Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000396 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000396
Unique NameTCONS_00000396
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2631

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000396 ID=TCONS_00000396|Name=TCONS_00000396|organism=Clytia hemisphaerica|type=transcript|length=2631bp
AACAATGTAACGCTACTGGTAAGACACCAGTCTATGAAAGCTGGTTACAA
GGAACATTACCAAATCTACTCATCATCATACCATATTAAATGGCATCAAA
TGAAGACACAGTCAAAGAGGTTGTGCTAACAAACGGAAAACAACTAACTG
CAATCAACGAAGACTATACATCGACCATCGACCCTGGCACTCCTATAATT
GTCAACAATGATCAATCTAGCTCGTCGCCAGCAAATCCTGGTTCAAAACC
AAATGAAGACATCTTGCTCCCGAGTTCACAGAGACGTAATTCAAAACAAA
GCGACAGCCCTGTACCCCCGAATTCACAGAGACGTAATTCAAAACAAAGC
GACAACCCTGTACCCCCGAATTCATCGAGACGTAACTCAAAACAAAGCGA
CCCTGAAGTGCCAAATTCACCGAGACGTAACTCTAAGCAAAGCGAGAGCC
CTACGCTGCCAAATTCACAGAGACGTAATTCAGAACAAAGTGAAGACTCA
AATTCACAGAAACGTAACTCTAAACAAAGCGAGAGCCCTGTGCTCCCGAA
CTCACAGAGGCGTAATTCAAAACAGAGCGACGATCCTGTAAACCCAAAGT
CCCGATCACGCAATTCCAAACAAAGCGAAGATTTAAATTCACAGAGACGT
AGCTCAAAACAACAAGAAAGTCCTAAAGACTTTGATCTCGAAGAAAACGC
ACTTACAATTTTACCCAGAGTAAACAATGTTTTATCTCCAAGTGATACAT
CATTTGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAAATAGAAAACCA
TCAAAAAGCGCAATTAAAAGATTCAAAGCTAACAACAAGCAGGATGAAAC
AACAAAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGGGCTTTCAGGCA
TAAAACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTCTAGACATACAT
ATCCCGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGCTATGCAGTTAG
CATTGAGGGAAATGAACCTCCATATGATTTTGATCAACAATATGGACGAT
TACCGAGGCCAACAATGGCGGCACCACAACCTCGAACACGTATCTATAAA
ACTCGTTGGTACATTCTTGCCGTTTTTACGGCGTACGTTGCAATGCAGTA
TTTTATATGGAACTCCTTTGGACCCATCGCATCTTCAGTTAAAACAGCTT
ATGGATGGGAAAATTCAGATATTACATTGTTAGCCAGTTGGGATACCATT
CTATATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTGCAAAAAAGAGG
TTTAAGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGTCATTGGAGCTT
TATTTCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAACGTACATGAAC
ACCGGACAAATCTTAAACGGTCTTGGTGGGATGTTAGCACAAGCTGCTGG
TCCTGTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCGGACCCGAGCCA
CCGCTATTTCCACTTTAGCATCACAAGGCGGGCTTGCTCTATCTTATATC
ATTGGACCAGCTATAGTCAAGGAAGAAGCACACATTCGGGAAAGTTTCCC
AAACATCACAACACGCGCTTTAGAAGCGGAGCTACGAGATGAGATCAGCA
CTTTCATGTACAAAGAACTTCTAGTCACATGTTTTATAACAGCATGTGCT
