Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000399 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000399
Unique NameTCONS_00000399
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6592

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000399 ID=TCONS_00000399|Name=TCONS_00000399|organism=Clytia hemisphaerica|type=transcript|length=6592bp
GTCAAATTAAGATAAGCAGTCTGTAAATCGTAATAATATCGGCAAAATCA
AACTTTTACCCTGGATTATTGAAAAGTTGATTTGAGAGCAGTTCATTCTA
CAGCTTTTATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTG
GAAACAAACACAGAAGATACAGAGACATCGTTAGCTGACACAAATACAAT
TCATGGTTCACTGGATGGGGATACATCGACGGAAGGTTCCATTTCACCTG
ATCTATTGATCACCAACGAAGTTTCTCAACCACTTCACCAACCAACGGGT
CACTCTGCAGCTGCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCAC
CTCAATAAGCTCAATGACTCCGGTCCTAATCaccaaaaacatagaaatag
gGAATGAGCGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACATTAAT
TCGGTCCCGATTCACGACCTACCGCAACCGTACATTGCACCGGACGGTTT
ATATTACTGGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGC
TGATCGAAAGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCAC
GACAGCCAGCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATAT
AATAACTCAAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTG
TCATCCCGCCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCC
ATACAAAATCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGA
TCAATACTTGAACTCACAGATGGACAGCGATCAGTATGTACCGATCTCTA
CCGTTGCTAAATTCAATCAAgtTCGAAAATTAACTTCAGATATTGATCTC
ATAGTGGACGCACTTCGAGAATCACCATACGTGCAGTTGGACGAAACCGA
ACAGAAAGTGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAA
TCCCAGAAGTCACACCCATCGAGGATGTTAAAGCGTTGTTCGCAAGTCCA
AACTGTCCTAAATGGACGAGTTTCGAGTACGCATACAATGACAACTGGTA
TGTCACCTTTGAATGCGAAGATGACGCAAAGAAAGCTTACAGATATCTCC
GCGAAGAAGTCCAATCATTTCAAGGTCGGCCTCTGATGGCTAGAATCAAA
GCTAAAACGCTACTCAGCCGGACAGTCTATCTACCAAAGAATGCGGCAAG
CGCCACCGGTTCGACCACAACTAACACGTCACCGCCCGCCGATAATGTGA
CGTCACAATTCTCCACCACCGGTGGTGTTCCGGCGTTCACTGTGAGCCAC
CCGCAACAAATCTTTTCACCCAATTTTCAACCGTTTTACAACACAGCACC
TGTGAACGGGAATCCCGGCATTCTTCCGGCCGGTGCTCAATGGATCAGTA
CAACCACACGATTCATTCCTCCAGAGATCCGACCGAAAAATAACTACAAC
AAATACAACAACTACCAAGGGAATAAACAATTGAATGGACAACGCCCTTA
CTTCCCTGGCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCCAACA
AAGTACCGTTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGAC
CGCCCGTCCAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACA
TAATCACCAAAACGTACACAATACAAATGTCAATAGTAATTATCGTGGTA
GAAATAGTGAAGACCCACGCTTCGTACGTCACAGTGGACCGCGCAAAGAC
TGGAATCGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGA
ACGACGCGGCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGA
AAGACGAGAAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGAT
AAAAGTTCCATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCC
TCAAATTAATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTC
TACCAAGCCCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAAT
AGATCTGCTTCCTCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTGAAGT
CGaatcaaataaagaaaaaccaatGACAACATCTCCTGCAGACATGAGtg
AACTTTTGACGACGGCTGAAGTTTTCGAACCAGCAGCTACCGAACCCGCC
CAAACCACTACAACGAACGCCAACGAAAACGCCCCCTTAATCACCACAGT
GGTGAGCACAGATAACGGTATACCAAAAATGCTGAGCTATGCACAAATGG
CGCAAAAACCGAACAGTAATaaggaaaattttgtaaacGATATCGACACG
GCGAAGGACATTTCAGATGCGGTCGCCGCCAGTGACcctaaaaaatcttc
aaataataAGACGGAAAACGGCAAAAACGGACAATCGGCAAATggaaaac
aaaatagaaaacctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCGGAAA
TCCAACGGACAAGACAAATCGGCGGAAGTCGAACAGATGAGCGTTTCTTC
GAACTTAACAAATACGGTGATGAAGGAAACTTACGCATCTAAATTTGGTT
CGTCCAGTGACTCGTCAAGAACTGGCAACTCTCCGTCAAGACCCAAAACC
CAACCAACGACTAACACAAACTCTATAAATAAGCAAAACCCACCATCAac
gaataataaaaataatagcGGCCTACCAGCGCTGCGGCCTTTGATGAGCC
AAGTCATCAATCCACCTGTCAGTAAAATGGACGAAATCAACGGACTAGAG
TTACAACAACAGCAACCGATTTCGTTCAGTGATACTGTTAAAAAACAATC
TTCAATTGAACCTTCCACTCCTACTTCACCGAGGTCAATAGATCTCAACT
CTGTGAGTAGTCCTCCATCCTCTAATACTGTTTCTCAACCGCCAGAGACC
TCTTCAACGATAGAAGCTCCGAAAGAGAAATCATAGTTGTATAGATGCTG
AGTGGTTTTTAGTGTGTTTTTACGTGCAAACGATGTGGATAGGATGGTTT
TTCTTTCCGCTAAATGGTTGCTTGAATCATTGGATGGTTTCTATATGGTA
TTTGATAGGGTGgatgattttaagaaaaagtaatCAACCAATTCGCAGCA
AATGATCGAATCGTCGCTTGATACCCACCATCTTGTTCAGTCTTTGTGTT
CCAACACAAAAGATGCTGTAAATTAAAGAATTCGGTACCTGAATACAAAG
AGTATCCCCGATTAATCACGCGCGTTCAACGCACTGGCTGGTCTGTAAGA
GAGCACTTCAGAAAtgcatctttctcatctttgctgacTTTGACCCTTAC
AGtccactttgggaagcttggaaaatataccTATAAGGGCCGCAtgtatg
gtaggtcatttaccttgagtgccccggTCTTTGAGGGTTTTACAACAACC
TTTTATAGTCTGACAATATTTTGTTCCCATAATGCAATGATAGAAGTAGT
AGTTTTATAGGGGTCCGATGTTTTCTGTCTTGTTTTCTGTTCTGTAGTAT
ATTATATATTGCGAGTTAAGTCAGGCCTCAACTCTTGCGTAGTACATTTG
CAGGAATAAACTACCGTCACTTTTCGGGTTGAATTAGTTGTGAAAATCTA
CAttgattattgaaaattttcaccaTTAAATTTTGCAAGATTGTAACTTT
AACTGTTTAATtgaacagaattttttttctaaagtttttctTCTAATTTG
TGGATGGAGTTGAGGCTAGgcttaaaaattcttttttctgtagttttcaa
accaaaaaaatcttttattttatattttttaaaacaaaaaagtcaacttT
GTTCGACGTAGAGTTCCCAATATTTGTCGTGTTTTTAACGAATCGAGTTT
ATttagaaagagagaaaaaaatcgtttaaaaaactaaaaatagatATATT
ATATGATATgaaattttagaacttttcttCGGGTTGATGCTTTATCACTT
GTGATGAGATAGATTTAAAGGTTCTGTCCTATTCACAAAAAGACTTTTCA
TATTCGTTACCCTTCATGCTTTAATCGGATTGTCTTCGAAATGCATTTTG
GGTATTAAAGTTCAATTAAGTCATTTGGTAGCTCTCAGCATGCATTTGAT
AAGCTTTAAAACCTGAGCGCGATTTGCGTGGATATCCTGCTATCCCTATA
GTGTGTAGAAAGCTAATCTACTTGAACAGAGAATACTCATGCCAGCAAGC
TTTTGTTCGACTGATAACTGTCGAggatgaatttcttttttaactgGCTG
AATAAAAGATTTGTAGATTTGCCATTTTTGAGAATGTCTGTTCCTCTTTT
CATCCCATAATAATGTTCCCTAAATATGAAAACTCAAATGAAACTCACTC
AANTTACATTTGCAGGAATAAACTACCGTCACTTTTCGGGTTGAATTAGT
TGTGAAAATCTACAttgattattgaaaattttcaccaTTAAATTTTGCAA
GATTGTAACTTTAACTGTTTAATtgaacagaattttttttctaaagtttt
tctTCTAATTTGTGGATGGAGTTGAGGCTAGgcttaaaaattcttttttc
tgtagttttcaaaccaaaaaaatcttttattttatattttttaaaacaaa
aaagtcaacttTGTTCGACGTAGAGTTCCCAATATTTGTCGTGTTTTTAA
CGAATCGAGTTTATttagaaagagagaaaaaaatcgtttaaaaaactaaa
aatagatATATTATATGATATgaaattttagaacttttcttCGGGTTGAT
GCTTTATCACTTGTGATGAGATAGATTTAAAGGTTCTGTCCTATTCACAA
AAAGACTTTTCATATTCGTTACCCTTCATGCTTTAATCGGATTGTCTTCG
AAATGCATTTTGGGTATTAAAGTTCAATTAAGTCATTTGGTAGCTCTCAG
CATGCATTTGATAAGCTTTAAAACCTGAGCGCGATTTGCGTGGATATCCT
GCTATCCCTATAGTGTGTAGAAAGCTAATCTACTTGAACAGAGAATACTC
ATGCCAGCAAGCTTTTGTTCGACTGATTACTGAAGTCGAggatgaatttc
ttttttaactgGCTAAATAAAAGAATTGTAGATTTGCCATTTTTGAGAAT
GTCTGTTCCTCTTTTCATCCCATAATAATGTTCCCTAAATATGAAAACTC
AAATGAAACTCACTCAATTCAAGGCAGGATATTTCGCGgaatcgcaaaaa
atatgaaaaatagaaattatattatttGACATGTGAACACGATTAACGTG
TTTTACAATTTAGAAACCCTAAAAAGAACGTTTATAAACTTTATTATTTT
ACCACGAGTATGTGTACACAGATTTTTACcatcttaacttttttttgaaa
ttaagtGTGTGGATCAGAGGTCTTTCAGGTTCGGCCAAGTTATAATTTCT
ATAATTATGAAAGAAAACGATATTCGAATTTGCACAAGTTGTTTTCTTTC
ATAATGGCAGATCCCCCTTGCAACACCTGTAAGACCTCTTTACGGGAAAG
GTTCAAACGCGCGACGGACTCGTATTTGAATTCTTCCCGCAGCTGACACA
GTGCTGACACACTGTCGTTTATGATATCTGCCGCTCAGTTGACCTCAAGA
AGAATACGCATAATTTAAACGGGCAGGCATCGCCATGACTTTATGTTCAT
GCTGGAATATTTATGCATGATATTATTTTGAAGGCTATTAAATATGTTAT
AAACTTGCCAGAGAGTGGGCTGTTTTTGACCCGTTCGTTTCATTTGCTTC
AAATATATACAAGGAGAAGTGCTTTTGCATGGTCATAAAACATTGCACAC
TAAGGCGGTATTTATGTGTGATGCCTGTCCTCGTGCCAGTCTTTGTTGTT
TATGCTTCTGAAGTCGACGAGCTTGTAGAAATCATGAAATTAAAAGAAAA
GGTGTAGCCTtaagattattttttttatctttatcaTAACAAGGCTTGTC
TAATATTAAAGCCAGTCAGGATGACTCAAATCGTACTGCAAACTTCTTGT
ACCCAATTTGATAAGTAATTTTTATGATTCTTACATGGCTCGCGAATCTA
CGACCTGGGTACGATATTATGCTTACTGATTTTCGATCCGAAAGATGAAA
GCTACACCGATCTTCTTCTGTGATTTCTGTATGTTCTTTGAGGCTTGGAA
ACGAGAGTAAATCTTaattaaaatcaattaaaatttACTTACATCCAATG
GATATCCAAGAAGAAAGTAGATGAGTTCAAGGCGTGTCTTCAAGAGATCT
CTAACTTTTTCGAAATAACTTTTTGAGTCTCGGAAAAGCTATAACTGGTG
GACGATAGTTGCATTATCAAGCTTTGGGGTAGTTAAACTTTTCTTGATTT
GTGGTCTTGGATATTTTGGATAAGGAAAATTATTTCTCTGTTTCACAAGC
ATAAAAGACATACATTTACTATATTTGATGACTTTTTCAACTTGTACATA
GCCTTCtaacatttcttttttcagaaaaaagtcaCTTGTACA
Run BLAST on NCBI

protein sequence of TCONS_00000399-protein

>TCONS_00000399-protein ID=TCONS_00000399-protein|Name=TCONS_00000399-protein|organism=Clytia hemisphaerica|type=polypeptide|length=975bp
MTSGVIESLSTLSLETNTEDTETSLADTNTIHGSLDGDTSTEGSISPDLL
ITNEVSQPLHQPTGHSAAAVASLNANAPAFTSISSMTPVLITKNIEIGNE
RWKPTATIVEENINSVPIHDLPQPYIAPDGLYYWPADMINGFPPQPVLIE
SLPNGTATVIQADHDSQQAFTQQNALVRPDIITQVSAPPPTPPINNVVIP
PSTKDLTPDELKRSIQNQFEYYFSRENLANDQYLNSQMDSDQYVPISTVA
KFNQVRKLTSDIDLIVDALRESPYVQLDETEQKVRANMKRCIVILREIPE
VTPIEDVKALFASPNCPKWTSFEYAYNDNWYVTFECEDDAKKAYRYLREE
VQSFQGRPLMARIKAKTLLSRTVYLPKNAASATGSTTTNTSPPADNVTSQ
FSTTGGVPAFTVSHPQQIFSPNFQPFYNTAPVNGNPGILPAGAQWISTTT
RFIPPEIRPKNNYNKYNNYQGNKQLNGQRPYFPGSKPRFRNNYNNPNKVP
FHERNGNVDYNSEDRPSNVPTNRRNNNPSGHNHQNVHNTNVNSNYRGRNS
EDPRFVRHSGPRKDWNRNSSEEGPRFQRLRERRGKDDTGGSSSTSSTKDE
KMSSHSKNPSSKHDKSSISSNEGSEDSSNAPQINGDLNLDLALDFPALPS
PNSPNETGSNGSANRSASSLKELAANVLSEVESNKEKPMTTSPADMSELL
TTAEVFEPAATEPAQTTTTNANENAPLITTVVSTDNGIPKMLSYAQMAQK
PNSNKENFVNDIDTAKDISDAVAASDPKKSSNNKTENGKNGQSANGKQNR
KPGSKNSPRSQRRKSNGQDKSAEVEQMSVSSNLTNTVMKETYASKFGSSS
DSSRTGNSPSRPKTQPTTNTNSINKQNPPSTNNKNNSGLPALRPLMSQVI
NPPVSKMDEINGLELQQQQPISFSDTVKKQSSIEPSTPTSPRSIDLNSVS
SPPSSNTVSQPPETSSTIEAPKEKS
Run BLAST on NCBI

transcript from alignment at sc0000002:63815..100958+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000399 ID=TCONS_00000399|Name=TCONS_00000399|organism=Clytia hemisphaerica|type=transcript|length=37144bp|location=Sequence derived from alignment at sc0000002:63815..100958+ (Clytia hemisphaerica)
GTCAAATTAAGATAAGCAGTCTGTAAATCGTAATAATATCGGCAAAATCA AACTTTTACCCTGGATTATTGAAAAGTTGATTTGAGAGCAGTTCATTCTA CAGCTTTTATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTG GAAACAAACACAGAAGATACAGAGACATCGTTAGCTGACACAAATACAAT TCATGGTTCACTGGTAAGCTATTTCTTACTTTTCTTCTTATCTTTATTTT CTTCCTTTATAATGAATAATTCTAGATTTCAGCCCACCACATGGTAAGCC AAGCCATATTTAGTATGGTAGGGCAGCTTTTTATAGTCTTTTTCCACTAA TAAAAGctatttttacagtttttaccaaaaattgTAGTGATTTTTGGAAG GGCAGTGTCTGATAACTGGACTCTAAAAGGGCTTGAAATATGACCTGTAA TCCTCAGGTGAAAAAATCTGAACATCATATCATGTTTAATTTGATACTTA GTAAGTCATATATAACcttcctttttggacctaccttggaggtcctgtGA ATTGACCCACGTTCGTCTGTTCACGTGTTCGTTCATTCTTTCGTCAGtta ccttaaccctattcggcctaggggggggggctgtttctgttctgAGGTCA AATTATCAGTAATAGcacctgaaataatagagcttttgccatgaaacttt ctgtaaattcctaacttttatttagcttcaaaataaaaaaaaatttgaca cctaaaaattttcacaccttgagcatgatgacatttctgacagtggGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNGCCTTTGTtaaaatacaatagct atttataagaacaaaggaaattttaggtttttgctcactttgggcataat gagtgacgtcatcaaaaaaaaaatttatcaaaagttaccttatgtgccaa atttcattcaaaaagaccaactagatcaaaagttaaggggtggtacagga aaagccccccctaggtttgaaccgcccctaaaagcctaggttgaataggg ttaagtgtATATATTTTGGTGGGTACTAAATTCTTGTGTGTActcaattt ttgcaagtttATAGGATAAAtctcataaaatttagtactgtttaaatttt tcaaaatatacatatacaaaatcacgaaattaaatacacgcaaaaaaatt tcaaaatacgcTGAAAATGAGGAAACTTTATTTTACATTGttttcgcggg cagaaagtttcgcgagaccgaaaagtcgcgaaatttcgcaGATTtaattt tcgcaatttttactttttgaagaaaatttacggaagaaactttcgctgtt ttttgtgaatgttcaattttagtagcaataactttcgcgagaggctaggg aaagtgaataaaaaattaattcaaatctcatttttttcttcaatcttaaG AGTGATATGCTAATAAATGAAAGATAAACTATTTTGCTCTTCTTCCTCTC ATTCCGAATCCTAGTCACTGCGATAATATCGATAATATCGACTCCCCTcg gcttttaaaatttcatttttcgcgaatttcttgtttcatttcttacctgg cagaaacttttgcgaaaaaatgccaaaaacacgaaaaacgcgaaagtttc tgcccgcgaaagtttctgcccttttAAAAAGCTGCTAAAAGTAATCATGA