Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000450 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000450
Unique NameTCONS_00000450
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length706

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000450 ID=TCONS_00000450|Name=TCONS_00000450|organism=Clytia hemisphaerica|type=transcript|length=706bp
ATTGCAACATAGAATTGTTTTCAAATTACTAACACAACAATGGAGATGAA
CACAGAATTAGTCTGTGTGATGGCCAGTCTTGGCTATCATGATGACACGG
ACTACTTTCTGGGTGAAGATTGTCTTCCAAGTCTTAAAGATTTGATTCGT
TTCTTGAAACATGAAGATGAATCTTGTAACATCAGAAGACAAATGGGACA
TTCTCAACTGATTCAAAAGGACCTTCTTCCAATGTTCATGTTTCATGCTG
AAAATGCAGAACTCATTGATATTGTTGTCAGATTGCTTGTCAATTTGACC
TCACCTGCAGATATTTGCTTCAATAAGAATCAGAGTGAGCTAGCTGAAGA
ATCTGCCCCCACAAAAATGTCAAACACTTATTCTGCAAAGCAAATGGAAG
TTGTTGGCCATCTTCAAGGATACAAAGAGGCTTTTGTAAATGAAAAGGCA
ATGAGTGCAATTGCTGCTCAAATAGGAAAAGTTTTACAGATgGAAATGGA
AGATCGAGGAGAAGACGAATATTTGTTATTTGAACGATTGCTTCTCCTGC
TGAGAAACATTTTACACGTTCCTGCTTCACCAGAAGATGAAAAGcgAACT
GATGATGATGCCTCTCTGCATGATCAAATTTTATGGAGCATGCACTTGAA
TGGTATTGATGATTTGTTAGTTTACATTTGTAGCTCGCCAGAAGAGAGTC
GCTGGG
Run BLAST on NCBI

transcript from alignment at sc0000002:958475..962472+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000450 ID=TCONS_00000450|Name=TCONS_00000450|organism=Clytia hemisphaerica|type=transcript|length=3998bp|location=Sequence derived from alignment at sc0000002:958475..962472+ (Clytia hemisphaerica)
ATTGCAACATAGAATTGTTTTCAAATTACTGTAAGTGTTTGGATCAAgaa aataccgggtgcgccacaaaaaagtttctctctttaaaactaattttctc gaaatctaaaagttttaaacgaatcattcctatttcattagaaagaagaa agataaacttaaattttgatgggtcatttattaaattcgattcatcagat caaaagttaggctcaattgaatgaaaaagttattttcagaaaatgctcga aactttgaaaatcgagctatcaaattttattttaaaattagcAATCAcca tagcctttacatgattaagagcattttttcCGTAACTAAAcacttaaatt ttgaaactgaagggtcgaaagggtttagaatcttcatcaaaatcatttta atttacttttaccgaaattttcctcaaatcNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCTTTAGGG AAAAACAGTTGACCTCTTCAGTCTCAGCCCCCCcccagaaattaaaattt tgtttccCTCTcccctttttggaaaattttttttaaatctctaaCCCACC CTGTAAAAAAGAGACACTATCCTAACCACTGATGATCCACGGTATTATTT AAAAGCTTTGATTGCTTTGTGCTCTCTTCGCTTGAAATGTTTGACAGATT AAAGATTGACCATCCATGAGAGAGTTCCTGGGCGTTTGTATTTGcgatgt tagcttttttaggctcatgcaaataaatggatagaaatagaaataggaAG GTGTTTTCTTACATTATTGCAGGTATCAAATAAATGCATTATATTAGGGG CAAAACCACATTTATTTCATTCGAAAGTTGAAtatatttgaagatatttt cgcGAGGGGGTCCACTGGTCAAAAATCTTTTATAGGCCAAAGACTGACNa ttgaaacgaaaatactgatgcatcatgtaattatgcttctgtttaatttg ataggtctatttttaacgtttttgggcACTTTCAGaaactaactttttta tttaattgagcataacttttgatctactgaatcaaatttaataaatgacc catcaaaatttaagtttatctttcttctttccgatgaaataagaatggtt cttttaaaaatgttatatttcaagaaaattagttttaaagagagaaactt ttttgtgacgCACCCGGTAGAAACACAAGGttctattttacaaatttttt caaacgttCCAGGAATGAAAATTAAGGTATAATGATAATTTAATACTAAC CATAGTGTCTNGCAGACCCCCCTCACAAAAATGTCTTcaaatacattcaa cttttgaatgaaattcATGTGGTTGCTTCCTATAAAAGTTGTCACGGATC CTATGTGATTGAATCCTATATGTGAtatatgatatttttttgaattactT ACAAGCTANattttttttaaatctctaaCCCACCCTGTAAAAAAGAGACA CTATCCTAACCACTGATGATCCACGGTATTATTTAAAAGCTTTGATTGCT TTGTGCTCTCTTCGCTTGAAATGTTTGACAGATTAAAGATTGACCATCCA TGAGAGAGTTCCTGGGCGTTCGTATTTGcgatgttagcttttttaggctc gtgcaaataaatggatagaaatagaaataggaAGGTGTTTTCTTACATTA TTGCAGGTATCAAATAAATGCATTTTATTAGGGGAAAAACCACATTTATT TCATTCGAAAGTTGAATAtatttgaagacattttcgCGAGGGGGTCCACT GGTCCAAAATCTTTTATAGGCCAAAGACTGATGTTacttttttacccatt ttttgcctttaCAGTTTTGCCTGTAACGTCAGTCTTTaaccaataaaaaa ttttgctagGCCTTAGCAGCAGACCCCCCTCACAAAAATGTCTTcaaata cattcaacttttgaatgaaattcATGTGGTTGCTTCCTATAAAAGTTGTC