ATGCTTTATTTCCCTAACAAGCCCAAACTACCACCATCACTGTCCGCTAG
TTTAACAAAACTACAGTTTCGTGATGGATTTAAAAGACTTTTTAAAATGA
GAAATTATTGGTATATTCTGTTCATTGCTGCATCTTCAACTGGTATCTAC
AGTGGTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGATCATGGTCTTGG
CATCACACAAagtgAATGTGGTTTAATGGGTTTTGCTTCAACAGTGTTCA
GCGCAATCGGCGGAATAGCGCTTGGTTATTTATCGGACAAGTGGCCCGGA
CACATGAGACATTTATTGATCATATTATTTAGTTTGGCTTTTATCATGTT
TTGTTGGATCACAGTGATTTGTTTGAAAGTGTTTACTTATAGATTGGATA
TGTTGTACATTCCATGTCTGATTGGTGGCTTTTGTATCAACGGATCAACT
CCCTTGATGTACGAGATGATCATAGAATTAACTTACCCTATACCAGAAAC
TGTCAGCATCGGATTTCTTGGTGTGGTCAATAATATCTTCACTTTTGCTT
TTTTGTTGCTCTTCAACGTCCCTAAAATAGGTGTTGTATGGACAAATTGG
TGTTTGATAGCTACTTGCTTCATATGTCTATTACTCCTTACAAGATTCAA
AGAGAAATATTATCGCATGAAAATTGATGGCATTTCGGTGACATCAATTG
AAAGGAGAGTAGAAAGTACTATCGAAAGAAGACTACACGGAATAAATTCG
ATGGCACCAACAGCTAAAAGGTTTATCTCTGATATGAGAGGGATTGCTGT
TGTTAGTTTTTCAAGCGATGACATCATTACCTCACCCAATTTGGAGCCAA
CACCTAACCGAAGCTACAGTTATTGATGGAAATAACACGGCTAATGCAAA
TAAACCAGCAACAACTTTGAAACTGTAAAAG
Run BLAST on NCBI

protein sequence of TCONS_00000396-protein

>TCONS_00000396-protein ID=TCONS_00000396-protein|Name=TCONS_00000396-protein|organism=Clytia hemisphaerica|type=polypeptide|length=828bp
MASNEDTVKEVVLTNGKQLTAINEDYTSTIDPGTPIIVNNDQSSSSPANP
GSKPNEDILLPSSQRRNSKQSDSPVPPNSQRRNSKQSDNPVPPNSSRRNS
KQSDPEVPNSPRRNSKQSESPTLPNSQRRNSEQSEDSNSQKRNSKQSESP
VLPNSQRRNSKQSDDPVNPKSRSRNSKQSEDLNSQRRSSKQQESPKDFDL
EENALTILPRVNNVLSPSDTSFEEIVLCDPPLANRKPSKSAIKRFKANNK
QDETTKSSLKKSPLLAGLSGIKQKFSSVRFSSILDIHIPSETHPQSDEPS
YAVSIEGNEPPYDFDQQYGRLPRPTMAAPQPRTRIYKTRWYILAVFTAYV
AMQYFIWNSFGPIASSVKTAYGWENSDITLLASWDTILYVIFSLEVCWLV
QKRGLRKSFLCSLFLVVIGALFRCFAVRETKVKTYMNTGQILNGLGGMLA
QAAGPVVSSNWFPPDERTRATAISTLASQGGLALSYIIGPAIVKEEAHIR
ESFPNITTRALEAELRDEISTFMYKELLVTCFITACAMLYFPNKPKLPPS
LSASLTKLQFRDGFKRLFKMRNYWYILFIAASSTGIYSGWAAVLYLNLSD
HGLGITQSECGLMGFASTVFSAIGGIALGYLSDKWPGHMRHLLIILFSLA
FIMFCWITVICLKVFTYRLDMLYIPCLIGGFCINGSTPLMYEMIIELTYP
IPETVSIGFLGVVNNIFTFAFLLLFNVPKIGVVWTNWCLIATCFICLLLL
TRFKEKYYRMKIDGISVTSIERRVESTIERRLHGINSMAPTAKRFISDMR
GIAVVSFSSDDIITSPNLEPTPNRSYSY
Run BLAST on NCBI

transcript from alignment at sc0000002:36021..40946+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000396 ID=TCONS_00000396|Name=TCONS_00000396|organism=Clytia hemisphaerica|type=transcript|length=4926bp|location=Sequence derived from alignment at sc0000002:36021..40946+ (Clytia hemisphaerica)