AATATTGTACTTGCGAAACACGAAAAAAATTGCGATTTGCGAAAATTTAG TGCCCATGAAAATATCATACACTTAACTtgactttttgcacaatgatgta aaaggGTAATGTTTGAAATCTGATAGGGCCTGATTtttgaaagaacaatt ttttgggcaaatttaggccaaaaagtgcctaaaaataggctcttttggtt ttggtttttttcctCTATTTTTTCCAGAAAGATCGAGAGAAAGGCAGGTT TTTTCCAGAAAATcgcattttcttattttgggaAATgcccttttgtcatt tttagggaaaataagCATTTCTCGTAATTGCCTTggaattttttctgatt ttttgcgcaATGATGATGTGAAActgtaatgtttaaaaatcgatggagtc aaattttcgaaaaataaatattttggggaaatttgggccaaatagtgcct ggaaatatttttttgaaattgctttatagtttttttctaagttttgaatt taTACAGAGGGAAAGGTTCTCTAGAAGGTGAATGAAGCCATTTTTcccag aaaaatctttttgaccatgaaatcagatttttgtatttggggaaattccc ttctATCATCAATTTTAGGGGAAATCAGGGGAAATAAGCATTTCTCCCGA TTTGGATTGATatttttgtctgattttttTACTATTGTTGCTATTTTGTT CCTATtttcttattacatcaatcttcaggaaGGTCCATTTAGCATGTAAC TTGTTCTGATCAAGTTAAAGtgtttttctttagttctgttTTCTTTAATA GAAAATTTCTGCcccaatttcattttcttttcttttttcttaagtCTTAG AAAACATATTAAGGGCTCTTTTTATGCTTGttaaaaatagctttaaataG TTCATTAGAGACAAAGTTATCGTTTTAAAGTAAGTGGTCTTGTTCCATGA AAGTGGTCTAAACAATTTTACAGAGGTATAAAGTCAAATAAAGTCATTTT AACCATTAGAAGTCTAAAACGTTCATAACACAGTTGTTATGAACGTTTTA GACTTCTAATGGTTAAAATGACTTTATTTCTTTGCAATAAATACTGATGC TGTTCATAATTGTGAGattgtgatttttcaaaaatcatttgataaaaaag tcaATCCAATCTACACAACGTTGTCTCCTATATTGGTACTAAAGAGCTTC ATGTTTTATTTGGTGAAAGTAGTTTAATATGGGGATTTTTGTTACAACCA TTTGgcatttaaatattttgaaatactgaAATCTCGTTCNatttcttacc tggcagaaacttttgcgaaaaaatgccaaaaacacgaaaaacgcgaaagt ttctgcccgcgaaagtttctgcccttttAAAAAGCTGCTAAAAGTAATCA TGAAATATTGTACTTGCGAAACACGAAAAAAATTGCGATTTGCGAAAATT TAGTGCCCATGAAAATATCATACACTTAACTtgactttttgcacaatgat gtaaaaggGTAATGTTTGAAATCTGATAGGGCCTGATTtttgaaagaaca attttttgggcaaatttaggccaaaaagtgcctaaaaataggctcttttg gttttggttttggttttggtttttttcctCTATTTTTTCCAGAAAGATCG AGAGAAAGGCAggtttttttcagaaaatcgcattttcttattttgggaAA TgcccttttgtcatttttagggaaaataagCATTTCTCGTAATTGCCTTg gaattttttctgattttttgcgcaATGATGATGTGAAActgtaatgttta aaaatcgatggagtcaaattttcgaaaaataaatattttggggaaatttg ggccaaatagtgcctggaaatatttttttgaaattgctttatagtttttt tctaagttttgaatttaTACAGAGGGAAAGGTTCTCTAGAAGGTGAATGA AGCCATTTTTcccagaaaaatctttttgaccatgaaatcagatttttgta tttggggaaattcccttctATCATCAATTTTAGGGGAAATCAGGGGAAAT AAGCATTTCTCCCGATTTGGATTGATatttttgtctgattttttTACTAT TGTTGCTATTTTGTTCCTATtttcttattacatcaatcttcaggaaGGTC CATTTAGCATGTAACTTGTTCTGATCAAGTTAAAGtgtttttctttagtt ctgttTTCTTTAATAGAAAATTTCTGCcccaatttcattttcttttcttt tttcttaagtCTTAGAAAACATATTAAGGGCTCTTTTTATGCTTGttaaa aatagctttaaataGTTCATTAGAGACAAAGTTATCGTTTTAAAGTAAGT GGTCTTGTTCCATGAAAGTGGTCTAAACAATTTTACAGAGGTATAAAGTC AAATAAAGTCATTTTAACCATTAGAAGTCTAAAACGTTCATAACACAGTT GTTATGAACGTTTTAGACTTCTAATGGTTAAAATGACTTTATTTCTTTGC AATAAATACTGATGCTGTTCATAATTGTGAGattgtgatttttcaaaaat catttgataaaaaagtcattCCAATCTACACAACGTTGTCTCCTATATTG GTACTAAAGAGCTTCATGTTTTATTTGGTGAAAGTGGTTTAATATGGGGA TTTTTGTTACAACCATTTGgcatttaaatattttgaaatactgaAATCTC GTTCAAATGTTCTTTTGTCACCACTCAGTACCTTTTTACCTTAAAATATC AACATTATgctcttttcttttaaagatcAATCTTATGAGACAATTTTACG GCGATAAAATAAGTACTAATGATTTGTGTATAATAACGCTTATTctaaaa ttgatgatttttaagCCTATGAAGGGTTAAGTTAGTATATAATTGGTCAT AAAACccaaaaaaactcaattttgctataaaaataaGAAGAGGATAGGAA TAGCTTTATGCTGACAATGCCATGACAAATAAGAACAGCTCGGCCATACT AAACCATCTTTTGGTAAAGCTAGAGGCTAGAGGCtaaataaaatgaattt aatAAAAACGATTCATGCCATCAAGCTGAGTggtgtaaaaaaaacaaaaa atattcgaAACGAACGAATATTGTGCAGCAAAAAATGGTATGTCTCGTTC GCTGTGTTTACAGAACGTTCGATTTGTTTATGAGCTCgttcgagaaaaaa atctctttcTCTCTTTTCTTCACTGCACATCATTTTTGAACATGGTAAAA TCAACTTTAGTTTAACTAACACGTGTTCCAAACAGTAAACATTGAAAACT GTTCCCTTGGTTCCTCTAAACATGAAAATTCTTGCTTTCCTATCAGAAAA TCtcctgttttttttcttcagttttctttttagttttcagtctttttttt ttcattataccGATCAAGAGACCAACAGTAAACAAAAACTCTGTTTCCAA GCATTGTTGAATGTAGCATTTTTTCTTAACCGTCGTAGTTTTTTTGAAGT ATGTTGTAAAGTTTATTACAAATAATTGTTTCGCCGTCGCGCTTTTTTTA ACGACAAATTGACTAATTGAAGAATGAAGAATTCCTATACtaatatgttt tgatttatatttcaaaaaaggattttttaattttctggaAATTAACAGAC TGTTGCTGATAAGTGTAAGTGGTTGTAGAAATACAATTCCCCTGGCAATT TGTGTGACTGGTCAATTCCATTCGAGAAAAATgtgttgacaaaaaaaaaa gaaaaattttatttgtgaACGGTTGGTTGCCATTAATATAAATCGAAttc atttgttgttgtttttgcaCACTGGTATATTTTACGGcgctaaaattttt attaaaagaattgaGCAAAAATGACGATGGTAGTTCAACTCAATGTTAGT AGCgaagaaatattttctctcAAACGTAAACATGAACCTTCAAGCTCCAC CGTAAGAtattgattattttgattttatttttcagtttcgTCCTGAAAAT TCTTTCTAAATTTGATTAAATGTGTTTTTTAACGACCTAGGAAACGTTAA TACTTTCTTTACTATGATTCTTCACCTNTCAATGTGTTTTTTAACGACGT TTCCTATACATTAATACTTTCGTTACTATGATTCCTCACCTAATGTTAAT CTTCCTTAACTACAAAACCTGTGGGAAAACTTTGTTTCGTGTAGCTGCCA CACACAGCATAAACTATTCTACTACATCGTAACTTCCGGGTTTCTTGAAT TTCAGATTTTGATCAAACTGCTCCtctttcatttcaaattattcCAATGA TCTTTGTGCTGCACTCGAATCTTATTTCGAAccttaatttaaatttaatc TCATGATTTATGTTTTTCAATGAATATCTAGATTTAGTGCGATTAGATCA CGCGAGTGAAGTCTATTGCTTGTTGCAATAAGGCTCTAATTTCCATTTTG AAGGGTTTTataacagggggggggtcagtactaaaatgtaagacatacat gagtactaaaaggatttttgctaatttttgacatacccccacctattttt cgaaaatgttattttagtaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaaaatggggtcattgt tacaaacctagtcgaatttagtgcatcaatctgcaaaataatataatttt attactaaactgtgctgaactgtacataaagataattttagaaaatattt aaaaaattggaaaaattctgaaagatttctgaaggtttttttgaaaattc ctgaaaaaaaaaatcaaattttttccaaaattgttaaaaaaatgctccat tttggctgattttagaacaaaatactaagatttttNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNccccc ccccctgtttataaaggttttgtttttaaataagagtgatattgtaATTT CAAGCTtcttgatattgaattgacacggatgtggagcaagattggtccga aagaggaaaagaaaaacattttttgcttatatcagcacaatcaggcacaa tataacaataggcagacactgtcctaatatgaaacatgtgtctgatatga aacgggaatactaatgaaaaaatgaaacctTTACAAGGAACTTCGACATA TGGAACTTTCAGGAATGAAATAAGCCACATTAAGCAAGAGGAAATATTgt gaaaataaatacaaaatacaaaGATTGCTAAATGAAATGGTCTATAAAAC TACCAGAATCGAAAGTTTTGATTCCATGGAAGTTCCATTAAATACACGCT TGTTGTTAATATGATCATGAAACTGAAAGTTCTAGAACATAGTTTTTAAA GGACTATTCGAGGCTCACATTTCAGAAATTACCAAGAAAATACTAAGCCT TCAGATGAAAGTAAACCTATTTAAAACATCTTAAGAACAACTTAAAAGGA AGTGAGTTTACTTGTgttcttattgaaaattttgtataattttttattag agAAATCATCATCATGTTTCTATCGTGTGTGGGCGTGTAAGCATGTAAGG ATAATGAATGGGGGTGGTAAAGAGGTTGAGCGTGTAGTAATTTTCCATCG AAACAGTAGGCACATACATTACATATTTTATAATTAACAACATCCTAGGT ATTAAACGTTATTTCTATTTATTAAGAAATTCTTATATCAGTAAAACCAA TGTGTCTTGACTGCTTGAAAAATCTCTCTCGTGATCAAAGGATGTGATTG CTCCTGTTATGCGCCTGTTGTCCCTCTTCGGACGCTTAGATGTCTTAGAT GTATTTTGAAGGTTTCATACATTTCGagaattaatatttttattacctta gCTTTACTTTGTTTTTATGGTTGCCTTGACAGATTTGGAGATGAAATGAT ATATGCAGTGCAGTGAGCTCTCTTATAAACTTTACTTGACGGGCTAATTC TATTTTGTACAGTCTTCGTAGTATAGTTTGTAGAAGTTTATGTGTATTAT GACAAGCAAACCAGACAAcgttttaccattttgtgaccgTGGTTGGCTTC ACCTTTCAACGGGAGCTACTAAGGAGATACCAACGCAGTTAGTTTGAAGT TCGTTGGGAAGctaagagaaaaataaataaaaatttcttttgcatcTAGG AACGCGATAGCAGTATGTCGCACCTTATTTTTTCTAACCATCGCGAGCGA CACATAAAACCCCATAAAAGGGGCTTTTCAAACTCGGGCTCAAAAAGGGG ATTCCCAGGGATTCCTGGTATGTGACTTAGTTTGTTTTGTCACGTTTTCG GCAGTTGAGATTGATTATCATCAACACAACATATTTTGATAAAGCTTGGC CTTTTTTCTTAAGTTGTAGAAGCTATTGTCAAATACCAAATTATAGGTGG GTTAAAGGGCTGGTAAACTgcttatgaaaataattttactaTTTATTATT CCCCAGGATTATTACACAAAGTTTCTCAGTTCTGCCGTTGATCTTGCTTG AAGTTTGTGCTGATGCGCTGGCGTAACCATCCTATTGATCGTGAAGATAA ATTCTTGATAAATGTTCCTTGATTCTGAAAGCGGAAGAGATTTGATCTAT ATCAATGTTGTTGAATCTACAAAATAGAAACCGCCTTGAGAACTTTTGGG CATCCTAGCGTATCTCGTATAGTATGTTTACTGAGAATCGATAGTAAACG TGTATGTTGTATCTTTGTTTGTTATCCTGACTGGACAATATAATGTACTG ACGGTGGGCACGCAAACACGTACGTTTCACAACATTATCTCCGTGCGTAA AAGCATGCCGTAGGTGCCGGACCCCTATCATTGGAATGCAATTCTCCCTT CAAGCATTTCatatacaaacaaaatgatTTTGAGGGTGAGCTAGAGCGAT ATTCACCATTATGACGATCGCTTCATAAATTCATACGTCTAGTCGCCATT TCTATTTCTTTGATTGTTTTCTTTATTAGTGCGAAAAATATGTATGTTTC CCCCTTCGTCTATAGTGTCTAGTAGTTTGTCCCTGTTTGGTGTTTGTTTT TGaatatgatttcttcttttttggatAAAGTAGGTAGAAGTAGAAAACAT ACTTCGGATTGGGttacaataaatttttttatagaaactagtaaattttt gctgaaccTCAACTTTTTTTCGTGAATTTTAGGCTGAGTTGCTTTTTAGA AATGTTCCTGAATTTATCGAATACCTAGCAAAAGAGCAGCATATTGGTTA GCAATGTTTGAAAGTTGAGTCAATAACTGTTCTGACATTGTTTTTGTGTT TGAGCAAAATCGAGCCTCGTGATCTTATAAAATTGTATTCATATAAAAAA CATTATCAGACTTGTGAAAACCTGGTGATTATGACTAGTTGAAGGGAGGG AGGGAGAGAAACCGTGAAAAACAAAACCGACGGAAAttctcagaaatttt caaaaacaacgaGAAAGGAGCGAACATTGAAAACAAAACACAGTTTTTTT GTCACTAGATTGTTACCAAACGTACGTTTGTCGTGGGCtgcttttttata gaaaaagtgtgatgaaaaaaaaagggaaaaaaataaagaattctaaaaat agtaTGTATCCGCCGACGACTAACATTGCGAAAAAAAATCCCGAATAAAT ATTAGAAGGAAATAGAAAGAATAAGAAAGAAACCGAGAAAAGTTGAAGCA GAGGCGtttcgaagaagaagaaatttcaattttcatcaaTTGCCAATGTT TATCATTTCTTccttattgttattatttttttctacgATTGTTCCTTTGT TGTCcgaaaaaatctcttttgttttgctttatAATAATTTGACGAACAAT GGACAGAATTTATCAAATATTTACTAACATCAATACAGATGTGTTAACGA ATActacaaaagaaacaaaaaaaaggaagaggttttaaaaataaaatagg aagaaaaatgaagaagaagaaaaatgaattcTTCGGTAGCGATGATGGTA GGCGATAAAGAAACGACGAATTTCTTCGGACTAAGTTTAAGTTTTCGGTT ACGGACGGTAGTCGTTCTTATACAGCGAGAGTCAACAGTTATGGCAGTTC AAGTTCTCACATAGAAGAAGGGAGATAAAACTGCgctaaaaataaagaag aaattatagccagggagaaagagtgaaAGACAGTGGGGAGAAAAGgaata gagaatttgaaaaaactcaaaacaaaaaataaaacataagtttttattct ttcataCTGGACCAAAAAAGAAGaaccatgaaaatgaaaatctatttctc tttctcttcttattctttttttttatatccaTTTTTTATTCTGTTCGAGT CGTACTGTTTCGTATTAAGATACTGGTCTGGGTCTAGTATGTCTAGCTGG ATTTGTGTTGTATCTCTCTTCCCTTCTACAGTACAGAGGGGGAGATGGTG AGGAAAGGAGAGAGATGTTTTCACTGTTATTTTTTCGttgtttttaaaaa ctattTCTTGAGACCAGGCATGTTTTCCTAGTAAGCATAAAAAGTAAGAC TTTCGAAATTCTTTGAACTAGTTATCCTCTAATTACATTACAAATCCTTC AATCTAGACTAGATCACCAcattatttctcattttttgaattAGTTGTAC CAATAACATATTATTCTTATAGTATAATTTACGTATAATGTTTTGGAAAA GCAAGTGTGAACTACAGTAGTTTTGAAGACCATCACTCTTGAGGAGAGAT TTTTTAGAGATAtagaattttcttttcaatgttgttctttaaattTTCGT TCAGACTAGGTTATGTTATGATCAACAATACATACATATTTAAAATCCAG TCTAAAAACCAGGAACAAGGAAATGTATTAGATGTAAAAAGTAGATTCTG TTAGATTAAATTATTGTTTTATGAGTGGATTGATTCACTTTTTTCAACTT AATTTTTCATGTTCTTGCCCTGTCTTGCCAGACTGAAAGCTATGAAAAAG AATCAGCTTTTCAAGAGTGGTTGGAGTTTatgtcttttcatttttgaagt ccTGTTTTACCGAGTTTAACATTTCAGTAACATTTGGATGTTGTTCAAAG TTGTTGTTATTGCCTGGGTTTAGCTGTGATTGGGACCAAAAAAATGATCG AAAGTGACAATCGCTTAATTTCCTGTTCTTAAGATGATGATTGACCGAGT CATGANctcaaaacaaaaaataaaacataagtttttattctttcataCTG GACCAAAAAAGAAGaaccatgaaaatgaaaatctatttctctttctcttc ttattctttttttttatatccaTTTTTTATTCTGTTCGAGTCGTACTGTT TCGTATTAAGATACTGGTCTGGGTCTAGTATGTCTAGCTGGATTTGTGTT GTATCTCTCTTCCCTTCTAGAGTACAGAGGGGGAGATGGCGAGGAAAGGG AGAGAGATGTTTCCACTGTTATTTTTtcgttgtttttaaaaacaattttt tgagaCCAGGCATGTTTTCCTAGTAAGCATAAAAAGTAAGACTTTCGAAA TTCTTTGAACTAGTTATCCTCTAATTACATTTACAAATCCATCAATCTAG ACTAGATCACCAcattatttctcattttttgagtTAGTTGTACTTCCACT AACATATTATTCTTATAGTATAATTTACGTATAATGTTTTGGAAAAGCAT GTGTGAACTACAGTAGTTTTGAAGACCATTCACTCTTGAGGAGAGATTTT TTAGAGATATAGAATTTTCTTTTCCATGTTGTTCTTTAAATTTTCGTTCA GACTAGGTTATGTTATGATCAACAATATATACAGATTTAAAATCCAGTCT AAAAACCAGGAACTAGGAAATGTATTAGATGTAAAAAGTAGATTCTGTTA GATTAAATTATTGTTTTATGAGTGGATTGATTCACTTTTTTCAACTTAAT TTTTCATGTTCTTGCCCTGTCTTGCCAGACTGAAAGCTATGAAAAAGAAT CAGCTTTTCAAGAGTGGTTGGGGTTTatgtcttttcatttttgaagtccT GTTTTACCGATTTTAACATTTCAGTAACATTTGGATGTAGTTCAAAGTTG TTGTTATTGCCTGGGTTTAGATGTGATTGGGACCAAAAAAATGATCGAAA GTGACAATCGCTTAATTTCGTGTTCTTAAGATGATGATTGACCGAGTCAT GAAATACCATAATTCATGATaagcaccattgcaatgtcttccacggaccc aacaactGATGATTGGTTGagagtgacgtattgactgattttacgtcact tacaaccaatcagctattaggtccatgatgtaatgtcagaagacattgcg atggtgcatatcatgaatagaacaCCATAGAATATGATAAGATCTGGATT TGGGAGACTTTTTCTCagtaaattcttttttaaagggGTTGCACAGATTA TTTTGTTCAGTTGTAGTTGCAACTTAATCTTAAATCTGAAACCACTATTA