttcaaaatattaccCGGAGTTTTAACAAGTTGACGGAGT ATTTTGCCTCTCTTACCTTCCTCATAATGTAAATTAAAGAGTTGTAAAGA GTTGGACCATTGAGgtttttgtcgaagttttgacgtagTTAGCAAAGTAT TCATCtgaggtatatcatcaaaatttattgtttcatttcatgattttaac gaggcggcaacgaagctagcagtgttatcttcaaaaatacaaaggagatg gatgttcAGTCGTTTATTCTTGGGCACGgaaagtcacgtgactttgaGAA ATCGTACCGCTGTgaaagtctaccattttgaattggTTGTTAACAAACGC GAGCAAAAGCTGCAGTAATCTAGTAATCTAATTTACTTTCAACTTTAGAA CACGTTTGATCACCATTAGAAGCCATCTTTTTACTGTTTAACATGAGAAT GCTGTGATTTGTTTTCAACCAATTCAAGATGGTAGACTTTTTTAGCGGGA ATTACATAATCTTGTGATTATGTTCATGGAGACACTCAAAAAACACCGGG CAACTACCTTAATTTTTATTGCTCTAAATTtaaaactggtggcaaacgcc cagtatttttcaggttttccgtatgaattttttacaaaaggCGTGTTTGT ACGTTTTTCTAGGTCAGCTACGTTAAAGCAATCGATAAATACATTGTTGG TTGCATTTTGTTTGTGGCTGGTGCATTCTTGGAGTATGCGGTAGTTCTGC TAATCAATATCAAGAAGAATAGTGTTCTGATGGAAAATTCGTCCCTGGTG AGCAATAACCATGACAATGTATGATTTTGCtaattttccttgtttttcaa CTTTGGCAATCgcattacttttttcttttatctgcTTATTTActctttca agttttttttttgtctcgTGTTAGCCCATGAGCTAGACACTTTTTGGGGC TCACTCGACGGAGGAAGCCTCACTATGATTTTCGGAAGCCTTAACTacta tattttaagaaaaatcagggTGCTTTTTTCAAACTCACAGCTTTTGAccg aaattttcaacttttttaaggGGTGGTAAAcgcgaaatttttatttttgc ttggaTTCCCTTAGGAAATGAAATTACCATGTCATCTTTAAAATAGTATT GCAGTATTTGCAGTTCTCAGCGAAGAAGGCGTTATCTGTAACAAATACAG ATACAGGAAACTTCTTAGATTTCTGAAGCTCTATGACTGGATGGTGGTTC AGCATTGCTGAAATCCTAAGATCCTTCAACTTcctcgattttttttttct tcttctagaTTTTCAATAACTTTTCGTACGCTCTTCAACCCAGAAGTGAA AAGTCTAAATCCTCTCTAAAGAAGAAATTACGACGTCGCAAAATCACTTT CTTACGATCCCGATTAACGAGCCCAAAGGAGTTCCACGACGATCAGACGT CATCGGTGAATGACCAACAAATTGTATTAACAAAATTCGGAGCTATTTTT CATTTCTATCTGAGCGATGCGTGGCCCAAGAAGCTGGATGTTATTTCAAG AGTTTTCTTCCCGTCCCTGTTTTTAACTTTCAATTTGTTTTACTGGATAA CTCATGTTGACGATCAGTATTGAGTCACACCAAAGCTGTATAGACGTGCT ATATTGATttcatctgttttttttttcttttgcatgAAGACTGTTCGTTA CCTTCTTGTAAACTGGAATCTGGTTTTTAATACAGTTGACCCTATTGTTT TTTCGAGCTCGAATGGCATGTCCAATTGTTTAAATTGCAGAAAGATTAAT ATTAGCGTGAGTCTAACGTCCGATTGGACGTGCAAAAAATTACATTGACA TGGTGATTACAGAACGGTTTCCTccgataaattttgaaaattgcattttt taagGAAGTGGGACCATAatgaaagaataacaaaatttgattggatgTGT TTTCAACTGTCGTTTGGAGCTGAGAACACGTTCTTCATTTCGCCACCagt ataaaaaagaaataatcaTATAGGATGGGTCTCCAGGGGTTTCCAGGCTA TGCCCGATTGGaagaaagaaatatttaaacTATAGTGTTTGCATTcctta aaacaatgaaatgttATTGGTTCGAAAATACATCACGTGACCTTTCCATT TTACTCTTCGTAAgctcaaaatcgaaatttcaagaatgaggattacacgt tttttttataagaacattcaaaatttttgatgccttctgatgttcttaac tttttgggaatca

Coding sequence (CDS) from alignment at sc0000002:1524677..1533239+

>TCONS_00000488 ID=TCONS_00000488|Name=TCONS_00000488|organism=Clytia hemisphaerica|type=CDS|length=13959bp|location=Sequence derived from alignment at sc0000002:1524677..1533239+ (Clytia hemisphaerica)
ATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAAATAGA
TACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGATTTTAT
CCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTATCATG
tgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAACTGA
ATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCAATG
GATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTGTGTTA
CAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCAAATTT
CCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTACTATCG
AAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTATTACGT
CAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTCTTGGA
TGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTTTGTTC
AAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGACAATT
AAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACATTGGA
GGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCAACATT
GCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAACATAT
AATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaacatcaaa
atcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGGATCTT
CGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCAAGTTT
GTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGCCAT
GGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGTACC
CTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACCCTA
CAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAAGCAAT
CGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATTCTTGG
AGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTCTGATG
GAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAATAACTT
TTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTAAAGA
AGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAACGAGC
CCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAACAAAT
TGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGATGCGT
GGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCTGTTT
TTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGTATTG
AATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAAATAG
ATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGATTTTA
TCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTATCAT
GtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAACTG
AATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCAAT
GGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTGTGTT
ACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCAAATT
TCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTACTATC
GAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTATTACG
TCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTCTTGG
ATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTTTGTT
CAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGACAAT
TAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACATTGG
AGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCAACAT
TGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAACATA
TAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaacatcaa
aatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGGATCT
TCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCAAGTT
TGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGCCA
TGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGTAC
CCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACCCT
ACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAAGCAA
TCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATTCTTG
GAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTCTGAT
GGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAATAACT
TTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTAAAG
AAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAACGAG
CCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAACAAA
TTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGATGCG
TGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCTGTT
TTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGTATT
GAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAAATA
GATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGATTTT
ATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTATCA
TGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAACT
GAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCAA
TGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTGTGT
TACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCAAAT
TTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTACTAT
CGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTATTAC
GTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTCTTG
GATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTTTGT
TCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGACAA
TTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACATTG
GAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCAACA
TTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAACAT
ATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaacatca
aaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGGATC
TTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCAAGT
TTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGCC
ATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGTA
CCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACCC
TACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAAGCA
ATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATTCTT
GGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTCTGA
TGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAATAAC
TTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTAAA
GAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAACGA
GCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAACAA
ATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGATGC
GTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCTGT
TTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGTAT
TGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAAAT
AGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGATTT
TATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTATC
ATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAAC
TGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATCA
ATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTGTG
TTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCAAA
TTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTACTA
TCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTATTA
CGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTCTT
GGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTTTG
TTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGACA
ATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACATT
GGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCAAC
ATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAACA
TATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaacatc
aaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGGAT
CTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCAAG
TTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTGC
CATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAGT
ACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTACC
CTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAAGC
AATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATTCT
TGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTCTG
ATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAATAA
CTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTAA
AGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAACG
AGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAACA
AATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGATG
CGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCTG
TTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGTA
TTGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAAA
TAGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGATT
TTATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTAT
CATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAAA
CTGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTATC
AATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTGT
GTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCAA
ATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTACT
ATCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTATT
ACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTCT
TGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTTT
GTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGAC
AATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACAT
TGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCAA
CATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAAC
ATATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaacat
caaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGGA
TCTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCAA
GTTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGTG
CCATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCAG
TACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTAC
CCTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAAG
CAATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATTC
TTGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTCT
GATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAATA
ACTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCTA
AAGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAAC
GAGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAAC
AAATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGAT
GCGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCCT
GTTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAGT
ATTGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACAA
ATAGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGAT
TTTATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCTA
TCATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACAA
ACTGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTAT
CAATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTTG
TGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACCA
AATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTAC
TATCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTAT
TACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGTC
TTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATTT
TGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAGA
CAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTACA
TTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCCA
ACATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATAA
CATATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaaca
tcaaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAGG
ATCTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTCA
AGTTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATGT
GCCATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCCA
GTACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTTA
CCCTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAAA
GCAATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCATT
CTTGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTTC
TGATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAAT
AACTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTCT
AAAGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTAA
CGAGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCAA
CAAATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCGA
TGCGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCCC
TGTTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCAG
TATTGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGACA
AATAGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCGA
TTTTATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCCT
ATCATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGACA
AACTGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTTA
TCAATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTTT
GTGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGACC
AAATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTTA
CTATCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCTA
TTACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCGT
CTTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTATT
TTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCAG
ACAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTAC
ATTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATCC
AACATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAATA
ACATATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaac
atcaaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAAG
GATCTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATTC
AAGTTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCATG
TGCCATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCCC
AGTACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGTT
ACCCTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTAA
AGCAATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCAT
TCTTGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGTT
CTGATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCAA
TAACTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCTC
TAAAGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATTA
ACGAGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACCA
ACAAATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGCG
ATGCGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTCC
CTGTTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATCA
GTATTGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGAC
AAATAGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATCG
ATTTTATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCCC
TATCATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGAC
AAACTGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCTT
ATCAATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGTT
TGTGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGAC
CAAATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGTT
ACTATCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCCT
ATTACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCCG
TCTTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTAT
TTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGCA
GACAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATTA
CATTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATATC
CAACATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAAT
AACATATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaaa
catcaaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAAA
GGATCTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAATT
CAAGTTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCAT
GTGCCATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGCC
CAGTACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCGT
TACCCTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTTA
AAGCAATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGCA
TTCTTGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTGT
TCTGATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTCA
ATAACTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTCT
CTAAAGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGATT
AACGAGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGACC
AACAAATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAGC
GATGCGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGTC
CCTGTTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGATC
AGTATTGAATGGATTTGCCGGACACTCACAACCTGACTTCAATTATCGGA
CAAATAGATACTTGGGACGAAGAGGGGCATTTGACGCAACTTTTATTATC
GATTTTATCCATTGGAGTGACTATTAGTCCAGAATGTTGGTTGAAATTCC
CTATCATGtgtaTAGGCTGCAATTGGCACCAAATCACAGCATCGCTTCGA
CAAACTGAATACCACGAAGTTGTCACCACTATATGTACACTCTGCAATCT
TATCAATGGATTCATACCAGAGAACATAGAATTCGAAAGAAAAGATTGGT
TTGTGTTACAAAAACTTCGAAGATCTGCCCAGTATGAACCCAATTTGAGA
CCAAATTTCCCGAAAATATCCGAAACGGTTAACGTTACAATACAACTGGT
TACTATCGAAAATTTGGACCTGTCACACTCGaGCTTCAAATTAGATTTCC
TATTACGTCAAGAATGGAACGACCATCGATTACGTCATCACCATCCGGCC
GTCTTGGATGGATCCAACCTTCGAATGGGGGTTTGGGTACCAGATTCGTA
TTTTGTTCAAGCAAAGCGTGGTGTGTTCAGCCGGGTTGCACATGATGGGC
AGACAATTAAAGTCAAAAGTAATGGAGATGTATCACACGGTGCAAGaATT
ACATTGGAGGTGAGCTGTCCCATCGACTTACGAAACTTTCCAATGGATAT
CCAACATTGCAATCTCGACATGGAAAGCTACGCATACAGCACAGAAGAAA
TAACATATAATTGGTCACCTCACGAAGTCATCATGAAGAATATCaaagaa
acatcaaaatcactttCACAATACACGCTGGAACCAATCAAAACCGGCAA
AGGATCTTCGGAATATGTGCTCGgtaaTTGGTCCAAACTACAAATTGAAT
TCAAGTTTGTTCGGAACAGTATCATATTTATACCAGCAATGTATTTCCCA
TGTGCCATGGTCGTCTTCATTACTTGGATCACATTCTTAATGGACTCGGC
CCAGTACCCTGCCCGTACTTACTTATGTGTGACGTCACTGTTGACTATCG
TTACCCTACAGACGGCAATGAATGCTTCGTTACCTAAGGTCAGCTACGTT
AAAGCAATCGATAAATACATTGTTGGTTGCATTTTGTTTGTGGCTGGTGC
ATTCTTGGAGTATGCGGTAGTTCTGCTAATCAATATCAAGAAGAATAGTG
TTCTGATGGAAAATTCGTCCCTGGTGAGCAATAACCATGACAATaTTTTC
AATAACTTTTCGTACGCTCTTCAACCCAGAAGTGAAAAGTCTAAATCCTC
TCTAAAGAAGAAATTACGACGTCGCAAAATCACTTTCTTACGATCCCGAT
TAACGAGCCCAAAGGAGTTCCACGACGATCAGACGTCATCGGTGAATGAC
CAACAAATTGTATTAACAAAATTCGGAGCTATTTTTCATTTCTATCTGAG
CGATGCGTGGCCCAAGAAGCTGGATGTTATTTCAAGAGTTTTCTTCCCGT
CCCTGTTTTTAACTTTCAATTTGTTTTACTGGATAACTCATGTTGACGAT
CAGTATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000306XLOC_000306Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000488-exon-sc0000002-1491911889:1524677..1524900TCONS_00000488-exon-sc0000002-1491911889:1524677..1524900Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1524677..1524900TCONS_00000488-exon-sc0000002-1510915933:1524677..1524900Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1524677..1524900TCONS_00000488-exon-sc0000002-1575043694:1524677..1524900Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1525325..1525425TCONS_00000488-exon-sc0000002-1491911889:1525325..1525425Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1525325..1525425TCONS_00000488-exon-sc0000002-1510915933:1525325..1525425Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1525325..1525425TCONS_00000488-exon-sc0000002-1575043694:1525325..1525425Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1526886..1527