AACAATGTAACGCTACTGGTAAGACACCAGTCTATGAAAGCTGGTTACAA GGAACATTACCAAATCTACTCATCATCATACCATATTAAATGGCATCAAA TGAAGACACAGTCAAAGAGGTTGTGCTAACAAACGGAAAACAACTAACTG CAATCAACGAAGACTATACATCGACCATCGACCCTGGCACTCCTATAATT GTCAACAATGATCAATCTAGCTCGTCGCCAGCAAATCCTGGTTCAAAACC AAATGAAGACATCTTGCTCCCGAGTTCACAGAGACGTAATTCAAAACAAA GCGACAGCCCTGTACCCCCGAATTCACAGAGACGTAATTCAAAACAAAGC GACAACCCTGTACCCCCGAATTCATCGAGACGTAACTCAAAACAAAGCGA CCCTGAAGTGCCAAATTCACCGAGACGTAACTCTAAGCAAAGCGAGAGCC CTACGCTGCCAAATTCACAGAGACGTAATTCAGAACAAAGTGAAGACTCA AATTCACAGAAACGTAACTCTAAACAAAGCGAGAGCCCTGTGCTCCCGAA CTCACAGAGGCGTAATTCAAAACAGAGCGACGATCCTGTAAACCCAAAGT CCCGATCACGCAATTCCAAACAAAGCGAAGATTTAAATTCACAGAGACGT AGCTCAAAACAACAAGAAAGTCCTAAAGACTTTGATCTCGAAGAAAACGC ACTTACAATTTTACCCAGAGTAAACAATGTTTTATCTCCAAGTGATACAT CATTTGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAAATAGAAAACCA TCAAAAAGCGCAATTAAAAGATTCAAAGCTAACAACAAGCAGGATGAAAC AACAAAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGGTAAGGAATTTC TAGACTACCTTAAGGGACCtgatttttgcgggaactaaattttgcggttt ttgcgTATTTAGACCCAAGCCGTAAAATTAAGTTTCcgccaaatttttcg aaatgcgaaaaacaaaggtcgaataattcacagtacggctctaattttct ttcaagtgagaaatccgcaaagttaagttcccgcaaatattaaatattaa atcttgaaccgcgaaccgcaaaaattagttcctgcaaaaaatagtgttca gacgttacggtttcgtacCTCTCCGGTGTGGTATTTGTTACGGATAGgaa gtgttcatattggtttcgaaAAGTTTCGGGGAAACGAAGCAGAGCAGTTC CGTTCCAATaaaaatagtggagcgaaactGTTTCGAAACAGTTTGTAACG ACTTCTTTTTTAACGTTTCGAATtctgacgttcacacttgtttcggaacc gtttcgtttcggataTCGTTacaaaccgtaacgtctgaacgcGGTCTCAG AAACGTTAAAACAGAAGGCGTCAATTTCCTTTTTATCCATGATTACGACT TAAGGTTGTAGAGAAATAAAAGCAATTAGTTTCTACTTGGGAAATAAGCT ATCTTAACTTCACCTCGAATCAAAGTTCCTAACGAACCAACAACACATCC CCTCGTGGTCATCATTCTAATCAAATGcttacaaaattatttttctgaca ATAGAAAAGGTACTCCACCAAAAACTAAAGAGATGCGAGTCAATGCATAC TATTCATATTTTCATTAACAAAAATTGATTCATTTTCAGGGCTTTCAGGC ATAAAACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTCTAGACATACA TATCCCGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGCTATGCAGTTA GCATTGAGGGAAATGAACCTCCATATGATTTTGATCAACAATATGGACGA TTACCGAGGCCAACAATGGCGGCACCACAACCTCGAACACGTATCTATAA AACTCGTTGGTACATTCTTGCCGTTTTTACGGCGTACGTTGCAATGCAGT ATTTTATATGGAACTCCTTTGGACCCATCGCATCTTCAGTTAAAACAGCT