GTTGGTTATATTAAGGTTTTTATTAATCTTTATATTTAGGAAAAACAGAA AAGCCTCTATATTTGTCATTGTGACTCTTTTTTTTCCGAGACATAAAATC ATCTCTCGTGTATTGATTTAAACCGATACATTTGGTGGATTCTTTAAGGA TGGTCGTTGGTCATGCATGATTTCTAAAGCAATATGTTGTTGGGGAATTT AATCCAAATGTTGTATTTGTAACTTATCTTGactttttttggttttgatg gtttttgcttttttcgttTGGATAATCATTTTTATATCTTCCACAAAAAA GCCTTGGATATAAAGCCAAAAGTAGATTTTTGAGTCATATTATACTTCTA AACATGGTGTATCCAATGCGACGAGTGTTCCACGTCAAAGTCTGGTTGAC TGAAGTCAGCTCTGACGATGAAGATGAACCAGAACGTATTGTGATCTGTA GAACGCCCAGCCCTCGATATTCACCTGATCTCCACGCCCTTCACCACCCA CCGCCCAACATCATAAAAACAGAGTTCAATAATATACTTTCCAATAATCT AAaacctgattttcaaaatatgcaTACGACTCACTTGAAAAACGACTTCA ATACAATGCCACATCATACAGCTCCACACAATACTACAAACATGTTAAAA ACCAACTATTACAGTAGTGATTTACCAGACAAGAGGGGTTTGAATGGAAT TGTAAATCGCCATAGTTATAATAGTGGTGTTGGACACAACAGAAAATATC TTGAAGTGAATAACAATGTCCCTTCTGAATGTGATTCCAGTGAAGGTTAT GAGACTTTCGATGAAATGTCTTCTCATCTCGGCTACGTAAGTGTTAGGGG CTGTTCACATGGAGGTGGGCCTCGGATAGATTTTCGAACGTCACGTGATC TATTTTTATCCATTTGACTCATCGTCAAAAACTGTGACgtaacgttcgaa aatctatcCCATCTCACATGGGGCAGCCCGCCTCCATATTAACAACCCCT TAGTTATTTTTGGTTCTCTTCGTTTGTTATTACCATTTAGTTTCTTACTT ACAGACAAGCAGGTATAGACATGTAGGACATATAGACATGTCTATTAAAG TTTCATTAGCACAAGGGATGCTCTGATTTAAGAATAGACAAGATTACGAA CTATAGGGTTGATTTGATTGCTGGCTTGccggaaattttaaatttgaaag gTTTTTGGTATTGGGTGTGTCAGCGATGACAGAAAATTGTACAACTGCAG TACAGCAAGTTAtgctaatttttcttttctttccacTGTTTTGTTCCTAT Cgaaagtttttcaaatcttagaaaataatatttttcctttaatttttttt ctgaccaTAATCAAAGAGAGGaacatatttttcttaaagTGCATCAGATG TTCTTTCTTCATCTTCCCTTATAATATTATCCTAATGCCAAGACAAacga tttttttttccttcGTATTAGCTTGTTTGATTACTTTCTTtactttcata atttttttcacgttctcgtttttcttcttcttcttttttagttTACTTCT CTCGTTTTAGATATCTGTCTTCACAAGACCACTATTTGTTTGTGTCTATG TGTTGATGACTCATTGAGGctcaaagtgaaatttttgtcatttgCAATTC CGTGTTTTATCTTTATGTCTGACTGACCgtcttgaaaaagtttttttgaa acagCAAAAATTCCGTATAATTTTCTAGTAAATCTTTTGTTAGTTTGTGA ACGATATCTTTTCACTTTGATACATATTTGCGTCAGTTCGGCCACATTTT CATAAAGGTAtaccaattttaaaacaaaaagcaaCATCTCTATATCCGTG CGTGAATTTATTCCGGACTTATGGAGACAGAATCTGTCTTCTTTTATATT ACTTGAAAACGAAACCATAACAGAGAAACATCTTCTTTAAATGGCAACAA TGTTTTTTGTGTTTGGAAGTTATCAATATATCTAAtctaattttgattat ttcatcTAATGTGCCCCTGaaacacttttaaaaactaGAGGGAAAATCTC GCGGTACGGCGCATGACGTCACCTCGAAAGTATCCTCTATGCGTTACAAG gggtaaaaaatattcaaaaatagaaTATACGATCTAAAATCGGATATATC TCTTCTCTTTTGTTCTGCTTATCATATCAAAGGACTAGGAAAAGGGCAAA TTTCCCCTTTTTGGGTTTGTTGTTTCCTAATAGTGTTTAAAGGCTCAAAG CTCTTCTTTCCATCCTTTCCGTCTCGAAGTTCACCGAATCCAGGGCGAAT TTGATGTGTGAAATCAACGGCAAAATTAATTCTTTATCTGAAATGAAAGG TGTACTTTTGAATACTGTTTTGTTTGCAATTCAGAAGAAGTGCATTCCTT TTCCTCTTGCTCATCCTTCTATTGTATATCACAGGGGTCTTATTTAGACC CGGCGCAGAGCAAATTTCGCCGTTGTAAGGCACGAAGAATAACAATTCAC TGGGTTAAAATTCTGTTCGCCGCCCCACGCACATAATCAATACACTGGGT TTGCTAAGAATTCTCCGGTATAAAATCTAGaattgttaatttttcattcg ccagcctATCAGAAACAAAGCAAACCCCCTGATCATATTCCGATGACGGT ACCTGGACTCACTTGTAAAGATAAATTGGGGCGAATGTTTCTTTGATAAC GGCTCAAACATCTTCTTTAATAATGTTCACCGGAAAGTCCCAAAAGACTT AAATTAGGAAGTAGCTTTAAAGAAAAATCGAAACTTTGATTGATTGCTCA GGATTGCTCATGATTTCTGAGAGGTCCCTTTTTTGATCGGTTTAGAAGAA AAGGTTGGCCActaaaattttgatcaaatgaaactttttttttgaaatga ttcCTTTAATCTTTATAAAAATTAGAGAGCCTCATTTGAAAGATTTCCCA CTTGTTAGGTTCCCCTTTTTGCGCTTGTTTCTGTCCTAGCCACTAatata tttatttgtttttaatattcATATATATACAAAGTTGATTTGAAAGAAAC TTTAAGGGAAAgggaagaaaaacatttttgatatGAGGCGACTAATATAT CTGTAAATTTGTGTCTAATTTCCTCCCACGTTAATATATACTGTTGAAGA GGAAGCTTGTGATCAACTTCCTATTTTTAAAGTACCATTCTGAGTATAct gttttttgtaagaactagtGAACTTTCATTGAGGCTCGGGTGTTCTCAaa tcgttcgttcgtccgtttaccagcttttctcgggattggcccattatctt tttcttatttcttgCAAAATGACAGTACTAAAAAAGtcacagagcccgat tttcgagaaaaaaaattgtgcaaaaaaatttgtCTAATTTCCTCCCACGT TACTATATACTGTTGAAGAGGAAGCTTGTGATCAACTTCCTATTTAAAGT ACCACTCTAAGTATActgttttttgtaagaactagtGAACTTTCATTGAG GCTCGGGTGTTCTCaaatcgttcgttcgttcgtccgtccgtttaccagct tttctcgggattggcccattatttttttcttatttcttgcAAAATGACAG TACCAGAAAAGtcacagagcccgattttcgagaaaaaaaattgtgctCCC ACGTTACTATATACTGTTGAAGAGGAAGCTTGTGATcaactttctatttt taaagtacCATTCTGAGTATActgttttttgtaagaactagtGAACTTTC GTTGAGTCTCGGGTgttctcaaattgttcttatacttTTTGTAAGGCCGA AATTGAGCAATTTTATACTTTAtatgctttttttttaatttgacgtTCAG GATTGCtgttaatttttcttattttttgaattgtttcagcctcattgttc ttataaaattgttctaacAAAAAAGTGTGTActatttcgatttttaaaaa ttccgtcCTGAATCTGAAACTACGCGGTGGGATCGTCTTCTACACGTCGA TTTCACTAAGGCTAGGAtgaaaggtgattttttttattacctTGTAGCAC CAAACTTAGCCGAGTTTTCTTCTCCAAAGCTTTAGACATCTAGCACTGAT GCAGCTTAAATATATTCCTCATTCTGTCATCCTGTATTGAACCGATGCTc taaaagaaaacacaaaacaTTCATTAAAAGATATACTACCCTAGATCCGG ATGAAAAATTCATCTATTAGTAAAATTGAAAGTTGATTTTCAAACATGAA ATTCAAATTGAAGAACTGTCATTGAAACagattgaaacattttgttAACA ATAAATATTGTCTGCCGACCATTGTTCACTCGTTGAGCATTGTAAATTTG TAGTAGCTTTTACTTGAACACGGTTCTAAACATTCGCTATGCGCTATCAA AACATTGATCAGACATGGCCTGTGGTTTCTTGCGAAGAATTGAAGCGAAG GTTTACAAAATTATTAATAGAAGTGCGATGTTCGATCAAAATCATCATAC GTAATAGAAGTACGGTGTTcgatcaaaatcttcaaattttccattctgga atttaATTGTAAGATTAAGTTTGTTCTTGCCTACTATGTTTTAAATCTAT TGCTTTTgtttttgtcaatctttcgccTGATTTTCACTCCGGTCGGTTCA GTCATTCCTGCAGACAGGATTAAGAAGCAAATAGGAGGATTTCTAAAAGC TCTTTGAGAATAGACGACGAGATGAGAAAAGGGTAGTCCAAATTTAACGA TTCGAAATTTCCCGATTCTAGGACATTAGTTAGAGGTATGTAGTATGCTA TCATATGATATCAggtggaaatttaaaaaaaattattctatgACCATGTG CAAAATTTGATAACTTTAAAGTAAGCTTTATTTTACAAGTTAACAAACAT TACTTGATAGAAACATTGTTATACCAAATTAGCTTGaatcgtcaattttt ttctggtttcaagTAATTCTGGTAAATTTGCATTAGcccatttataaaat ataaataatcaTGATAGAACTTCTTACGCAATGGAAAAGTCTGAGTTGTT NatttataaaatataaataatcaTGATAGAACTTCTTACGCAATGGAAAA GTCTGAGTTGTTTTATACAGGAATTACGTCAGTAACGCGAACTTTGTGAA TTTTCCAGAGAATCGCAATGACGAATATTTTGATCGTCCTTTAATTctaa tacagttgacgctcgcTACGAATAGTAGAGCgccgtttatgagagtttct caTTGACGATggatttcaatattatcgaataatggagcgtatcaaatagt agaagGTCGATAAACTCGATTAACTAATACTTTTGATTTCTTGTTTTAGG ATGGGGATACATCGACGGAAGGTTCCATTTCACCTGATCTATTGATCACC AACGAAGTTTCTCAACCACTTCACCAACCAACGGGTCACTCTGCAGCTGC TGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCACCTCAATAAGGTATG TGGTTTTTGTATGTttcaattcttgatattttgagaCGGGAAACGGGAaa tcttttttgtgaaaatctggtacggcggCCACTGCACCTGCCGTACCCGG TGCGTCGTGTCTAGGAACTGGGTACTGCAATAGCTTCTCGCGAGCTGTGG ATAGAGTTGTTTTTTGTTCCCTTCGGACCTAGATCAAAGGATGATGATGA TGATGGTTTGCTGCTGATTTTATCTACATGTTTACTTATAATGGGCTCTT CCAGAAAATCGTTCATAGGGTTTCGAAGATATAATATCAATGGCATAAAT TTGAATATATCCAGGATTGATTAAATTATCCGGCGGGGGAATAAATTGAA ATCACCACTCCCCCCTTTGTTTCTGGAAGAGCCCAATCTGACCAATTCTA TTTAATTCTAATAGTATCCAAGGCTAATACTTGAATAATCATATGATTTG CGTCTGTATTTAGTCATTATTTGAAAAATTGTTTTACGTTTATTGAAGTG ACGTTTGATGTGAGAAATGACAACTGtgtttttcttataataaaatcaTA TGCTAGTTGATTTATAGTAGTTTTCCATCTCCTTGGCAACTTCAACTTTT AAAAGCTAATAAATCAGTTGGTGCTCCTCGTGTCGCGATTGAACGTAAAA ATGTGTTTAACAGAACTACgcgtttattttgtaagaacaaactttataag aacataaagcttgaTGGCCAGAATGTTAAGGACacggttaagaacatttg aggCTTCATGAACTCTTAAACACTCAAATTGCCCAAATATACTCACAAGA TGGCCAAATTAAGAACTCTTTAAGAATAACCctccaaggcttcaaaaatt tcggatgttcttataaaaacgtgtgcTCTTTGCAGGCGTTAAAAATTTAA GCCCTTTCCAAGTTGGTGTTTTTGAAGTTGTTTTAGAAATTGTCTATTTT GTTCTAACAAAATATTGACCAAGTGTCTCAAGTCTCTAGTTTGATCTTTA AGGGGCTAGAGAAAGAGTATGCTTTTAATTTTAGGGGAGGGTGGTGGTAA AGATCCGAGTTCCAAAATCATTTATAGAGATATATACATGAGgaagtttc aaaaatcattATAGAGGTAAATATCTGAGGAAGTCGACAGTAGGTCTCat catttttttgcaattttggttGTTCATACTATTTCGACGTCTAATTTACA TAAAGATGTCGAATAATGCTTTTTGCTTATCAACAAGTATGATTTCTCGT TGTAGCATTTCCATTGTTTCTACTGTAAAAGGAAATTACCGTTGACATTA AATTTAGACGGATCCCTTCTGTTTACATTCATATCATTAATGACTTCTTT CACTCAAAAAGTAGGTTTTTTTAACGAGAACTCTGTCTGAATTACTTAGC TAGCTCTCCTCCCTCTTTGTATTTGTGCTGTAAAGAGGAATTTTAAACAG ACAACGTGTGCTAGCTGGCtgggttttgaaaaaatgaagtgtATTTCAAG TTATAAGATTACAGAATTGCCCCCTCTAAAGCCCCTGGTCGTGTTAGTCT ATTTTCAAATACTTCAAACAAACAATTGACCGGGCTATTCTGAGGCTCGT CAGATGATAAAAAAGGATTACGTCATTATCTTTGTTTCTAGATTTGGCAT GGATGTGTTGTGTCTGTATAATACACGGTCTGGCAGTATTCGGCtatttt taatgactgattacattttttttgttttcgtaCAGCTTAATAGAGAAAGA GAGGGTTTTTCTCTTGAACAGTATTCTCTGGTTGGTTGATGCTATTATGG TGGTggttttgcttttaaataaGCTTTTTTAAATTGCTTATTGAAGAgcg ttggaaatatttttgtatcagTAATAGTGTGGTGCGAACACGTTGTCAAT TTGATTTGGAAATGCGGTGGTGTTCAGCTTTTTCTGTGGATAGTGGAAGA GTTTTTTTAAGGAGTTTTTTAAGATGTTCTTTAAtagcattttttttttg agagattatattattttgaagaGTCCTTTGATATTTTCCATCTTATTTCA CGTAGATTTTTGTTGTTGGACAATCAAATTCATCGAATACAGTCTTTGTA GCGGTTAGCGCAAAAAACTGTCCGCATAATGAGAAATGTGCTCTATTTTC GTTCTAAAGAAAGTAATAGACTATTTCTCTCTGGATTGGAATAGCTGGAA TGTAGAGGATGAGAATTGTGTCCTTTATTTAAGAGCGTATTTTTATATCT GAGTCCTCGCTTACAATCAGTAGTCAACGATTGTGTTCGTTTCGCTTGTG ATTTTTCCCCAGAGTTTTGTTATTATTGTATATAGCTCTAGTGAAACATG TTCTCAGATCATCCCCTCTTAGAGacaagatattcttaacttaaGACTGT ATTTAAAACTAAActgagaaaagaaaaattagaaagtgaaaaaaaaagag ttcAGACTAGAAACTGTATTCGTTTCCCTACCTCTAGTGTCTCCTTTAAA ATTCACGTGTGTGACTAGCCCGTAATCTCTATAAtatactttaattttga tttgatgGGCTGTAACGGGATTATTTCCATTATAATACCTGGTAGAAATT CATACCTCTGATCAGATTATTTTTTATGGTGTAAGTTTTTACtctcttta taagaactagtaaAAGAATGTTTGAGACTCGTTTTAATGGCTTTTGACGT TGAATCCTTGAAGTCAGCTACTATTTTAGGACAgaattttaagcattttg tGCCTTTCAGTACATGATTAGTTTTTTAGTTTAACTATTTCAGGNGGGAT AGTggaatagagttttttaaggaGTTTTTTAAGATGTTCTTTAAtagcat tttttttttgagagattatattattttgaagaGTCCTTTGATATTTTCTA TCTTATTTCACGTAGATTTTTGTTGTTGGACAATCAAATTCATCGAATAC AGTCTTTGTAGCGGTTAGCGCAAAAAACTGTCCGCATAATGAGAAATGTG CTCTATTTTCGTTCTAAAGAAAGTAATAGACTATTTCTCTCTGGATTGGA ATAGCTGGAATGTAGAGGATGAGAATTGTGTCCTTTATTTAAGAGCGTAT TTTTATATCTGAGTCCTCGCTTACAATCAGTAGTCAACGATTGTGTTCGT TTCGCTTGTGATTTTTCCCCAGAGTTTTGTTATTATTGTATATAGCTCTA GTGAAACATGTTCTCAGATCATCCCCTCTTAGAGacaagatattcttaac ttaaGACTGTATTTAAAACTAAActgagaaaagaaaaattagaaagtgaa aaaaaaagagttcAGACTAGAAACTGTATTCGTTTCCCTACCTCTAGTGT CTCCTTTAAAATTCACGTGTGTGACTAGCCCGTAATCTctataatataat tttgatttgatGGNGACTTagtattgttcttaatttgtccttaggttttg gtcaattttcagcctcgtacTCTTAtaagattgttcttataagaaaagtg tGTTTTCCCGAGAAACAAGAGACTAGAACTGCGTTTTGACATTTTCTGAG GCTCGTGTTcatATTCTAATGAAATTTGCTTTTAATTACAAGAGCAGCAT tcgctcttttttataagaacaactttaAGAAAGAGAACAAAAGACTAAAA GTTTGTAGACTAAGAATAAGTTAGGAAGCAGTTGAGCTTTCATCAATTAC CTAGAAATTATTAAAGCCACTTTAGGCCCAATTTAGGCTCTGAAAAACGA AATTATAAGTACTTTGAGAATTTTTTATGTCTTCAgacttcgaaataaaa ataagaaaagccaAGCCTTAGCCGAAGTGTACTGTGACGTATTCTGAATT TAGAATTCTAATTGCTAAATCCAGTGGTCGGGTAGGATCGTTAAACTCTA ATTATATCGAGTTAACTTTTGTACTatatttccataactcgaatctTCAA TTAACAAGTTTTATTATAACCCTTGAACAATTCTCATTATATCGAACAAA TTTTCGTTTCCCTAGCGTGGTGGAGTTATAGAGTCTGgagctacacgctt ttttttttataagaatggtgtaaatccatttcatcatggatattcttaac ttttttgggaaaatcatcctaaaatattcttacagtattcttNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNtaaagtgtattcttataaaaaaaaa agcgtgtatcagtCTTGTCATGAGATACTAAAGCCGACTAAAGCCACGAG GTTTTGATTCAAAGAGAGAGAGAGGGGGAGAAAGAGAAACGTGTTCTGGA AGTATTGTATAGCTGAGGTCTTATagtgttatttttcaaaatagtaaTCA AACTGTCCCCCTTTTTTATGTAAGACAAAACTGTTGACAAACTTCAAACT GTGTTATGAAATggacaaagtaaaaaaaataatataacaaATTTGTTATT TTCTGTAACTTGAACTGTGTTTTCTATCGATTTTCGATTTAGTAGTCGTT CGTTGTCACATGGCCTAATGACAGTCAGTTTGTGTAGCATAGAAAACTTA CGTTGGTGTAATGAATGGTTTTGGTCCTAATTTTGAGTTCTTtttttgac aaacttttttttcaatgatgAAAACGATCAGGGGGACAGAGGAGGCGATT GTTATGATTATTCTAGATAAATTGGGTATTCTTAATTGATCTTAGTGTAT GTTGCGGGCAAAAATTGCTTTAAATGtttattgttatgttttcattggaa aaatgattaaatttaCAATTAATTTTCACAAGCATACCAGATCCTATTGA CATTTTATTATGGAACGCTTGTTTCGTTTTCCTTCtacaaatttttactt tgttaCAATATAAAATCTTGATTAGTGGTACAATGAGTTGATTTGTTGTA ATTAGTTCGGTCGTGACATTGAGAAAGATATTATAtggtttttttcttta aatactTTGTATTTGAATCAATGAGATAAGACTTTGTCCGATTGGCAAGA