ACGGATCCTATATGTGATTGAATCCTATATGTGAtatatgatattttttt gaattacttacaagctaaaaaaATTACTAATCAATATCAAGATCCAAAAC CATACATTAATATGCATTGTGAAAAGTTAGTCCAAActatttattaaaat ttgagTTCAAAAGATACTAAGTAAAAATGTTTACTTTCTTGCAGAACACA ACAATGGAGATGAACACAGAATTAGTCTGTGTGATGGCCAGTCTTGGCTA TCATGATGACACGGACTACTTTCTGGGTGAAGATTGTCTTCCAAGTCTTA AAGATTTGATTCGTTTCTTGAAACATGAAGATGAATCTTGTAACATCAGA AGACAAATGGGACATTCTCAACTGATTCAAAAGGTATGACAATCTTTCAA TTATTATCCATAACAacggttttattttgaaagctctaATAACCTCTAAT CACTAATGTTTTTCATATGCTAATAAATCTTCTGAATTGTTTAGGACCTT CTTCCAATGTTCATGTTTCATGCTGAAAATGCAGAACTCATTGATATTGT TGTCAGGTATgttaattttatcattttttactaCTACATTGGCGAAAGAA TATGAATTAGATAAAAACAAGACAGCGCAATGCAAAATTTCATTCCTGCA AAACAAGGTTGAAAGAGGCCATCAAAGATATCAATAAGATTTACAGCTCA CAATAGTTGAGATGTCAATGATTCTACTTACCTTTCAGTCTCCTATAGGT CCATTAACTTGGTGGTGAATCTAAGTACAGAATTTCAAGTCCTTTCTGTC ATCCTTTCAGATTGCTTGTCAATTTGACCTCACCTGCAGATATTTGCTTC AATAAGAATCAGAGTGAGCTAGCTGAAGAATCTGCCCCCACAAAAATGTC AAACACTTATTCTGCAAAGCAAATGGAAGTTGTTGGCCATCTTCAAGGAT ACAAAGAGGTAAATTTCTATTCTGATCTTTCCGGTTGTACCAAAATAGAA ATCCTAAAAGTTTAATCATTATAACAAACTTTAACTTTTCATCTTTAATT TATAGGCTTTTGTAAATGAAAAGGCAATGAGTGCAATTGCTGCTCAAATA GGAAAAGTTTTACAGATggtatgttattattattatgtatTATTTATCAT ATTGATACTTTGACCTCTAACTTAATATTCAGTTATTCAGGTCTCTGATC TATCTAAGTAGTTTGCTTTGAGAAAATATCCTTGAGTACACATAATTTGA CTTTGTCTAGGAAATGGAAGATCGAGGAGAAGACGAATATTTGTTATTTG AACGATTGCTTCTCCTGCTGAGAAACATTTTACACGTTCCTGCTTCACCA GAAGATGAAAAGGTgcattttaaaatcattttaccATACTACTTATGCTC AATTAATTTTATGTTTTAGAAAAACAGTAGCAGTTCTTTACCcacatatt ttcttaaaaactaAATCAAAATGATTAAACCTAAGGATAGCCAAGGAACT AATTGTTTTAccctcttttttttgttttagcgAACTGATGATGATGCCTC TCTGCATGATCAAATTTTATGGTAGGACATTCTTGCATTCTCTTTTAAGT CCTACTACTCAGCTAgcctataaatatttttaaatatttctgtaacctgt attttgaaattttctactttttaggATTTTCTTGTAATCTCTTAAGTAGT TCTATTCATTCAGTCTATAAATTTGCTAGATACTAAGATGTATTTCTATT CAAGTATTTCTGTAACCTGTTACTTGTAATTCTTTACTTCTTAACATTTA GGAGCATGCACTTGAATGGTATTGATGATTTGTTAGTTTACATTTGTAGC TCGCCAGAAGAGGTAAATTTATGTGAACATTTAGGTTTTATCATTCCCTC TTTCTGTCAGAAAAGGattcatttttttacaattttgttttAACCATTGA AAATTTTACCTTTCTTTCTGTCTATCTTTTCATATTAGAGTCGCTGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000286XLOC_000286Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000450-exon-sc0000002-1491911889:958475..958504TCONS_00000450-exon-sc0000002-1491911889:958475..958504Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:958475..958504TCONS_00000450-exon-sc0000002-1510915933:958475..958504Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:958475..958504TCONS_00000450-exon-sc0000002-1575043694:958475..958504Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:960669..960857TCONS_00000450-exon-sc0000002-1491911889:960669..960857Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:960669..960857TCONS_00000450-exon-sc0000002-1510915933:960669..960857Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:960669..960857TCONS_00000450-exon-sc0000002-1575043694:960669..960857Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:960969..961030TCONS_00000450-exon-sc0000002-1491911889:960969..961030Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:960969..961030TCONS_00000450-exon-sc0000002-1510915933:960969..961030Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:960969..961030TCONS_00000450-exon-sc0000002-1575043694:960969..961030Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:961285..961432TCONS_00000450-exon-sc0000002-1491911889:961285..961432Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:961285..961432TCONS_00000450-exon-sc0000002-1510915933:961285..961432Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:961285..961432TCONS_00000450-exon-sc0000002-1575043694:961285..961432Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:961530..961592TCONS_00000450-exon-sc0000002-1491911889:961530..961592Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:961530..961592TCONS_00000450-exon-sc0000002-1510915933:961530..961592Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:961530..961592TCONS_00000450-exon-sc0000002-1575043694:961530..961592Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:961735..961836TCONS_00000450-exon-sc0000002-1491911889:961735..961836Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:961735..961836TCONS_00000450-exon-sc0000002-1510915933:961735..961836Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:961735..961836TCONS_00000450-exon-sc0000002-1575043694:961735..961836Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:962005..962045TCONS_00000450-exon-sc0000002-1491911889:962005..962045Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:962005..962045TCONS_00000450-exon-sc0000002-1510915933:962005..962045Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:962005..962045TCONS_00000450-exon-sc0000002-1575043694:962005..962045Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:962276..962336TCONS_00000450-exon-sc0000002-1491911889:962276..962336Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:962276..962336TCONS_00000450-exon-sc0000002-1510915933:962276..962336Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:962276..962336TCONS_00000450-exon-sc0000002-1575043694:962276..962336Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1491911889:962463..962472TCONS_00000450-exon-sc0000002-1491911889:962463..962472Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1510915933:962463..962472TCONS_00000450-exon-sc0000002-1510915933:962463..962472Clytia hemisphaericaexon
TCONS_00000450-exon-sc0000002-1575043694:962463..962472TCONS_00000450-exon-sc0000002-1575043694:962463..962472Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:958475..962472 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.70659 0.185613 1.36901 4.85694 1.87766 1.47434 2.5593 4.72642 0.407433 0 0 0 1.42523 0 0.954013 2.21488 0 0 1.25245 1.30078 0.673814 1.52844 0.000220626 0 4.88768 5.85003 0.0385797 0 0 0
Blast
BLAST of TCONS_00000450 vs. Swiss-Prot (Human)
Match: TIM (Protein timeless homolog OS=Homo sapiens GN=TIMELESS PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 6.051e-51
Identity = 100/220 (45.45%), Postives = 150/220 (68.18%), Query Frame = 1
Query:   46 MNTELVCVMASLGYHDDTDYFLGEDCLPSLKDLIRFLKHEDESCNIRRQMGHSQLIQKDLLPMFMFHAENAELIDIVVRLLVNLTSPADICFNKNQSELAEESAPTKMSNTYSAKQMEVVGHLQGYKEAFVNEKAMSAIAAQIGKVLQMEMEDRGEDEYXXXXXXXXXXXXXXHVPASPEDEKRTDDDASLHDQILWSMHLNGIDDLLVYICSSPEESRW 705
            MN EL+   ++LGY +   Y    DCL S+KDLIR+L+HEDE+ ++R+Q+G +Q++Q DLLP+   H ++  L D V+RL+VNLT PA +CF     E            ++    ++V+ +LQ YKEAF +EKA   ++  + ++LQ+  E+R E++ LL ER+LLL+RNILHVPA  + EK+ DDDAS HDQ+LW++HL+G+DDLL+++ SS  E +W
Sbjct:    6 MNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKE-----------PSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQW 214          
The following BLAST results are available for this feature:
BLAST of TCONS_00000450 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TIM6.051e-5145.45Protein timeless homolog OS=Homo sapiens GN=TIMELE... [more]
back to top