057TCONS_00000488-exon-sc0000002-1491911889:1526886..1527057Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1526886..1527057TCONS_00000488-exon-sc0000002-1510915933:1526886..1527057Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1526886..1527057TCONS_00000488-exon-sc0000002-1575043694:1526886..1527057Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1527513..1527727TCONS_00000488-exon-sc0000002-1491911889:1527513..1527727Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1527513..1527727TCONS_00000488-exon-sc0000002-1510915933:1527513..1527727Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1527513..1527727TCONS_00000488-exon-sc0000002-1575043694:1527513..1527727Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1528273..1528355TCONS_00000488-exon-sc0000002-1491911889:1528273..1528355Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1528273..1528355TCONS_00000488-exon-sc0000002-1510915933:1528273..1528355Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1528273..1528355TCONS_00000488-exon-sc0000002-1575043694:1528273..1528355Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1529717..1529860TCONS_00000488-exon-sc0000002-1491911889:1529717..1529860Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1529717..1529860TCONS_00000488-exon-sc0000002-1510915933:1529717..1529860Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1529717..1529860TCONS_00000488-exon-sc0000002-1575043694:1529717..1529860Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1530344..1530558TCONS_00000488-exon-sc0000002-1491911889:1530344..1530558Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1530344..1530558TCONS_00000488-exon-sc0000002-1510915933:1530344..1530558Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1530344..1530558TCONS_00000488-exon-sc0000002-1575043694:1530344..1530558Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1531639..1531794TCONS_00000488-exon-sc0000002-1491911889:1531639..1531794Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1531639..1531794TCONS_00000488-exon-sc0000002-1510915933:1531639..1531794Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1531639..1531794TCONS_00000488-exon-sc0000002-1575043694:1531639..1531794Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1491911889:1532285..1533239TCONS_00000488-exon-sc0000002-1491911889:1532285..1533239Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1510915933:1532285..1533239TCONS_00000488-exon-sc0000002-1510915933:1532285..1533239Clytia hemisphaericaexon
TCONS_00000488-exon-sc0000002-1575043694:1532285..1533239TCONS_00000488-exon-sc0000002-1575043694:1532285..1533239Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000488-proteinTCONS_00000488-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1524677..1533239 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.51477e-08 0.336541 6.02646e-08 0.0764587 15.2001 10.7029 28.6408 31.9016 31.607 31.0788 33.7234 22.8819 4.10749 2.64199 1.44568e-07 0.210303 2.56451e-06 2.74839 3.98926e-06 2.39936 3.42018 3.39345 5.35361e-07 2.17988e-07 10.599 10.5146 5.53018e-08 1.80754e-07 0.15322 2.68033e-07
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006811ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005230 extracellular ligand-gated ion channel activity
molecular_function GO:0005216 ion channel activity
Blast
BLAST of TCONS_00000488 vs. Swiss-Prot (Human)
Match: GLRA3 (Glycine receptor subunit alpha-3 OS=Homo sapiens GN=GLRA3 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 3.660e-53
Identity = 125/428 (29.21%), Postives = 220/428 (51.40%), Query Frame = 3
Query:  366 FVLQKLRRSAQYEPNLRPNF--PKISETVNVTIQLVTIENLDLSHSSFKLDFLLRQEWNDHRLRHHH---------PAVLDGSNLRMGVWVPDSYFVQAKRGVFSRVAHDGQTIKVKSNGDVSHGARITLEVSCPIDLRNFPMDIQHCNLDMESYAYSTEEITYNWSPHEVIMKNIKETSKSLSQYTLEPIKTGK-GSSEYVLGNWSKLQIEFKFVRNSIIFIPAMYFPCAMVVFITWITFLMDSAQYPARTYLCVTSLLTIVTLQTAMNASLPKVSYVKAIDKYIVGCILFVAGAFLEYAVVLLINIKKNSVLMENSSLVSNNHDNIFNNFSYALQPXXXXXXXXXXXXXXXXXITFLRSRLTSPKEFHDDQTSSVNDQ--QIVLTKFGAIFHFYLSDAWPKKLDVISRVFFPSLFLTFNLFYWITH 1607
            F+ + + R++ Y+  +RPNF  P ++ T N+ I   +  ++  +   ++++  LRQ+WND RL +           P++LD       +W PD +F   K   F  V  D + +++  NG+V +  R+TL +SCP+DL+NFPMD+Q C + +ES+ Y+  ++ + W     +   + E   +L Q+ L+  K  +  +  Y  G ++ +++ F   R    ++  MY P  ++V ++W++F ++    PAR  L +T++LT+ T  +   ASLPKVSYVKAID ++  C+LFV  A LEYA V       N V  ++  L+           ++AL+       S +  ++R  + +F    +    +  D  T    +   Q++      +   ++  A  KK+D ISR  FP  FL FN+FYW+ +
Sbjct:   46 FLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFIN--SFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDS------IWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPV--QVAE-GLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAV-------NFVSRQHKELLRFRRKRKNKTEAFALE--KFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRA--KKIDTISRACFPLAFLIFNIFYWVIY 451          
The following BLAST results are available for this feature:
BLAST of TCONS_00000488 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GLRA33.660e-5329.21Glycine receptor subunit alpha-3 OS=Homo sapiens G... [more]
back to top