TATTTTCACTGATTGGTCTCATTCTTACTGCAGCAGAGGTCACTGAAGTG TAAGACATTCTTTAATGAAAAACGATCGCACGCCTAATTAACTTAACATG GTGATTTGAGTGGTGTGTGTCATATAGCTGAAACAACCAAGATTTATAAC ATTTATTTCAAGCGTAATGTGATTTTATTATTtccaatatttttgttatt tcagCTCAATGACTCCGGTCCTAATCaccaaaaacatagaaataggGAAT GAGCGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACATTAATTCGGT CCCGATTCACGACCTACCGCAACCGTACATTGCACCGGACGGTTTATATT ACTGGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGCTGATC GAAAGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCACGACAG CCAGCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATATAATAA CTCAAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTGTCATC CCGCCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCCATACA AAATCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGATCAAT ACTTGAACTCACAGATGGACAGCGATCAGTATGTACCGATCTCTACCGTT GCTAAATTCAATCAAGTAGGTCTCTTATTTCACATTTACACATAGGGTTT ATGCCgtacatttttttaattgagtCAGACGGTCAGacctttttgaaatt atttcatcCAGCAGCTGTCAAGTCAATAAGCTATTGGACATGAAAATTTA CTTCCAGAATAATATCTAAAACAATCATCTTCTGAAATAGTAGCTAAATG ATGAAGTTAACAATCTTCTTAAAGGCTTGCGGTGTATGTTATGTCTTTGA TTCTATAAATTTcctctttatttttgtttaggtTCGAAAATTAACTTCAG ANGATTCTATAAATCTtctctttatttttgtttaggtTCGAAAATTAACT TCAGATATTGATCTCATAGTGGACGCACTTCGAGGTATCTATTAGTACTT TTGTCGTGTGCATTTTTAAAGATGATGATTAGTTTATGGATAAtaccttt tgttttgattgttgcCATAACACAACGTCATCTTTATGGGCTTGGGTGAC TAATCAACATGCTGTTTTTGATACAGTGGAAtctttttaactcgaacttc tataagTCTCctgaacaagttttatggtacATATAAGCATCTTTATTTCT TATAAACTCTACTCCATATCTCGAACAAAGTTGCGCGTGctcgaattatg gagactccactgtatcatATAAACGTCACTCCCAGTAAAAGTGTTTTTAG TAATTTAAAGAAGAAACTCTTTTCAACTCTACTATTGAAGCTctacaatt aaaaaaatatttctttagtcAACGAAAATTCTTGTAGTGATTCAACCAtg tccattttctttatcttagAATCACCATACGTGCAGTTGGACGAAACCGA ACAGAAAGTGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAA TCCCAGAAGTCACACCCATCGAGGTAAGAAAGACCTTCTTTTGATACTGC TTCTCCTTGGCTGGAAACATGTCACTCTCCACTGCCGAAATCTCGAAAAA CTCAGCTCCTTGTTACTATTTCCCTCGTCCGTTTAGAAATATGGGGAATG TAAGTCTAGAGTTTTTAACTAGTCCAACCGAATGTCTTCTTAGTACTATT CTACTGTCTctcaggcgaaaataaaaaaaatatatagtgtttccggaaac tgGCCGGTTGAAAAATGCATTTTTCTGACCCgaccgcagactatgggttc atctatatggttcatcataaagaaaatcaagttaaccgtccaagctatca aacgttgtttggttagatattcccgcttgtaaattAAGTTTTGTTCgcta gtagttgatacattagtattcagggcctacttcatactgtttgtacataa aatttatctttaaagttctatttcaatgatcttgaGTTATCGAAAAtagc aagaaaaaaaattttccggccggccgcatgagagctttcttgcttcaccc gcattccagaaacactgcatttttttattttcgcctcacCGGTCTTTCAC TGCATTCCTAGGTTTAATTTAGAGCTTGGAGTTTAAAAGATGCGGTTTCA TATAACTGGGTATAGGTTCTCATTTCCTCTAAAAAGTGAGGCCTTCTTTA TACAGACATCACTAATGACGATGTTATAAGGATAAACAAACACGGAAATT TTCGAACGGGAAAAAAATTCTTACACAACGCACAGTCTAGGCTctctctt tgtttttcttttgttttccttgtAGAGCAGTTCATAATCCTTTGTGTAGA CTAACCTCATATTTCTTAATCGGTGACTGTTTTTCTATGCTCTGCTCCTT TTATGGTTCATTTCATGAttggaattttaaattttgtgtttatttttcaa attaaactTTCATCGTGAATATATCGCAAAGCTATTTGCGAAATTCATTA ATGACTTTTGAGGAGAAAAGCACCTAATCATCATTGGGTTACTGCGTAGT AAAGGACCCAAAATAGGTCATGATTTTGTTTCGTTTGAGAGTTAAAAATg tgcaatgaaaaaaaatattttgaaaggtGTAAGAGATAAAGTGGTGATCT TTATTAACTAGATTTTCCTTCCCCATTCATACATATGAcaattttttcct aaaaataatGTTCCTGTTTTGCAATCGCCCTCCGAATGATTTTTTCGATT TGAGTTTCCGTCCATGATTTATAACTGTACAGCATTTAAATTTTAGATAT TATATAAATTATAATTTTCGGAAATATAGTGAGATTCTCCGTATTTTAAG CATCAAATCATGCATAGACAAGGAGTTCGAAACAGGTAATTTTTGGTACA AAATCAAATTACTAAATTCCTTCTTTTCCCTGTATATAGGATGTTAAAGC GTTGTTCGCAAGTCCAAACTGTCCTAAATGGACGAGTTTCGAGTACGCAT ACAATGACAACTGGTATGTCACCTTTGAATGCGAAGATGACGCAAAGAAA GCTTACAGATATCTCCGCGAAGAAGTCCAATCATTTCAAGGTCGGCCTCT GATGGCTAGAATCAAAGCTAAAACGCTACTCAGCCGGACAGTCTATCTAC CAAAGAATGCGGCAAGCGCCACCGGTTCGACCACAACTAACACGTCACCG CCCGCCGATAATGTGACGTCACAATTCTCCACCACCGGTGGTGTTCCGGC GTTCACTGTGAGCCACCCGCAACAAATCTTTTCACCCAATTTTCAACCGT TTTACAACACAGCACCTGTGAACGGGAATCCCGGCATTCTTCCGGCCGGT GCTCAATGGATCAGTACAACCACACGATTCATTCCTCCAGAGGTATTCTT GTATAAAATTTGCTCATTCTAATTTGATATCTAAGGGAATGAGACTTTCC TNGTATAAAATTTGCTTGTTCTAATTTGATATCTAAGGGAATGAGACTTT CCTTAGACTTTAGAAAATGAATCAGATTGAAAGACTTTCATAAAAGGCTT TCCGAACTGACGGAAACGAGTTGAGGGTATCAGAGGTTTGGATCTGAGAT ACACCTTAAGTGgtttaattttttgcgtggacaaaattttgcGAATCGGT TCCTTTTTAcccaatttctttcattttgctAGGGTTTCGGACCAAATTGG CGAgttctactttaatgggataaatttttgcagGAATTAAATTTCGTGGA TTTCGCGGACTTGGGTGTCATCCACGAAATTAAgtctcaatggaaatttg gaaagtcGTTATCCGCTaaatatttttgaggaaaagctcgaaaaatgtaa aataactaTTTTTATAATGTTCACTAGCATCAAAGAGGTGCTGACAATGC GTATTTCGATAACCAAATGCATAAATTGGCATAAAAAGGCATAAAACTAA AGTATAGTGCTATCTGCCAAATAAAGTCCCCGCAAGATCTTAAAATTTCG TGGATGAGCTCAACTCCGAAATTTAATCcgcgcgaaaatttatcccatta cagtagttttcgcgaaaataaatccacaTCAAACTCAACCTACTTAAGGT ACCTCATCTCTGTAATAATTTATTCTTTGACACTAATATTTTCATCAATG TTGATGAAGTTTTATAGCCCTTGGAGGACATTCGAATCGACGTTTCTTTT CAGGTTAATGGGGATGCTGCATAGCTAAAATATATTATGAATGAAATTTG TATAACTCACGTGTTGTGTTGTAATTCAGAACTGGACAGTACGCCTACTC CACTACTTTACGAAATgagcaatttttttctctcttagTTTTTTTTACCg tatttgtttatttattttcgcTGTAATTTGATCTCTTTACTCTCTGTCTG AATCTTTAATTCCTCTTAGCGTTTTCGTGGTTAAACTTGCTTTCATTCTT ATTTGACAAACCAACATGCAAAAATCATGTCATTTCTCACATGGCATCTC TGCATTACTCTCGAATACCATGTGGTACTGTCATCATGGGCAGATCTTGT TTCAAAGCTTACCGTGTAAACAGGAGATGCTAGAAAATTACCTCCCATCA CTTTCAGatcctattttttacttttgCACGCGAGCTCACGAATAATATAG AGTGTTTCGCGTCGGAACATCCGAATAATATCGAGTGCTTTCCGTCGGAG CATccgaatactttaatgggataaactttcgcggatttcgcggatttggg tgtcatctgcgaaattaagtcccaatggaaatttggaagggcctcatccg cgaaatatttctaaacaaaaatcAAAGTGTGTCAAATAAATAGTATCTGA ATGGTTACCTGCATCAAAGAGgtgcaaataatgtgtatttcaacaaccaa catgcatgatttgatagtaaaagtcacaaaatcgtgaagatgttgccacc cgcgaaattaagtccccgcaaaatttttgaatttcgcggatacgctcaac cgcgaaatttaatccccgcgaaagtttatcccattaaagtaatatGAAGT GTTTTCCACCGAAGCATTTGAATAGGATCGAGTTTACCACCAACTATGAA TCTAGTGGCAAGCACCCAGTTTTACGGGCTGTTTTCAATCAAGATTGCAT CGCTAGAAAGTTTCCCTCGTCTTTATTTTCAGATCCGACCGAAAAATAAC TACAACAAATACAACAACTACCAAGGGAATAAACGTAAGAAACTTTCTTT CCTCATCCCACCTCATCATTGACCAGGGACCTGTCCCCTTTGAGAATTTT TTCATACCACCACCCCAATTTTTCGAAGTGGTATTTTAGTCCACTAAACG TTTTTGGGATATTGTGATACAGGGACCATCTTATTTTGGTCTtctcaaaa aatgataaatattgcTTATTTTAGTACCAGTGTATTTTTGGCTTGACAAC ACTTTTTTAGTATTTAGTATGCCATCAAATCAACCCTTCCCCTGTATAGA CAAAAACTTATAAGAACCTTTACCTCTAAATTCAAGTCCTTGATAATTTT GGTCGCGTTTGAATCCGTTTTAAACACATAGTTTCAGGCcccttaaaaag cttttttgtcATAATAAAATATCTCACTCAAGTCACCGTTTGTCAGTTAT CTATTTCATGTCCTTTTACTTTTACAGAATTGAATGGACAACGCCCTTAC TTCCCTGGCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCCAACAA AGTACCGTTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGACC GCCCGTCCAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACAT AATCACCAAAACGTACACAATACAAATGTCAATAGTAATTATCGTGGTAG AAATAGTGAAGACCCACGCTTCGTGTAAGCGAATGATTTATTTTACATTT GGCATCAATTCGAGTTTATTACTTACTCCTCAGTTTCTTTATGCTAAGTC TAtctttcctaagcataacatttaTAAACATATGCAGGCACAATTTTTGG TACCTGAACAACGGCTCTAATGTTCAGGAGCAATAGAATGCTTAACATAA TGCGAGCCTAGTATAAGGGAAgacatttgtttaaaaaaaaacatgtatta aaAGTTAAGATCTTTAGACTTTGAGCAATTCCAAATATTACAATGAAGTA AATTATCTTTTACTTGAAAATAATTAACTTTATTTAGAAAAGAAGTTACC ACTTTCCTCTTCTATATTTTATTAGACGTCACAGTGGACCGCGCAAAGAC TGGAATCGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGA ACGACGCGGCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGA AAGACGAGAAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGAT AAAAGTTCCATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCC TCAAATTAATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTC TACCAAGCCCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAAT AGATCTGCTTCCTCTCTCAAGGTTCGATTCTCAGTTTAGAGTTCTCTGTT AATCATTTCAGGCTATCGTACttattttgtttaatttgtCTCTGTCTCTC ATGGGAGTCTCTCCTTTGGTTAAGACTTCAGTACAAATTTAGATTtcgga attttgaaattgaaattcataGCAACANGAGTCTCTCTTTGGTTAAGTAC AAATTTAGATTtcggaattttgaaattgaaattcataGCAACATAAGTTT AAAATAATCGGTAATTTTCCCCATTCTTGGATTTCACTGATTCCAATTAT GTATTCTTGTTTTAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCGaatc aaataaagaaaaaccaatGACAACATCTCCTGCAGACATGAGGTATTAAA CTGGCTTTTTTGTCTATGTGGTTTGGTTGTACATTTAGACATcgaattag cggacactaaacATACAAAACGTATTGGTAGGTGAGCAACCCACCTCTAA AAAGCGTCGTTTACAACCAATGAATTGAGGCACAAGTTCTTCAAAGAACT TAATTATATAAACTTCACAATCTTATAACTTGACAACCAATGGACCACGT TTAAAAGATTTTACCACAATTTTTCTAATAAAGGTTCCAGCTTAGGGGTT CAAAGTTTTCTTGAGTCACCCGGTATGTATTTGCTCTTTATAGTAAATCA AGGTCTGGAATATACAGATTCAAATCAGGATTGAGAAATTTATcgtattt ctattttctttgttttagtgAACTTTTGACGACGGCTGAAGTTTTCGAAC CAGCAGCTACCGAACCCGCCCAAACCACTACAACGAACGCCAACGAAAAC GCCCCCTTAATCACCACAGTGGTGAGCACAGATAACGGTATACCAAAAAT GCTGAGCTATGCACAAATGGCGCAAAAACCGAACAGTAATaaggaaaatt ttgtaaacGATATCGACACGGCGAAGGACATTTCAGATGCGGTCGCCGCC AGTGACcctaaaaaatcttcaaataataAGACGGAAAACGGCAAAAACGG ACAATCGGCAAATggaaaacaaaatagaaaacctGGAAGTAAGAACTCTC CTAGAAGTCAACGTCGGAAATCCAACGGACAAGACAAATCGGCGGAAGTC GAACAGATGAGCGTTTCTTCGAACTTAACAAATACGGTGATGAAGGAAAC TTACGCATCTAAATTTGGTTCGTCCAGTGACTCGTCAAGAACTGGCAACT CTCCGTCAAGACCCAAAACCCAACCAACGACTAACACAAACTCTATAAAT AAGCAAAACCCACCATCAacgaataataaaaataatagcGGCCTACCAGC GCTGCGGCCTTTGATGAGCCAAGTCATCAATCCACCTGTCAGTAAAATGG ACGAAATCAACGGACTAGAGTTACAACAACAGCAACCGATTTCGTTCAGT GATACTGTTAAAAAACAATCTTCAATTGAACCTTCCACTCCTACTTCACC GAGGTCAATAGATCTCAACTCTGTGAGTAGTCCTCCATCCTCTAATACTG TTTCTCAACCGCCAGAGACCTCTTCAACGATAGAAGCTCCGAAAGAGAAA TCATAGTTGTATAGATGCTGAGTGGTTTTTAGTGTGTTTTTACGTGCAAA CGATGTGGATAGGATGGTTTTTCTTTCCGCTAAATGGTTGCTTGAATCAT TGGATGGTTTCTATATGGTATTTGATAGGGTGgatgattttaagaaaaag taatCAACCAATTCGCAGCAAATGATCGAATCGTCGCTTGATACCCACCA TCTTGTTCAGTCTTTGTGTTCCAACACAAAAGATGCTGTAAATTAAAGAA TTCGGTACCTGAATACAAAGAGTATCCCCGATTAATCACGCGCGTTCAAC GCACTGGCTGGTCTGTAAGAGAGCACTTCAGAAAGTATATTTTTCTATtc gatctttttattttttttgtttttcctcTCTGGATATAAGAGACGAGCGT GCGAGCGAGTGATCGCGACGGGCAACCGTGATATGAACGTGACCGCGTGG TCGCGAGACATTGAAATAAACTTTCGTGTTgtgtattttgaatttttgac gctttagttttattgttttgatttttttagtttttagaattttttcttct tcaataatTCTCTACTCTTTTAGCTCCTGACATCACGCTTATATTTATAG CGCCATTTTGTAGGTCATTAGCAGCCCAGGAAcatgaattcatgatattc atgacgtaatgttttatacggaaataccccggttttagccaatagtggca aatttaaaatagacaaaagttgtatgaAATTTGCCGCtattggcaaaaac cggggtctttctgtagaaaacattacgtcatgaataggCAAATACACATC CACTAAGATTTATACAAAAACCTAAGACAAATTCTAACAGTAATTTACGA AATGTGCATCTACCGTTATTCTCGTCAGAGTCACTTGTGAGTTGTGGTGA TTATCTCTAGCATGCTTACTGGAGAAAAATCGACCattacggtgcatttt cttgaattttttttaccattttcaagcaaaatatggtcagattttcgaaa ttttacacccttacagtgcatctttctcatctttgctgacTTTGACCCTT ACAGtccactttgggaagcttggaaaatataccTATAAGGGCCGCAtgta tggtaggtcatttaccttgagtgccccggTCTTTGAGGGTTTTACAACAA CCTTTTATAGTCTGACAATATTTTGTTCCCATAATGCAATGATAGAAGTA GTAGTTTTATAGGGGTCCGATGTTTTCTGTCTTGTTTTCTGTTCTGTAGT ATATTATATATTGCGAGTTAAGTCAGGCCTCAACTCTTGCGTAGTACATT TGCAGGAATAAACTACCGTCACTTTTCGGGTTGAATTAGTTGTGAAAATC TACAttgattattgaaaattttcaccaTTAAATTTTGCAAGATTGTAACT TTAACTGTTTAATtgaacagaattttttttctaaagtttttctTCTAATT TGTGGATGGAGTTGAGGCTAGgcttaaaaattcttttttctgtagttttc aaaccaaaaaaatcttttattttatattttttaaaacaaaaaagtcaact tTGTTCGACGTAGAGTTCCCAATATTTGTCGTGTTTTTAACGAATCGAGT TTATttagaaagagagaaaaaaatcgtttaaaaaactaaaaatagatATA TTATATGATATgaaattttagaacttttcttCGGGTTGATGCTTTATCAC TTGTGATGAGATAGATTTAAAGGTTCTGTCCTATTCACAAAAAGACTTTT CATATTCGTTACCCTTCATGCTTTAATCGGATTGTCTTCGAAATGCATTT TGGGTATTAAAGTTCAATTAAGTCATTTGGTAGCTCTCAGCATGCATTTG ATAAGCTTTAAAACCTGAGCGCGATTTGCGTGGATATCCTGCTATCCCTA TAGTGTGTAGAAAGCTAATCTACTTGAACAGAGAATACTCATGCCAGCAA GCTTTTGTTCGACTGATAACTGTCGAggatgaatttcttttttaactgGC TGAATAAAAGATTTGTAGATTTGCCATTTTTGAGAATGTCTGTTCCTCTT TTCATCCCATAATAATGTTCCCTAAATATGAAAACTCAAATGAAACTCAC TCAANTTACATTTGCAGGAATAAACTACCGTCACTTTTCGGGTTGAATTA GTTGTGAAAATCTACAttgattattgaaaattttcaccaTTAAATTTTGC AAGATTGTAACTTTAACTGTTTAATtgaacagaattttttttctaaagtt tttctTCTAATTTGTGGATGGAGTTGAGGCTAGgcttaaaaattcttttt tctgtagttttcaaaccaaaaaaatcttttattttatattttttaaaaca aaaaagtcaacttTGTTCGACGTAGAGTTCCCAATATTTGTCGTGTTTTT AACGAATCGAGTTTATttagaaagagagaaaaaaatcgtttaaaaaacta aaaatagatATATTATATGATATgaaattttagaacttttcttCGGGTTG ATGCTTTATCACTTGTGATGAGATAGATTTAAAGGTTCTGTCCTATTCAC AAAAAGACTTTTCATATTCGTTACCCTTCATGCTTTAATCGGATTGTCTT CGAAATGCATTTTGGGTATTAAAGTTCAATTAAGTCATTTGGTAGCTCTC AGCATGCATTTGATAAGCTTTAAAACCTGAGCGCGATTTGCGTGGATATC CTGCTATCCCTATAGTGTGTAGAAAGCTAATCTACTTGAACAGAGAATAC TCATGCCAGCAAGCTTTTGTTCGACTGATTACTGAAGTCGAggatgaatt tcttttttaactgGCTAAATAAAAGAATTGTAGATTTGCCATTTTTGAGA ATGTCTGTTCCTCTTTTCATCCCATAATAATGTTCCCTAAATATGAAAAC TCAAATGAAACTCACTCAATTCAAGGCAGGATATTTCGCGgaatcgcaaa aaatatgaaaaatagaaattatattatttGACATGTGAACACGATTAACG TGTTTTACAATTTAGAAACCCTAAAAAGAACGTTTATAAACTTTATTATT TTACCACGAGTATGTGTACACAGATTTTTACcatcttaacttttttttga aattaagtGTGTGGATCAGAGGTCTTTCAGGTTCGGCCAAGTTATAATTT CTATAATTATGAAAGAAAACGATATTCGAATTTGCACAAGTTGTTTTCTT TCATAATGGCAGATCCCCCTTGCAACACCTGTAAGACCTCTTTACGGGAA AGGTTCAAACGCGCGACGGACTCGTATTTGAATTCTTCCCGCAGCTGACA CAGTGCTGACACACTGTCGTTTATGATATCTGCCGCTCAGTTGACCTCAA GAAGAATACGCATAATTTAAACGGGCAGGCATCGCCATGACTTTATGTTC ATGCTGGAATATTTATGCATGATATTATTTTGAAGGCTATTAAATATGTT ATAAACTTGCCAGAGAGTGGGCTGTTTTTGACCCGTTCGTTTCATTTGCT TCAAATATATACAAGGAGAAGTGCTTTTGCATGGTCATAAAACATTGCAC ACTAAGGCGGTATTTATGTGTGATGCCTGTCCTCGTGCCAGTCTTTGTTG TTTATGCTTCTGAAGTCGACGAGCTTGTAGAAATCATGAAATTAAAAGAA AAGGTGTAGCCTtaagattattttttttatctttatcaTAACAAGGCTTG TCTAATATTAAAGCCAGTCAGGATGACTCAAATCGTACTGCAAACTTCTT GTACCCAATTTGATAAGTAATTTTTATGATTCTTACATGGCTCGCGAATC TACGACCTGGGTACGATATTATGCTTACTGATTTTCGATCCGAAAGATGA AAGCTACACCGATCTTCTTCTGTGATTTCTGTATGTTCTTTGAGGCTTGG AAACGAGAGTAAATCTTaattaaaatcaattaaaatttACTTACATCCAA TGGATATCCAAGAAGAAAGTAGATGAGTTCAAGGCGTGTCTTCAAGAGAT CTCTAACTTTTTCGAAATAACTTTTTGAGTCTCGGAAAAGCTATAACTGG TGGACGATAGTTGCATTATCAAGCTTTGGGGTAGTTAAACTTTTCTTGAT TTGTGGTCTTGGATATTTTGGATAAGGAAAATTATTTCTCTGTTTCACAA GCATAAAAGACATACATTTACTATATTTGATGACTTTTTCAACTTGTACA TAGCCTTCtaacatttcttttttcagaaaaaagtcaCTTGTACA

Coding sequence (CDS) from alignment at sc0000002:63815..100958+

>TCONS_00000399 ID=TCONS_00000399|Name=TCONS_00000399|organism=Clytia hemisphaerica|type=CDS|length=32208bp|location=Sequence derived from alignment at sc0000002:63815..100958+ (Clytia hemisphaerica)
ATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTGGAAACAAA
CACAGAAGATACAGAGACATCGTTAGCTGACACAAATACAATTCATGGTT
CACTGGATGGGGATACATCGACGGAAGGTTCCATTTCACCTGATCTATTG
ATCACCAACGAAGTTTCTCAACCACTTCACCAACCAACGGGTCACTCTGC
AGCTGCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCACCTCAATAA
GCTCAATGACTCCGGTCCTAATCaccaaaaacatagaaataggGAATGAG
CGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACATTAATTCGGTCCC
GATTCACGACCTACCGCAACCGTACATTGCACCGGACGGTTTATATTACT
GGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGCTGATCGAA
AGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCACGACAGCCA
GCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATATAATAACTC
AAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTGTCATCCCG
CCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCCATACAAAA
TCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGATCAATACT
TGAACTCACAGATGGACAGCGATCAGTATGTACCGATCTCTACCGTTGCT
AAATTCAATCAAgtTCGAAAATTAACTTCAGATATTGATCTCATAGTGGA
CGCACTTCGAGAATCACCATACGTGCAGTTGGACGAAACCGAACAGAAAG
TGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAATCCCAGAA
GTCACACCCATCGAGGATGTTAAAGCGTTGTTCGCAAGTCCAAACTGTCC
TAAATGGACGAGTTTCGAGTACGCATACAATGACAACTGGTATGTCACCT
TTGAATGCGAAGATGACGCAAAGAAAGCTTACAGATATCTCCGCGAAGAA
GTCCAATCATTTCAAGGTCGGCCTCTGATGGCTAGAATCAAAGCTAAAAC
GCTACTCAGCCGGACAGTCTATCTACCAAAGAATGCGGCAAGCGCCACCG
GTTCGACCACAACTAACACGTCACCGCCCGCCGATAATGTGACGTCACAA
TTCTCCACCACCGGTGGTGTTCCGGCGTTCACTGTGAGCCACCCGCAACA
AATCTTTTCACCCAATTTTCAACCGTTTTACAACACAGCACCTGTGAACG
GGAATCCCGGCATTCTTCCGGCCGGTGCTCAATGGATCAGTACAACCACA
CGATTCATTCCTCCAGAGATCCGACCGAAAAATAACTACAACAAATACAA
CAACTACCAAGGGAATAAACAATTGAATGGACAACGCCCTTACTTCCCTG
GCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCCAACAAAGTACCG
TTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGACCGCCCGTC
CAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACATAATCACC
AAAACGTACACAATACAAATGTCAATAGTAATTATCGTGGTAGAAATAGT
GAAGACCCACGCTTCGTACGTCACAGTGGACCGCGCAAAGACTGGAATCG
AAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGAACGACGCG
GCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGAAAGACGAG
AAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGATAAAAGTTC
CATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCCTCAAATTA
ATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTCTACCAAGC
CCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAATAGATCTGC
TTCCTCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCGaatcaa
ataaagaaaaaccaatGACAACATCTCCTGCAGACATGAGtgAACTTTTG
ACGACGGCTGAAGTTTTCGAACCAGCAGCTACCGAACCCGCCCAAACCAC
TACAACGAACGCCAACGAAAACGCCCCCTTAATCACCACAGTGGTGAGCA
CAGATAACGGTATACCAAAAATGCTGAGCTATGCACAAATGGCGCAAAAA
CCGAACAGTAATaaggaaaattttgtaaacGATATCGACACGGCGAAGGA
CATTTCAGATGCGGTCGCCGCCAGTGACcctaaaaaatcttcaaataata
AGACGGAAAACGGCAAAAACGGACAATCGGCAAATggaaaacaaaataga
aaacctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCGGAAATCCAACGG
ACAAGACAAATCGGCGGAAGTCGAACAGATGAGCGTTTCTTCGAACTTAA
CAAATACGGTGATGAAGGAAACTTACGCATCTAAATTTGGTTCGTCCAGT
GACTCGTCAAGAACTGGCAACTCTCCGTCAAGACCCAAAACCCAACCAAC
GACTAACACAAACTCTATAAATAAGCAAAACCCACCATCAacgaataata
aaaataatagcGGCCTACCAGCGCTGCGGCCTTTGATGAGCCAAGTCATC
AATCCACCTGTCAGTAAAATGGACGAAATCAACGGACTAGAGTTACAACA
ACAGCAACCGATTTCGTTCAGTGATACTGTTAAAAAACAATCTTCAATTG
AACCTTCCACTCCTACTTCACCGAGGTCAATAGATCTCAACTCTGTGAGT
AGTCCTCCATCCTCTAATACTGTTTCTCAACCGCCAGAGACCTCTTCAAC
GATAGAAGCTCCGAAAGAGAAATCATAGATGACTTCTGGTGTGATTGAAT
CACTTTCGACCTTGAGTTTGGAAACAAACACAGAAGATACAGAGACATCG
TTAGCTGACACAAATACAATTCATGGTTCACTGGATGGGGATACATCGAC
GGAAGGTTCCATTTCACCTGATCTATTGATCACCAACGAAGTTTCTCAAC
CACTTCACCAACCAACGGGTCACTCTGCAGCTGCTGTTGCCTCCTTGAAT
GCTAACGCCCCTGCCTTCACCTCAATAAGCTCAATGACTCCGGTCCTAAT
CaccaaaaacatagaaataggGAATGAGCGCTGGAAACCCACGGCAACCA
TAGTCGAAGAAAACATTAATTCGGTCCCGATTCACGACCTACCGCAACCG
TACATTGCACCGGACGGTTTATATTACTGGCCGGCCGACATGATCAACGG
ATTCCCTCCCCAACCTGTGCTGATCGAAAGCCTGCCAAACGGTACGGCAA
CGGTCATCCAAGCAGACCACGACAGCCAGCAAGCTTTCACTCAACAAAAC
GCCCTCGTACGCCCTGATATAATAACTCAAGTTTCAGCACCGCCGCCTAC
ACCGCCCATTAACAACGTTGTCATCCCGCCCTCCACTAAAGACTTGACAC
CAGATGAGCTGAAACGCTCCATACAAAATCAGTTTGAATATTACTTCTCA
CGGGAGAATTTGGCGAACGATCAATACTTGAACTCACAGATGGACAGCGA
TCAGTATGTACCGATCTCTACCGTTGCTAAATTCAATCAAgtTCGAAAAT
TAACTTCAGATATTGATCTCATAGTGGACGCACTTCGAGAATCACCATAC
GTGCAGTTGGACGAAACCGAACAGAAAGTGCGTGCAAACATGAAAAGATG
TATTGTCATTTTGAGAGAAATCCCAGAAGTCACACCCATCGAGGATGTTA
AAGCGTTGTTCGCAAGTCCAAACTGTCCTAAATGGACGAGTTTCGAGTAC
GCATACAATGACAACTGGTATGTCACCTTTGAATGCGAAGATGACGCAAA
GAAAGCTTACAGATATCTCCGCGAAGAAGTCCAATCATTTCAAGGTCGGC
CTCTGATGGCTAGAATCAAAGCTAAAACGCTACTCAGCCGGACAGTCTAT
CTACCAAAGAATGCGGCAAGCGCCACCGGTTCGACCACAACTAACACGTC
ACCGCCCGCCGATAATGTGACGTCACAATTCTCCACCACCGGTGGTGTTC
CGGCGTTCACTGTGAGCCACCCGCAACAAATCTTTTCACCCAATTTTCAA
CCGTTTTACAACACAGCACCTGTGAACGGGAATCCCGGCATTCTTCCGGC
CGGTGCTCAATGGATCAGTACAACCACACGATTCATTCCTCCAGAGATCC
GACCGAAAAATAACTACAACAAATACAACAACTACCAAGGGAATAAACAA
TTGAATGGACAACGCCCTTACTTCCCTGGCTCTAAGCCACGTTTCCGTAA
CAACTATAACAACCCCAACAAAGTACCGTTCCACGAAAGAAACGGGAACG
TTGACTACAATTCTGAAGACCGCCCGTCCAACGTCCCTACTAACAGGCGT
AACAACAACCCGAGCGGACATAATCACCAAAACGTACACAATACAAATGT
CAATAGTAATTATCGTGGTAGAAATAGTGAAGACCCACGCTTCGTACGTC
ACAGTGGACCGCGCAAAGACTGGAATCGAAACAGTTCTGAAGAAGGACCG
CGCTTCCAGCGGCTCCGTGAACGACGCGGCAAAGACGACACAGGAGGGTC
TTCGTCGACGTCCTCCACGAAAGACGAGAAAATGTCTTCTCACTCTAAAA
ACCCTTCTTCGAAACACGATAAAAGTTCCATTTCCTCAAATGAGGGATCT
GAAGATTCATCCAATGCTCCTCAAATTAATGGTGATTTGAACTTGGATCT
GGCTTTGGATTTCCCAGCTCTACCAAGCCCGAACTCACCAAACGAAACTG
GTAGTAATGGATCAGCAAATAGATCTGCTTCCTCTCTCAAGGAATTGGCT
GCCAATGTTTTGAGTGAAGTCGaatcaaataaagaaaaaccaatGACAAC
ATCTCCTGCAGACATGAGtgAACTTTTGACGACGGCTGAAGTTTTCGAAC
CAGCAGCTACCGAACCCGCCCAAACCACTACAACGAACGCCAACGAAAAC
GCCCCCTTAATCACCACAGTGGTGAGCACAGATAACGGTATACCAAAAAT
GCTGAGCTATGCACAAATGGCGCAAAAACCGAACAGTAATaaggaaaatt
ttgtaaacGATATCGACACGGCGAAGGACATTTCAGATGCGGTCGCCGCC
AGTGACcctaaaaaatcttcaaataataAGACGGAAAACGGCAAAAACGG
ACAATCGGCAAATggaaaacaaaatagaaaacctGGAAGTAAGAACTCTC
CTAGAAGTCAACGTCGGAAATCCAACGGACAAGACAAATCGGCGGAAGTC
GAACAGATGAGCGTTTCTTCGAACTTAACAAATACGGTGATGAAGGAAAC
TTACGCATCTAAATTTGGTTCGTCCAGTGACTCGTCAAGAACTGGCAACT
CTCCGTCAAGACCCAAAACCCAACCAACGACTAACACAAACTCTATAAAT
AAGCAAAACCCACCATCAacgaataataaaaataatagcGGCCTACCAGC
GCTGCGGCCTTTGATGAGCCAAGTCATCAATCCACCTGTCAGTAAAATGG
ACGAAATCAACGGACTAGAGTTACAACAACAGCAACCGATTTCGTTCAGT
GATACTGTTAAAAAACAATCTTCAATTGAACCTTCCACTCCTACTTCACC
GAGGTCAATAGATCTCAACTCTGTGAGTAGTCCTCCATCCTCTAATACTG
TTTCTCAACCGCCAGAGACCTCTTCAACGATAGAAGCTCCGAAAGAGAAA
TCATAGATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTGGA
AACAAACACAGAAGATACAGAGACATCGTTAGCTGACACAAATACAATTC
ATGGTTCACTGGATGGGGATACATCGACGGAAGGTTCCATTTCACCTGAT
CTATTGATCACCAACGAAGTTTCTCAACCACTTCACCAACCAACGGGTCA
CTCTGCAGCTGCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCACCT
CAATAAGCTCAATGACTCCGGTCCTAATCaccaaaaacatagaaataggG
AATGAGCGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACATTAATTC
GGTCCCGATTCACGACCTACCGCAACCGTACATTGCACCGGACGGTTTAT
ATTACTGGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGCTG
ATCGAAAGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCACGA
CAGCCAGCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATATAA
TAACTCAAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTGTC
ATCCCGCCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCCAT
ACAAAATCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGATC
AATACTTGAACTCACAGATGGACAGCGATCAGTATGTACCGATCTCTACC
GTTGCTAAATTCAATCAAgtTCGAAAATTAACTTCAGATATTGATCTCAT
AGTGGACGCACTTCGAGAATCACCATACGTGCAGTTGGACGAAACCGAAC
AGAAAGTGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAATC
CCAGAAGTCACACCCATCGAGGATGTTAAAGCGTTGTTCGCAAGTCCAAA
CTGTCCTAAATGGACGAGTTTCGAGTACGCATACAATGACAACTGGTATG
TCACCTTTGAATGCGAAGATGACGCAAAGAAAGCTTACAGATATCTCCGC
GAAGAAGTCCAATCATTTCAAGGTCGGCCTCTGATGGCTAGAATCAAAGC
TAAAACGCTACTCAGCCGGACAGTCTATCTACCAAAGAATGCGGCAAGCG
CCACCGGTTCGACCACAACTAACACGTCACCGCCCGCCGATAATGTGACG
TCACAATTCTCCACCACCGGTGGTGTTCCGGCGTTCACTGTGAGCCACCC
GCAACAAATCTTTTCACCCAATTTTCAACCGTTTTACAACACAGCACCTG
TGAACGGGAATCCCGGCATTCTTCCGGCCGGTGCTCAATGGATCAGTACA
ACCACACGATTCATTCCTCCAGAGATCCGACCGAAAAATAACTACAACAA
ATACAACAACTACCAAGGGAATAAACAATTGAATGGACAACGCCCTTACT
TCCCTGGCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCCAACAAA
GTACCGTTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGACCG
CCCGTCCAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACATA
ATCACCAAAACGTACACAATACAAATGTCAATAGTAATTATCGTGGTAGA
AATAGTGAAGACCCACGCTTCGTACGTCACAGTGGACCGCGCAAAGACTG
GAATCGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGAAC
GACGCGGCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGAAA
GACGAGAAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGATAA
AAGTTCCATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCCTC
AAATTAATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTCTA
CCAAGCCCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAATAG
ATCTGCTTCCTCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCG
aatcaaataaagaaaaaccaatGACAACATCTCCTGCAGACATGAGtgAA
CTTTTGACGACGGCTGAAGTTTTCGAACCAGCAGCTACCGAACCCGCCCA
AACCACTACAACGAACGCCAACGAAAACGCCCCCTTAATCACCACAGTGG
TGAGCACAGATAACGGTATACCAAAAATGCTGAGCTATGCACAAATGGCG
CAAAAACCGAACAGTAATaaggaaaattttgtaaacGATATCGACACGGC
GAAGGACATTTCAGATGCGGTCGCCGCCAGTGACcctaaaaaatcttcaa
ataataAGACGGAAAACGGCAAAAACGGACAATCGGCAAATggaaaacaa
aatagaaaacctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCGGAAATC
CAACGGACAAGACAAATCGGCGGAAGTCGAACAGATGAGCGTTTCTTCGA
ACTTAACAAATACGGTGATGAAGGAAACTTACGCATCTAAATTTGGTTCG
TCCAGTGACTCGTCAAGAACTGGCAACTCTCCGTCAAGACCCAAAACCCA
ACCAACGACTAACACAAACTCTATAAATAAGCAAAACCCACCATCAacga
ataataaaaataatagcGGCCTACCAGCGCTGCGGCCTTTGATGAGCCAA
GTCATCAATCCACCTGTCAGTAAAATGGACGAAATCAACGGACTAGAGTT
ACAACAACAGCAACCGATTTCGTTCAGTGATACTGTTAAAAAACAATCTT
CAATTGAACCTTCCACTCCTACTTCACCGAGGTCAATAGATCTCAACTCT
GTGAGTAGTCCTCCATCCTCTAATACTGTTTCTCAACCGCCAGAGACCTC
TTCAACGATAGAAGCTCCGAAAGAGAAATCATAGATGACTTCTGGTGTGA
TTGAATCACTTTCGACCTTGAGTTTGGAAACAAACACAGAAGATACAGAG
ACATCGTTAGCTGACACAAATACAATTCATGGTTCACTGGATGGGGATAC
ATCGACGGAAGGTTCCATTTCACCTGATCTATTGATCACCAACGAAGTTT
CTCAACCACTTCACCAACCAACGGGTCACTCTGCAGCTGCTGTTGCCTCC
TTGAATGCTAACGCCCCTGCCTTCACCTCAATAAGCTCAATGACTCCGGT
CCTAATCaccaaaaacatagaaataggGAATGAGCGCTGGAAACCCACGG
CAACCATAGTCGAAGAAAACATTAATTCGGTCCCGATTCACGACCTACCG
CAACCGTACATTGCACCGGACGGTTTATATTACTGGCCGGCCGACATGAT
CAACGGATTCCCTCCCCAACCTGTGCTGATCGAAAGCCTGCCAAACGGTA
CGGCAACGGTCATCCAAGCAGACCACGACAGCCAGCAAGCTTTCACTCAA
CAAAACGCCCTCGTACGCCCTGATATAATAACTCAAGTTTCAGCACCGCC
GCCTACACCGCCCATTAACAACGTTGTCATCCCGCCCTCCACTAAAGACT
TGACACCAGATGAGCTGAAACGCTCCATACAAAATCAGTTTGAATATTAC
TTCTCACGGGAGAATTTGGCGAACGATCAATACTTGAACTCACAGATGGA
CAGCGATCAGTATGTACCGATCTCTACCGTTGCTAAATTCAATCAAgtTC
GAAAATTAACTTCAGATATTGATCTCATAGTGGACGCACTTCGAGAATCA
CCATACGTGCAGTTGGACGAAACCGAACAGAAAGTGCGTGCAAACATGAA
AAGATGTATTGTCATTTTGAGAGAAATCCCAGAAGTCACACCCATCGAGG
ATGTTAAAGCGTTGTTCGCAAGTCCAAACTGTCCTAAATGGACGAGTTTC
GAGTACGCATACAATGACAACTGGTATGTCACCTTTGAATGCGAAGATGA
CGCAAAGAAAGCTTACAGATATCTCCGCGAAGAAGTCCAATCATTTCAAG
GTCGGCCTCTGATGGCTAGAATCAAAGCTAAAACGCTACTCAGCCGGACA
GTCTATCTACCAAAGAATGCGGCAAGCGCCACCGGTTCGACCACAACTAA
CACGTCACCGCCCGCCGATAATGTGACGTCACAATTCTCCACCACCGGTG
GTGTTCCGGCGTTCACTGTGAGCCACCCGCAACAAATCTTTTCACCCAAT
TTTCAACCGTTTTACAACACAGCACCTGTGAACGGGAATCCCGGCATTCT
TCCGGCCGGTGCTCAATGGATCAGTACAACCACACGATTCATTCCTCCAG
AGATCCGACCGAAAAATAACTACAACAAATACAACAACTACCAAGGGAAT
AAACAATTGAATGGACAACGCCCTTACTTCCCTGGCTCTAAGCCACGTTT
CCGTAACAACTATAACAACCCCAACAAAGTACCGTTCCACGAAAGAAACG
GGAACGTTGACTACAATTCTGAAGACCGCCCGTCCAACGTCCCTACTAAC
AGGCGTAACAACAACCCGAGCGGACATAATCACCAAAACGTACACAATAC
AAATGTCAATAGTAATTATCGTGGTAGAAATAGTGAAGACCCACGCTTCG
TACGTCACAGTGGACCGCGCAAAGACTGGAATCGAAACAGTTCTGAAGAA
GGACCGCGCTTCCAGCGGCTCCGTGAACGACGCGGCAAAGACGACACAGG
AGGGTCTTCGTCGACGTCCTCCACGAAAGACGAGAAAATGTCTTCTCACT
CTAAAAACCCTTCTTCGAAACACGATAAAAGTTCCATTTCCTCAAATGAG
GGATCTGAAGATTCATCCAATGCTCCTCAAATTAATGGTGATTTGAACTT
GGATCTGGCTTTGGATTTCCCAGCTCTACCAAGCCCGAACTCACCAAACG
AAACTGGTAGTAATGGATCAGCAAATAGATCTGCTTCCTCTCTCAAGGAA
TTGGCTGCCAATGTTTTGAGTGAAGTCGaatcaaataaagaaaaaccaat
GACAACATCTCCTGCAGACATGAGtgAACTTTTGACGACGGCTGAAGTTT
TCGAACCAGCAGCTACCGAACCCGCCCAAACCACTACAACGAACGCCAAC
GAAAACGCCCCCTTAATCACCACAGTGGTGAGCACAGATAACGGTATACC
AAAAATGCTGAGCTATGCACAAATGGCGCAAAAACCGAACAGTAATaagg
aaaattttgtaaacGATATCGACACGGCGAAGGACATTTCAGATGCGGTC
GCCGCCAGTGACcctaaaaaatcttcaaataataAGACGGAAAACGGCAA
AAACGGACAATCGGCAAATggaaaacaaaatagaaaacctGGAAGTAAGA
ACTCTCCTAGAAGTCAACGTCGGAAATCCAACGGACAAGACAAATCGGCG
GAAGTCGAACAGATGAGCGTTTCTTCGAACTTAACAAATACGGTGATGAA
GGAAACTTACGCATCTAAATTTGGTTCGTCCAGTGACTCGTCAAGAACTG
GCAACTCTCCGTCAAGACCCAAAACCCAACCAACGACTAACACAAACTCT
ATAAATAAGCAAAACCCACCATCAacgaataataaaaataatagcGGCCT
ACCAGCGCTGCGGCCTTTGATGAGCCAAGTCATCAATCCACCTGTCAGTA
AAATGGACGAAATCAACGGACTAGAGTTACAACAACAGCAACCGATTTCG
TTCAGTGATACTGTTAAAAAACAATCTTCAATTGAACCTTCCACTCCTAC
TTCACCGAGGTCAATAGATCTCAACTCTGTGAGTAGTCCTCCATCCTCTA
ATACTGTTTCTCAACCGCCAGAGACCTCTTCAACGATAGAAGCTCCGAAA
GAGAAATCATAGATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAG
TTTGGAAACAAACACAGAAGATACAGAGACATCGTTAGCTGACACAAATA
CAATTCATGGTTCACTGGATGGGGATACATCGACGGAAGGTTCCATTTCA
CCTGATCTATTGATCACCAACGAAGTTTCTCAACCACTTCACCAACCAAC
GGGTCACTCTGCAGCTGCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCT
TCACCTCAATAAGCTCAATGACTCCGGTCCTAATCaccaaaaacatagaa
ataggGAATGAGCGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACAT
TAATTCGGTCCCGATTCACGACCTACCGCAACCGTACATTGCACCGGACG
GTTTATATTACTGGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCT
GTGCTGATCGAAAGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGA
CCACGACAGCCAGCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTG
ATATAATAACTCAAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAAC
GTTGTCATCCCGCCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACG
CTCCATACAAAATCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGA
ACGATCAATACTTGAACTCACAGATGGACAGCGATCAGTATGTACCGATC
TCTACCGTTGCTAAATTCAATCAAgtTCGAAAATTAACTTCAGATATTGA
TCTCATAGTGGACGCACTTCGAGAATCACCATACGTGCAGTTGGACGAAA
CCGAACAGAAAGTGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGA
GAAATCCCAGAAGTCACACCCATCGAGGATGTTAAAGCGTTGTTCGCAAG
TCCAAACTGTCCTAAATGGACGAGTTTCGAGTACGCATACAATGACAACT
GGTATGTCACCTTTGAATGCGAAGATGACGCAAAGAAAGCTTACAGATAT
CTCCGCGAAGAAGTCCAATCATTTCAAGGTCGGCCTCTGATGGCTAGAAT
CAAAGCTAAAACGCTACTCAGCCGGACAGTCTATCTACCAAAGAATGCGG
CAAGCGCCACCGGTTCGACCACAACTAACACGTCACCGCCCGCCGATAAT
GTGACGTCACAATTCTCCACCACCGGTGGTGTTCCGGCGTTCACTGTGAG
CCACCCGCAACAAATCTTTTCACCCAATTTTCAACCGTTTTACAACACAG
CACCTGTGAACGGGAATCCCGGCATTCTTCCGGCCGGTGCTCAATGGATC
AGTACAACCACACGATTCATTCCTCCAGAGATCCGACCGAAAAATAACTA
CAACAAATACAACAACTACCAAGGGAATAAACAATTGAATGGACAACGCC
CTTACTTCCCTGGCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCC
AACAAAGTACCGTTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGA
AGACCGCCCGTCCAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCG
GACATAATCACCAAAACGTACACAATACAAATGTCAATAGTAATTATCGT
GGTAGAAATAGTGAAGACCCACGCTTCGTACGTCACAGTGGACCGCGCAA
AGACTGGAATCGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCC
GTGAACGACGCGGCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCC
ACGAAAGACGAGAAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACA
CGATAAAAGTTCCATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATG
CTCCTCAAATTAATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCA
GCTCTACCAAGCCCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGC
AAATAGATCTGCTTCCTCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTG
AAGTCGaatcaaataaagaaaaaccaatGACAACATCTCCTGCAGACATG
AGtgAACTTTTGACGACGGCTGAAGTTTTCGAACCAGCAGCTACCGAACC
CGCCCAAACCACTACAACGAACGCCAACGAAAACGCCCCCTTAATCACCA
CAGTGGTGAGCACAGATAACGGTATACCAAAAATGCTGAGCTATGCACAA
ATGGCGCAAAAACCGAACAGTAATaaggaaaattttgtaaacGATATCGA
CACGGCGAAGGACATTTCAGATGCGGTCGCCGCCAGTGACcctaaaaaat
cttcaaataataAGACGGAAAACGGCAAAAACGGACAATCGGCAAATgga
aaacaaaatagaaaacctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCG
GAAATCCAACGGACAAGACAAATCGGCGGAAGTCGAACAGATGAGCGTTT
CTTCGAACTTAACAAATACGGTGATGAAGGAAACTTACGCATCTAAATTT
GGTTCGTCCAGTGACTCGTCAAGAACTGGCAACTCTCCGTCAAGACCCAA
AACCCAACCAACGACTAACACAAACTCTATAAATAAGCAAAACCCACCAT
CAacgaataataaaaataatagcGGCCTACCAGCGCTGCGGCCTTTGATG
AGCCAAGTCATCAATCCACCTGTCAGTAAAATGGACGAAATCAACGGACT
AGAGTTACAACAACAGCAACCGATTTCGTTCAGTGATACTGTTAAAAAAC
AATCTTCAATTGAACCTTCCACTCCTACTTCACCGAGGTCAATAGATCTC
AACTCTGTGAGTAGTCCTCCATCCTCTAATACTGTTTCTCAACCGCCAGA
GACCTCTTCAACGATAGAAGCTCCGAAAGAGAAATCATAGATGACTTCTG
GTGTGATTGAATCACTTTCGACCTTGAGTTTGGAAACAAACACAGAAGAT
ACAGAGACATCGTTAGCTGACACAAATACAATTCATGGTTCACTGGATGG
GGATACATCGACGGAAGGTTCCATTTCACCTGATCTATTGATCACCAACG
AAGTTTCTCAACCACTTCACCAACCAACGGGTCACTCTGCAGCTGCTGTT
GCCTCCTTGAATGCTAACGCCCCTGCCTTCACCTCAATAAGCTCAATGAC
TCCGGTCCTAATCaccaaaaacatagaaataggGAATGAGCGCTGGAAAC
CCACGGCAACCATAGTCGAAGAAAACATTAATTCGGTCCCGATTCACGAC
CTACCGCAACCGTACATTGCACCGGACGGTTTATATTACTGGCCGGCCGA
CATGATCAACGGATTCCCTCCCCAACCTGTGCTGATCGAAAGCCTGCCAA
ACGGTACGGCAACGGTCATCCAAGCAGACCACGACAGCCAGCAAGCTTTC
ACTCAACAAAACGCCCTCGTACGCCCTGATATAATAACTCAAGTTTCAGC
ACCGCCGCCTACACCGCCCATTAACAACGTTGTCATCCCGCCCTCCACTA
AAGACTTGACACCAGATGAGCTGAAACGCTCCATACAAAATCAGTTTGAA
TATTACTTCTCACGGGAGAATTTGGCGAACGATCAATACTTGAACTCACA
GATGGACAGCGATCAGTATGTACCGATCTCTACCGTTGCTAAATTCAATC
AAgtTCGAAAATTAACTTCAGATATTGATCTCATAGTGGACGCACTTCGA
GAATCACCATACGTGCAGTTGGACGAAACCGAACAGAAAGTGCGTGCAAA
CATGAAAAGATGTATTGTCATTTTGAGAGAAATCCCAGAAGTCACACCCA
TCGAGGATGTTAAAGCGTTGTTCGCAAGTCCAAACTGTCCTAAATGGACG
AGTTTCGAGTACGCATACAATGACAACTGGTATGTCACCTTTGAATGCGA
AGATGACGCAAAGAAAGCTTACAGATATCTCCGCGAAGAAGTCCAATCAT
TTCAAGGTCGGCCTCTGATGGCTAGAATCAAAGCTAAAACGCTACTCAGC
CGGACAGTCTATCTACCAAAGAATGCGGCAAGCGCCACCGGTTCGACCAC
AACTAACACGTCACCGCCCGCCGATAATGTGACGTCACAATTCTCCACCA
CCGGTGGTGTTCCGGCGTTCACTGTGAGCCACCCGCAACAAATCTTTTCA
CCCAATTTTCAACCGTTTTACAACACAGCACCTGTGAACGGGAATCCCGG
CATTCTTCCGGCCGGTGCTCAATGGATCAGTACAACCACACGATTCATTC
CTCCAGAGATCCGACCGAAAAATAACTACAACAAATACAACAACTACCAA
GGGAATAAACAATTGAATGGACAACGCCCTTACTTCCCTGGCTCTAAGCC
ACGTTTCCGTAACAACTATAACAACCCCAACAAAGTACCGTTCCACGAAA
GAAACGGGAACGTTGACTACAATTCTGAAGACCGCCCGTCCAACGTCCCT
ACTAACAGGCGTAACAACAACCCGAGCGGACATAATCACCAAAACGTACA
CAATACAAATGTCAATAGTAATTATCGTGGTAGAAATAGTGAAGACCCAC
GCTTCGTACGTCACAGTGGACCGCGCAAAGACTGGAATCGAAACAGTTCT
GAAGAAGGACCGCGCTTCCAGCGGCTCCGTGAACGACGCGGCAAAGACGA
CACAGGAGGGTCTTCGTCGACGTCCTCCACGAAAGACGAGAAAATGTCTT
CTCACTCTAAAAACCCTTCTTCGAAACACGATAAAAGTTCCATTTCCTCA
AATGAGGGATCTGAAGATTCATCCAATGCTCCTCAAATTAATGGTGATTT
GAACTTGGATCTGGCTTTGGATTTCCCAGCTCTACCAAGCCCGAACTCAC
CAAACGAAACTGGTAGTAATGGATCAGCAAATAGATCTGCTTCCTCTCTC
AAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCGaatcaaataaagaaaa
accaatGACAACATCTCCTGCAGACATGAGtgAACTTTTGACGACGGCTG
AAGTTTTCGAACCAGCAGCTACCGAACCCGCCCAAACCACTACAACGAAC
GCCAACGAAAACGCCCCCTTAATCACCACAGTGGTGAGCACAGATAACGG
TATACCAAAAATGCTGAGCTATGCACAAATGGCGCAAAAACCGAACAGTA
ATaaggaaaattttgtaaacGATATCGACACGGCGAAGGACATTTCAGAT
GCGGTCGCCGCCAGTGACcctaaaaaatcttcaaataataAGACGGAAAA
CGGCAAAAACGGACAATCGGCAAATggaaaacaaaatagaaaacctGGAA
GTAAGAACTCTCCTAGAAGTCAACGTCGGAAATCCAACGGACAAGACAAA
TCGGCGGAAGTCGAACAGATGAGCGTTTCTTCGAACTTAACAAATACGGT
GATGAAGGAAACTTACGCATCTAAATTTGGTTCGTCCAGTGACTCGTCAA
GAACTGGCAACTCTCCGTCAAGACCCAAAACCCAACCAACGACTAACACA
AACTCTATAAATAAGCAAAACCCACCATCAacgaataataaaaataatag
cGGCCTACCAGCGCTGCGGCCTTTGATGAGCCAAGTCATCAATCCACCTG
TCAGTAAAATGGACGAAATCAACGGACTAGAGTTACAACAACAGCAACCG
ATTTCGTTCAGTGATACTGTTAAAAAACAATCTTCAATTGAACCTTCCAC
TCCTACTTCACCGAGGTCAATAGATCTCAACTCTGTGAGTAGTCCTCCAT
CCTCTAATACTGTTTCTCAACCGCCAGAGACCTCTTCAACGATAGAAGCT
CCGAAAGAGAAATCATAGATGACTTCTGGTGTGATTGAATCACTTTCGAC
CTTGAGTTTGGAAACAAACACAGAAGATACAGAGACATCGTTAGCTGACA
CAAATACAATTCATGGTTCACTGGATGGGGATACATCGACGGAAGGTTCC
ATTTCACCTGATCTATTGATCACCAACGAAGTTTCTCAACCACTTCACCA
ACCAACGGGTCACTCTGCAGCTGCTGTTGCCTCCTTGAATGCTAACGCCC
CTGCCTTCACCTCAATAAGCTCAATGACTCCGGTCCTAATCaccaaaaac
atagaaataggGAATGAGCGCTGGAAACCCACGGCAACCATAGTCGAAGA
AAACATTAATTCGGTCCCGATTCACGACCTACCGCAACCGTACATTGCAC
CGGACGGTTTATATTACTGGCCGGCCGACATGATCAACGGATTCCCTCCC
CAACCTGTGCTGATCGAAAGCCTGCCAAACGGTACGGCAACGGTCATCCA
AGCAGACCACGACAGCCAGCAAGCTTTCACTCAACAAAACGCCCTCGTAC
GCCCTGATATAATAACTCAAGTTTCAGCACCGCCGCCTACACCGCCCATT
AACAACGTTGTCATCCCGCCCTCCACTAAAGACTTGACACCAGATGAGCT
GAAACGCTCCATACAAAATCAGTTTGAATATTACTTCTCACGGGAGAATT
TGGCGAACGATCAATACTTGAACTCACAGATGGACAGCGATCAGTATGTA
CCGATCTCTACCGTTGCTAAATTCAATCAAgtTCGAAAATTAACTTCAGA
TATTGATCTCATAGTGGACGCACTTCGAGAATCACCATACGTGCAGTTGG
ACGAAACCGAACAGAAAGTGCGTGCAAACATGAAAAGATGTATTGTCATT
TTGAGAGAAATCCCAGAAGTCACACCCATCGAGGATGTTAAAGCGTTGTT
CGCAAGTCCAAACTGTCCTAAATGGACGAGTTTCGAGTACGCATACAATG
ACAACTGGTATGTCACCTTTGAATGCGAAGATGACGCAAAGAAAGCTTAC
AGATATCTCCGCGAAGAAGTCCAATCATTTCAAGGTCGGCCTCTGATGGC
TAGAATCAAAGCTAAAACGCTACTCAGCCGGACAGTCTATCTACCAAAGA
ATGCGGCAAGCGCCACCGGTTCGACCACAACTAACACGTCACCGCCCGCC
GATAATGTGACGTCACAATTCTCCACCACCGGTGGTGTTCCGGCGTTCAC
TGTGAGCCACCCGCAACAAATCTTTTCACCCAATTTTCAACCGTTTTACA
ACACAGCACCTGTGAACGGGAATCCCGGCATTCTTCCGGCCGGTGCTCAA
TGGATCAGTACAACCACACGATTCATTCCTCCAGAGATCCGACCGAAAAA
TAACTACAACAAATACAACAACTACCAAGGGAATAAACAATTGAATGGAC
AACGCCCTTACTTCCCTGGCTCTAAGCCACGTTTCCGTAACAACTATAAC
AACCCCAACAAAGTACCGTTCCACGAAAGAAACGGGAACGTTGACTACAA
TTCTGAAGACCGCCCGTCCAACGTCCCTACTAACAGGCGTAACAACAACC
CGAGCGGACATAATCACCAAAACGTACACAATACAAATGTCAATAGTAAT
TATCGTGGTAGAAATAGTGAAGACCCACGCTTCGTACGTCACAGTGGACC
GCGCAAAGACTGGAATCGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGC
GGCTCCGTGAACGACGCGGCAAAGACGACACAGGAGGGTCTTCGTCGACG
TCCTCCACGAAAGACGAGAAAATGTCTTCTCACTCTAAAAACCCTTCTTC
GAAACACGATAAAAGTTCCATTTCCTCAAATGAGGGATCTGAAGATTCAT
CCAATGCTCCTCAAATTAATGGTGATTTGAACTTGGATCTGGCTTTGGAT
TTCCCAGCTCTACCAAGCCCGAACTCACCAAACGAAACTGGTAGTAATGG
ATCAGCAAATAGATCTGCTTCCTCTCTCAAGGAATTGGCTGCCAATGTTT
TGAGTGAAGTCGaatcaaataaagaaaaaccaatGACAACATCTCCTGCA
GACATGAGtgAACTTTTGACGACGGCTGAAGTTTTCGAACCAGCAGCTAC
CGAACCCGCCCAAACCACTACAACGAACGCCAACGAAAACGCCCCCTTAA
TCACCACAGTGGTGAGCACAGATAACGGTATACCAAAAATGCTGAGCTAT
GCACAAATGGCGCAAAAACCGAACAGTAATaaggaaaattttgtaaacGA
TATCGACACGGCGAAGGACATTTCAGATGCGGTCGCCGCCAGTGACccta
aaaaatcttcaaataataAGACGGAAAACGGCAAAAACGGACAATCGGCA
AATggaaaacaaaatagaaaacctGGAAGTAAGAACTCTCCTAGAAGTCA
ACGTCGGAAATCCAACGGACAAGACAAATCGGCGGAAGTCGAACAGATGA
GCGTTTCTTCGAACTTAACAAATACGGTGATGAAGGAAACTTACGCATCT
AAATTTGGTTCGTCCAGTGACTCGTCAAGAACTGGCAACTCTCCGTCAAG
ACCCAAAACCCAACCAACGACTAACACAAACTCTATAAATAAGCAAAACC
CACCATCAacgaataataaaaataatagcGGCCTACCAGCGCTGCGGCCT
TTGATGAGCCAAGTCATCAATCCACCTGTCAGTAAAATGGACGAAATCAA
CGGACTAGAGTTACAACAACAGCAACCGATTTCGTTCAGTGATACTGTTA
AAAAACAATCTTCAATTGAACCTTCCACTCCTACTTCACCGAGGTCAATA
GATCTCAACTCTGTGAGTAGTCCTCCATCCTCTAATACTGTTTCTCAACC
GCCAGAGACCTCTTCAACGATAGAAGCTCCGAAAGAGAAATCATAGATGA
CTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTGGAAACAAACACA
GAAGATACAGAGACATCGTTAGCTGACACAAATACAATTCATGGTTCACT
GGATGGGGATACATCGACGGAAGGTTCCATTTCACCTGATCTATTGATCA
CCAACGAAGTTTCTCAACCACTTCACCAACCAACGGGTCACTCTGCAGCT
GCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCACCTCAATAAGCTC
AATGACTCCGGTCCTAATCaccaaaaacatagaaataggGAATGAGCGCT
GGAAACCCACGGCAACCATAGTCGAAGAAAACATTAATTCGGTCCCGATT
CACGACCTACCGCAACCGTACATTGCACCGGACGGTTTATATTACTGGCC
GGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGCTGATCGAAAGCC
TGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCACGACAGCCAGCAA
GCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATATAATAACTCAAGT
TTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTGTCATCCCGCCCT
CCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCCATACAAAATCAG
TTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGATCAATACTTGAA
CTCACAGATGGACAGCGATCAGTATGTACCGATCTCTACCGTTGCTAAAT
TCAATCAAgtTCGAAAATTAACTTCAGATATTGATCTCATAGTGGACGCA
CTTCGAGAATCACCATACGTGCAGTTGGACGAAACCGAACAGAAAGTGCG
TGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAATCCCAGAAGTCA
CACCCATCGAGGATGTTAAAGCGTTGTTCGCAAGTCCAAACTGTCCTAAA
TGGACGAGTTTCGAGTACGCATACAATGACAACTGGTATGTCACCTTTGA
ATGCGAAGATGACGCAAAGAAAGCTTACAGATATCTCCGCGAAGAAGTCC
AATCATTTCAAGGTCGGCCTCTGATGGCTAGAATCAAAGCTAAAACGCTA
CTCAGCCGGACAGTCTATCTACCAAAGAATGCGGCAAGCGCCACCGGTTC
GACCACAACTAACACGTCACCGCCCGCCGATAATGTGACGTCACAATTCT
CCACCACCGGTGGTGTTCCGGCGTTCACTGTGAGCCACCCGCAACAAATC
TTTTCACCCAATTTTCAACCGTTTTACAACACAGCACCTGTGAACGGGAA
TCCCGGCATTCTTCCGGCCGGTGCTCAATGGATCAGTACAACCACACGAT
TCATTCCTCCAGAGATCCGACCGAAAAATAACTACAACAAATACAACAAC
TACCAAGGGAATAAACAATTGAATGGACAACGCCCTTACTTCCCTGGCTC
TAAGCCACGTTTCCGTAACAACTATAACAACCCCAACAAAGTACCGTTCC
ACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGACCGCCCGTCCAAC
GTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACATAATCACCAAAA
CGTACACAATACAAATGTCAATAGTAATTATCGTGGTAGAAATAGTGAAG
ACCCACGCTTCGTACGTCACAGTGGACCGCGCAAAGACTGGAATCGAAAC
AGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGAACGACGCGGCAA
AGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGAAAGACGAGAAAA
TGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGATAAAAGTTCCATT
TCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCCTCAAATTAATGG
TGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTCTACCAAGCCCGA
ACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAATAGATCTGCTTCC
TCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCGaatcaaataa
agaaaaaccaatGACAACATCTCCTGCAGACATGAGtgAACTTTTGACGA
CGGCTGAAGTTTTCGAACCAGCAGCTACCGAACCCGCCCAAACCACTACA
ACGAACGCCAACGAAAACGCCCCCTTAATCACCACAGTGGTGAGCACAGA
TAACGGTATACCAAAAATGCTGAGCTATGCACAAATGGCGCAAAAACCGA
ACAGTAATaaggaaaattttgtaaacGATATCGACACGGCGAAGGACATT
TCAGATGCGGTCGCCGCCAGTGACcctaaaaaatcttcaaataataAGAC
GGAAAACGGCAAAAACGGACAATCGGCAAATggaaaacaaaatagaaaac
ctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCGGAAATCCAACGGACAA
GACAAATCGGCGGAAGTCGAACAGATGAGCGTTTCTTCGAACTTAACAAA
TACGGTGATGAAGGAAACTTACGCATCTAAATTTGGTTCGTCCAGTGACT
CGTCAAGAACTGGCAACTCTCCGTCAAGACCCAAAACCCAACCAACGACT
AACACAAACTCTATAAATAAGCAAAACCCACCATCAacgaataataaaaa
taatagcGGCCTACCAGCGCTGCGGCCTTTGATGAGCCAAGTCATCAATC
CACCTGTCAGTAAAATGGACGAAATCAACGGACTAGAGTTACAACAACAG
CAACCGATTTCGTTCAGTGATACTGTTAAAAAACAATCTTCAATTGAACC
TTCCACTCCTACTTCACCGAGGTCAATAGATCTCAACTCTGTGAGTAGTC
CTCCATCCTCTAATACTGTTTCTCAACCGCCAGAGACCTCTTCAACGATA
GAAGCTCCGAAAGAGAAATCATAGATGACTTCTGGTGTGATTGAATCACT
TTCGACCTTGAGTTTGGAAACAAACACAGAAGATACAGAGACATCGTTAG
CTGACACAAATACAATTCATGGTTCACTGGATGGGGATACATCGACGGAA
GGTTCCATTTCACCTGATCTATTGATCACCAACGAAGTTTCTCAACCACT
TCACCAACCAACGGGTCACTCTGCAGCTGCTGTTGCCTCCTTGAATGCTA
ACGCCCCTGCCTTCACCTCAATAAGCTCAATGACTCCGGTCCTAATCacc
aaaaacatagaaataggGAATGAGCGCTGGAAACCCACGGCAACCATAGT
CGAAGAAAACATTAATTCGGTCCCGATTCACGACCTACCGCAACCGTACA
TTGCACCGGACGGTTTATATTACTGGCCGGCCGACATGATCAACGGATTC
CCTCCCCAACCTGTGCTGATCGAAAGCCTGCCAAACGGTACGGCAACGGT
CATCCAAGCAGACCACGACAGCCAGCAAGCTTTCACTCAACAAAACGCCC
TCGTACGCCCTGATATAATAACTCAAGTTTCAGCACCGCCGCCTACACCG
CCCATTAACAACGTTGTCATCCCGCCCTCCACTAAAGACTTGACACCAGA
TGAGCTGAAACGCTCCATACAAAATCAGTTTGAATATTACTTCTCACGGG
AGAATTTGGCGAACGATCAATACTTGAACTCACAGATGGACAGCGATCAG
TATGTACCGATCTCTACCGTTGCTAAATTCAATCAAgtTCGAAAATTAAC
TTCAGATATTGATCTCATAGTGGACGCACTTCGAGAATCACCATACGTGC
AGTTGGACGAAACCGAACAGAAAGTGCGTGCAAACATGAAAAGATGTATT
GTCATTTTGAGAGAAATCCCAGAAGTCACACCCATCGAGGATGTTAAAGC
GTTGTTCGCAAGTCCAAACTGTCCTAAATGGACGAGTTTCGAGTACGCAT
ACAATGACAACTGGTATGTCACCTTTGAATGCGAAGATGACGCAAAGAAA
GCTTACAGATATCTCCGCGAAGAAGTCCAATCATTTCAAGGTCGGCCTCT
GATGGCTAGAATCAAAGCTAAAACGCTACTCAGCCGGACAGTCTATCTAC
CAAAGAATGCGGCAAGCGCCACCGGTTCGACCACAACTAACACGTCACCG
CCCGCCGATAATGTGACGTCACAATTCTCCACCACCGGTGGTGTTCCGGC
GTTCACTGTGAGCCACCCGCAACAAATCTTTTCACCCAATTTTCAACCGT
TTTACAACACAGCACCTGTGAACGGGAATCCCGGCATTCTTCCGGCCGGT
GCTCAATGGATCAGTACAACCACACGATTCATTCCTCCAGAGATCCGACC
GAAAAATAACTACAACAAATACAACAACTACCAAGGGAATAAACAATTGA
ATGGACAACGCCCTTACTTCCCTGGCTCTAAGCCACGTTTCCGTAACAAC
TATAACAACCCCAACAAAGTACCGTTCCACGAAAGAAACGGGAACGTTGA
CTACAATTCTGAAGACCGCCCGTCCAACGTCCCTACTAACAGGCGTAACA
ACAACCCGAGCGGACATAATCACCAAAACGTACACAATACAAATGTCAAT
AGTAATTATCGTGGTAGAAATAGTGAAGACCCACGCTTCGTACGTCACAG
TGGACCGCGCAAAGACTGGAATCGAAACAGTTCTGAAGAAGGACCGCGCT
TCCAGCGGCTCCGTGAACGACGCGGCAAAGACGACACAGGAGGGTCTTCG
TCGACGTCCTCCACGAAAGACGAGAAAATGTCTTCTCACTCTAAAAACCC
TTCTTCGAAACACGATAAAAGTTCCATTTCCTCAAATGAGGGATCTGAAG
ATTCATCCAATGCTCCTCAAATTAATGGTGATTTGAACTTGGATCTGGCT
TTGGATTTCCCAGCTCTACCAAGCCCGAACTCACCAAACGAAACTGGTAG
TAATGGATCAGCAAATAGATCTGCTTCCTCTCTCAAGGAATTGGCTGCCA
ATGTTTTGAGTGAAGTCGaatcaaataaagaaaaaccaatGACAACATCT
CCTGCAGACATGAGtgAACTTTTGACGACGGCTGAAGTTTTCGAACCAGC
AGCTACCGAACCCGCCCAAACCACTACAACGAACGCCAACGAAAACGCCC
CCTTAATCACCACAGTGGTGAGCACAGATAACGGTATACCAAAAATGCTG
AGCTATGCACAAATGGCGCAAAAACCGAACAGTAATaaggaaaattttgt
aaacGATATCGACACGGCGAAGGACATTTCAGATGCGGTCGCCGCCAGTG
ACcctaaaaaatcttcaaataataAGACGGAAAACGGCAAAAACGGACAA
TCGGCAAATggaaaacaaaatagaaaacctGGAAGTAAGAACTCTCCTAG
AAGTCAACGTCGGAAATCCAACGGACAAGACAAATCGGCGGAAGTCGAAC
AGATGAGCGTTTCTTCGAACTTAACAAATACGGTGATGAAGGAAACTTAC
GCATCTAAATTTGGTTCGTCCAGTGACTCGTCAAGAACTGGCAACTCTCC
GTCAAGACCCAAAACCCAACCAACGACTAACACAAACTCTATAAATAAGC
AAAACCCACCATCAacgaataataaaaataatagcGGCCTACCAGCGCTG
CGGCCTTTGATGAGCCAAGTCATCAATCCACCTGTCAGTAAAATGGACGA
AATCAACGGACTAGAGTTACAACAACAGCAACCGATTTCGTTCAGTGATA
CTGTTAAAAAACAATCTTCAATTGAACCTTCCACTCCTACTTCACCGAGG
TCAATAGATCTCAACTCTGTGAGTAGTCCTCCATCCTCTAATACTGTTTC
TCAACCGCCAGAGACCTCTTCAACGATAGAAGCTCCGAAAGAGAAATCAT
AGATGACTTCTGGTGTGATTGAATCACTTTCGACCTTGAGTTTGGAAACA
AACACAGAAGATACAGAGACATCGTTAGCTGACACAAATACAATTCATGG
TTCACTGGATGGGGATACATCGACGGAAGGTTCCATTTCACCTGATCTAT
TGATCACCAACGAAGTTTCTCAACCACTTCACCAACCAACGGGTCACTCT
GCAGCTGCTGTTGCCTCCTTGAATGCTAACGCCCCTGCCTTCACCTCAAT
AAGCTCAATGACTCCGGTCCTAATCaccaaaaacatagaaataggGAATG
AGCGCTGGAAACCCACGGCAACCATAGTCGAAGAAAACATTAATTCGGTC
CCGATTCACGACCTACCGCAACCGTACATTGCACCGGACGGTTTATATTA
CTGGCCGGCCGACATGATCAACGGATTCCCTCCCCAACCTGTGCTGATCG
AAAGCCTGCCAAACGGTACGGCAACGGTCATCCAAGCAGACCACGACAGC
CAGCAAGCTTTCACTCAACAAAACGCCCTCGTACGCCCTGATATAATAAC
TCAAGTTTCAGCACCGCCGCCTACACCGCCCATTAACAACGTTGTCATCC
CGCCCTCCACTAAAGACTTGACACCAGATGAGCTGAAACGCTCCATACAA
AATCAGTTTGAATATTACTTCTCACGGGAGAATTTGGCGAACGATCAATA
CTTGAACTCACAGATGGACAGCGATCAGTATGTACCGATCTCTACCGTTG
CTAAATTCAATCAAgtTCGAAAATTAACTTCAGATATTGATCTCATAGTG
GACGCACTTCGAGAATCACCATACGTGCAGTTGGACGAAACCGAACAGAA
AGTGCGTGCAAACATGAAAAGATGTATTGTCATTTTGAGAGAAATCCCAG
AAGTCACACCCATCGAGGATGTTAAAGCGTTGTTCGCAAGTCCAAACTGT
CCTAAATGGACGAGTTTCGAGTACGCATACAATGACAACTGGTATGTCAC
CTTTGAATGCGAAGATGACGCAAAGAAAGCTTACAGATATCTCCGCGAAG
AAGTCCAATCATTTCAAGGTCGGCCTCTGATGGCTAGAATCAAAGCTAAA
ACGCTACTCAGCCGGACAGTCTATCTACCAAAGAATGCGGCAAGCGCCAC
CGGTTCGACCACAACTAACACGTCACCGCCCGCCGATAATGTGACGTCAC
AATTCTCCACCACCGGTGGTGTTCCGGCGTTCACTGTGAGCCACCCGCAA
CAAATCTTTTCACCCAATTTTCAACCGTTTTACAACACAGCACCTGTGAA
CGGGAATCCCGGCATTCTTCCGGCCGGTGCTCAATGGATCAGTACAACCA
CACGATTCATTCCTCCAGAGATCCGACCGAAAAATAACTACAACAAATAC
AACAACTACCAAGGGAATAAACAATTGAATGGACAACGCCCTTACTTCCC
TGGCTCTAAGCCACGTTTCCGTAACAACTATAACAACCCCAACAAAGTAC
CGTTCCACGAAAGAAACGGGAACGTTGACTACAATTCTGAAGACCGCCCG
TCCAACGTCCCTACTAACAGGCGTAACAACAACCCGAGCGGACATAATCA
CCAAAACGTACACAATACAAATGTCAATAGTAATTATCGTGGTAGAAATA
GTGAAGACCCACGCTTCGTACGTCACAGTGGACCGCGCAAAGACTGGAAT
CGAAACAGTTCTGAAGAAGGACCGCGCTTCCAGCGGCTCCGTGAACGACG
CGGCAAAGACGACACAGGAGGGTCTTCGTCGACGTCCTCCACGAAAGACG
AGAAAATGTCTTCTCACTCTAAAAACCCTTCTTCGAAACACGATAAAAGT
TCCATTTCCTCAAATGAGGGATCTGAAGATTCATCCAATGCTCCTCAAAT
TAATGGTGATTTGAACTTGGATCTGGCTTTGGATTTCCCAGCTCTACCAA
GCCCGAACTCACCAAACGAAACTGGTAGTAATGGATCAGCAAATAGATCT
GCTTCCTCTCTCAAGGAATTGGCTGCCAATGTTTTGAGTGAAGTCGaatc
aaataaagaaaaaccaatGACAACATCTCCTGCAGACATGAGtgAACTTT
TGACGACGGCTGAAGTTTTCGAACCAGCAGCTACCGAACCCGCCCAAACC
ACTACAACGAACGCCAACGAAAACGCCCCCTTAATCACCACAGTGGTGAG
CACAGATAACGGTATACCAAAAATGCTGAGCTATGCACAAATGGCGCAAA
AACCGAACAGTAATaaggaaaattttgtaaacGATATCGACACGGCGAAG
GACATTTCAGATGCGGTCGCCGCCAGTGACcctaaaaaatcttcaaataa
taAGACGGAAAACGGCAAAAACGGACAATCGGCAAATggaaaacaaaata
gaaaacctGGAAGTAAGAACTCTCCTAGAAGTCAACGTCGGAAATCCAAC
GGACAAGACAAATCGGCGGAAGTCGAACAGATGAGCGTTTCTTCGAACTT
AACAAATACGGTGATGAAGGAAACTTACGCATCTAAATTTGGTTCGTCCA
GTGACTCGTCAAGAACTGGCAACTCTCCGTCAAGACCCAAAACCCAACCA
ACGACTAACACAAACTCTATAAATAAGCAAAACCCACCATCAacgaataa
taaaaataatagcGGCCTACCAGCGCTGCGGCCTTTGATGAGCCAAGTCA
TCAATCCACCTGTCAGTAAAATGGACGAAATCAACGGACTAGAGTTACAA
CAACAGCAACCGATTTCGTTCAGTGATACTGTTAAAAAACAATCTTCAAT
TGAACCTTCCACTCCTACTTCACCGAGGTCAATAGATCTCAACTCTGTGA
GTAGTCCTCCATCCTCTAATACTGTTTCTCAACCGCCAGAGACCTCTTCA
ACGATAGAAGCTCCGAAAGAGAAATCATAGATGACTTCTGGTGTGATTGA
ATCACTTTCGACCTTGAGTTTGGAAACAAACACAGAAGATACAGAGACAT
CGTTAGCTGACACAAATACAATTCATGGTTCACTGGATGGGGATACATCG
ACGGAAGGTTCCATTTCACCTGATCTATTGATCACCAACGAAGTTTCTCA
ACCACTTCACCAACCAACGGGTCACTCTGCAGCTGCTGTTGCCTCCTTGA
ATGCTAACGCCCCTGCCTTCACCTCAATAAGCTCAATGACTCCGGTCCTA
ATCaccaaaaacatagaaataggGAATGAGCGCTGGAAACCCACGGCAAC
CATAGTCGAAGAAAACATTAATTCGGTCCCGATTCACGACCTACCGCAAC
CGTACATTGCACCGGACGGTTTATATTACTGGCCGGCCGACATGATCAAC
GGATTCCCTCCCCAACCTGTGCTGATCGAAAGCCTGCCAAACGGTACGGC
AACGGTCATCCAAGCAGACCACGACAGCCAGCAAGCTTTCACTCAACAAA
ACGCCCTCGTACGCCCTGATATAATAACTCAAGTTTCAGCACCGCCGCCT
ACACCGCCCATTAACAACGTTGTCATCCCGCCCTCCACTAAAGACTTGAC
ACCAGATGAGCTGAAACGCTCCATACAAAATCAGTTTGAATATTACTTCT
CACGGGAGAATTTGGCGAACGATCAATACTTGAACTCACAGATGGACAGC
GATCAGTATGTACCGATCTCTACCGTTGCTAAATTCAATCAAgtTCGAAA
ATTAACTTCAGATATTGATCTCATAGTGGACGCACTTCGAGAATCACCAT
ACGTGCAGTTGGACGAAACCGAACAGAAAGTGCGTGCAAACATGAAAAGA
TGTATTGTCATTTTGAGAGAAATCCCAGAAGTCACACCCATCGAGGATGT
TAAAGCGTTGTTCGCAAGTCCAAACTGTCCTAAATGGACGAGTTTCGAGT
ACGCATACAATGACAACTGGTATGTCACCTTTGAATGCGAAGATGACGCA
AAGAAAGCTTACAGATATCTCCGCGAAGAAGTCCAATCATTTCAAGGTCG
GCCTCTGATGGCTAGAATCAAAGCTAAAACGCTACTCAGCCGGACAGTCT
ATCTACCAAAGAATGCGGCAAGCGCCACCGGTTCGACCACAACTAACACG
TCACCGCCCGCCGATAATGTGACGTCACAATTCTCCACCACCGGTGGTGT
TCCGGCGTTCACTGTGAGCCACCCGCAACAAATCTTTTCACCCAATTTTC
AACCGTTTTACAACACAGCACCTGTGAACGGGAATCCCGGCATTCTTCCG
GCCGGTGCTCAATGGATCAGTACAACCACACGATTCATTCCTCCAGAGAT
CCGACCGAAAAATAACTACAACAAATACAACAACTACCAAGGGAATAAAC
AATTGAATGGACAACGCCCTTACTTCCCTGGCTCTAAGCCACGTTTCCGT
AACAACTATAACAACCCCAACAAAGTACCGTTCCACGAAAGAAACGGGAA
CGTTGACTACAATTCTGAAGACCGCCCGTCCAACGTCCCTACTAACAGGC
GTAACAACAACCCGAGCGGACATAATCACCAAAACGTACACAATACAAAT
GTCAATAGTAATTATCGTGGTAGAAATAGTGAAGACCCACGCTTCGTACG
TCACAGTGGACCGCGCAAAGACTGGAATCGAAACAGTTCTGAAGAAGGAC
CGCGCTTCCAGCGGCTCCGTGAACGACGCGGCAAAGACGACACAGGAGGG
TCTTCGTCGACGTCCTCCACGAAAGACGAGAAAATGTCTTCTCACTCTAA
AAACCCTTCTTCGAAACACGATAAAAGTTCCATTTCCTCAAATGAGGGAT
CTGAAGATTCATCCAATGCTCCTCAAATTAATGGTGATTTGAACTTGGAT
CTGGCTTTGGATTTCCCAGCTCTACCAAGCCCGAACTCACCAAACGAAAC
TGGTAGTAATGGATCAGCAAATAGATCTGCTTCCTCTCTCAAGGAATTGG
CTGCCAATGTTTTGAGTGAAGTCGaatcaaataaagaaaaaccaatGACA
ACATCTCCTGCAGACATGAGtgAACTTTTGACGACGGCTGAAGTTTTCGA
ACCAGCAGCTACCGAACCCGCCCAAACCACTACAACGAACGCCAACGAAA
ACGCCCCCTTAATCACCACAGTGGTGAGCACAGATAACGGTATACCAAAA
ATGCTGAGCTATGCACAAATGGCGCAAAAACCGAACAGTAATaaggaaaa
ttttgtaaacGATATCGACACGGCGAAGGACATTTCAGATGCGGTCGCCG
CCAGTGACcctaaaaaatcttcaaataataAGACGGAAAACGGCAAAAAC
GGACAATCGGCAAATggaaaacaaaatagaaaacctGGAAGTAAGAACTC
TCCTAGAAGTCAACGTCGGAAATCCAACGGACAAGACAAATCGGCGGAAG
TCGAACAGATGAGCGTTTCTTCGAACTTAACAAATACGGTGATGAAGGAA
ACTTACGCATCTAAATTTGGTTCGTCCAGTGACTCGTCAAGAACTGGCAA
CTCTCCGTCAAGACCCAAAACCCAACCAACGACTAACACAAACTCTATAA
ATAAGCAAAACCCACCATCAacgaataataaaaataatagcGGCCTACCA
GCGCTGCGGCCTTTGATGAGCCAAGTCATCAATCCACCTGTCAGTAAAAT
GGACGAAATCAACGGACTAGAGTTACAACAACAGCAACCGATTTCGTTCA
GTGATACTGTTAAAAAACAATCTTCAATTGAACCTTCCACTCCTACTTCA
CCGAGGTCAATAGATCTCAACTCTGTGAGTAGTCCTCCATCCTCTAATAC
TGTTTCTCAACCGCCAGAGACCTCTTCAACGATAGAAGCTCCGAAAGAGA
AATCATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000269XLOC_000269Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000399-proteinTCONS_00000399-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000399-exon-sc0000002-1491911889:63815..64027TCONS_00000399-exon-sc0000002-1491911889:63815..64027Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:63815..64027TCONS_00000399-exon-sc0000002-1510915933:63815..64027Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:63815..64027TCONS_00000399-exon-sc0000002-1575043694:63815..64027Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:83014..83159TCONS_00000399-exon-sc0000002-1491911889:83014..83159Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:83014..83159TCONS_00000399-exon-sc0000002-1510915933:83014..83159Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:83014..83159TCONS_00000399-exon-sc0000002-1575043694:83014..83159Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:88619..89129TCONS_00000399-exon-sc0000002-1491911889:88619..89129Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:88619..89129TCONS_00000399-exon-sc0000002-1510915933:88619..89129Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:88619..89129TCONS_00000399-exon-sc0000002-1575043694:88619..89129Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:89450..89498TCONS_00000399-exon-sc0000002-1491911889:89450..89498Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:89450..89498TCONS_00000399-exon-sc0000002-1510915933:89450..89498Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:89450..89498TCONS_00000399-exon-sc0000002-1575043694:89450..89498Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:89934..90037TCONS_00000399-exon-sc0000002-1491911889:89934..90037Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:89934..90037TCONS_00000399-exon-sc0000002-1510915933:89934..90037Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:89934..90037TCONS_00000399-exon-sc0000002-1575043694:89934..90037Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:91454..91906TCONS_00000399-exon-sc0000002-1491911889:91454..91906Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:91454..91906TCONS_00000399-exon-sc0000002-1510915933:91454..91906Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:91454..91906TCONS_00000399-exon-sc0000002-1575043694:91454..91906Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:93697..93748TCONS_00000399-exon-sc0000002-1491911889:93697..93748Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:93697..93748TCONS_00000399-exon-sc0000002-1510915933:93697..93748Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:93697..93748TCONS_00000399-exon-sc0000002-1575043694:93697..93748Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:94192..94438TCONS_00000399-exon-sc0000002-1491911889:94192..94438Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:94192..94438TCONS_00000399-exon-sc0000002-1510915933:94192..94438Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:94192..94438TCONS_00000399-exon-sc0000002-1575043694:94192..94438Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:94790..95135TCONS_00000399-exon-sc0000002-1491911889:94790..95135Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:94790..95135TCONS_00000399-exon-sc0000002-1510915933:94790..95135Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:94790..95135TCONS_00000399-exon-sc0000002-1575043694:94790..95135Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:95430..95506TCONS_00000399-exon-sc0000002-1491911889:95430..95506Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:95430..95506TCONS_00000399-exon-sc0000002-1510915933:95430..95506Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:95430..95506TCONS_00000399-exon-sc0000002-1575043694:95430..95506Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:95883..97048TCONS_00000399-exon-sc0000002-1491911889:95883..97048Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:95883..97048TCONS_00000399-exon-sc0000002-1510915933:95883..97048Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:95883..97048TCONS_00000399-exon-sc0000002-1575043694:95883..97048Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1491911889:97731..100958TCONS_00000399-exon-sc0000002-1491911889:97731..100958Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1510915933:97731..100958TCONS_00000399-exon-sc0000002-1510915933:97731..100958Clytia hemisphaericaexon
TCONS_00000399-exon-sc0000002-1575043694:97731..100958TCONS_00000399-exon-sc0000002-1575043694:97731..100958Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:63815..100958 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 1.85242 3.55557 4.70884 2.11972 7.00414e-08 4.8567e-09 1.15949e-08 0 0.00332988 1.48293 5.54795e-08 1.32452 0.000646057 1.05081 0.171497 0.0138163 0.000250335 0 3.15522e-07 2.16748e-09 6.93799 4.18174 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006630La_HTH
IPR011991WHTH_DNA-bd_dom
Blast
BLAST of TCONS_00000399 vs. Swiss-Prot (Human)
Match: LARP4 (La-related protein 4 OS=Homo sapiens GN=LARP4 PE=1 SV=3)

HSP 1 Score: 216.853 bits (551), Expect = 8.903e-58
Identity = 99/174 (56.90%), Postives = 134/174 (77.01%), Query Frame = 1
Query:  712 STKDLTPDELKRSIQNQFEYYFSRENLANDQYLNSQMDSDQYVPISTVAKFNQVRKLTSDIDLIVDALRESPYVQLDETEQKVRANMKRCIVILREIPEVTPIEDVKALFASPNCPKWTSFEYAYNDNWYVTFECEDDAKKAYRYLREEVQSFQGRPLMARIKA-KTLLSRTVY 1230
            S   ++ ++LK  ++ Q E+ FSRENL+ D YL SQMDSDQ++PI TVA   +++KLT+D DLI++ LR SP VQ+DE  +KVR + KRCIVILREIPE TPIE+VK LF S NCPK  S E+A+N NWY+TF+ + DA++A++YLREEV++FQG+P+MARIKA  T  ++  Y
Sbjct:  110 SNSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETTPIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGY 283          
The following BLAST results are available for this feature:
BLAST of TCONS_00000399 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LARP48.903e-5856.90La-related protein 4 OS=Homo sapiens GN=LARP4 PE=1... [more]
back to top