TATGGATGGGAAAATTCAGATATTACATTGTTAGCCAGTTGGGATACCAT TCTATATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTGCAAAAAAGAG GTAAGTACAAAATTCTCTTACAATCAATAGGTCATTATTAGGAATCTTAC CATTTTATGCCAAAACGCTCTGGCTGTTTTAAAAGTTGAAACTCGTAGTA GAGGTAATAATAATTCAAAGGGCCATAACTTCCGATAGCATATTCTGCTT gctttttattgcattttctgGGGTTACTAGCGACTTCGCAGGATTTTGAC ATAAGAACTAACAAGAGCTTTGTATAACAGGGGAAGGTATATTATCCTCA CATTATGGCGAAATTATTTTAACAGTTAATTATGTTTCTAAAATTCAGGT TTAAGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGTCATTGGAGCTTT ATTTCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAACGTACATGAACA CCGGACAAATCTTAAACGGTCTTGGTGGGATGTTAGCACAAGCTGCTGGT CCTGTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCGGACCCGAGCCAC CGCTATTTCCACTTTAGCATCACAAGGCGGGCTTGCTCTATCTTATATCA TTGGACCAGCTATAGTCAAGGAAGAAGCACACATTCGGGAAAGTTTCCCA AACATCACAACACGCGCTTTAGAAGCGGAGCTACGAGATGAGATCAGCAC TTTCATGTACAAAGAACTTCTAGTCACATGTTTTATAACAGCATGTGCTA TGCTTTATTTCCCTAACAAGCCCAAACTACCACCATCACTGTCCGCTAGT TTAACAAAACTACAGTTTCGTGATGGATTTAAAAGACTTTTTAAAATGAG AAATTATTGGTATATTCTGTTCATTGCTGCATCTTCAACTGGTATCTACA GTGGTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGATCATGGTCTTGGC ATCACACAAGTTAGTAGACTTATTATCTTTCAGACTTACAgtttgacgct ctctaattcgatttccaAAGGGAAagggattttcatcgaataatggagcg tatagAGCGTAGTTTATAAGACTTAAAGACTTAAAAAAGTATATTATGCA ATAATTTTTCATGCTTTCTTAAGTTACGGTAATTTCCACCGTtttggaag caaacgttcgactTTTTGGAAGCGATCCCTTTCACAAATCGAACGTTTAC TCCCATAATGTCAAGTTACGTAATTTAACAAAATATAAATacctcaacaa caacaaaaggcAATTTCACGGTCAAAACGAGTCATGACggtaattagaaa aaaaaactaataacgACTTCCCGGGGTTGATCATAATAATATcgaatttt taaattgtttggCCAATAGTAATAGGGAGAGGGTATATAGATCCTGAATT GCCAATGATTCTCTTCGACcgtgaaaaagctttttttttattttagagtg AATGTGGTTTAATGGGTTTTGCTTCAACAGTGTTCAGCGCAATCGGCGGA ATAGCGCTTGGTTATTTATCGGACAAGTGGCCCGGACACATGAGACATTT ATTGATCATATTATTTAGTTTGGCTTTTATCATGTTTTGTTGGATCACAG TGATTTGTTTGAAAGTGTTTACTTATAGATTGGGTAAGTGATTTTTTGCT GGCGCAATGCTCTATGGCTAATCTTTTGGTCCTACAGCAGATAGGTCTGA ATCTCAAAGAACCACAATCCGATGATATTCAATATTCCTCAGATTTTTGA AGAATTGAGGGCTTCAAAGTTTTAGGGCTCATTTTGCAAAACAAATAATA ATTAAACGGTTTCTTCCCATCCGCAAGATTTAATACCCCCTGAAAAACCG TTTTCCCCGACTATCCGCCCAATAAAATTCAcgccaaaatttcatttttt caaggtacattgtagaattttttttttcatttccccCTTAGATATGTTGT ACATTCCATGTCTGATTGGTGGCTTTTGTATCAACGGATCAACTCCCTTG ATGTACGAGATGATCATAGAATTAACTTACCCTATACCAGAAACTGTCAG CATCGGATTTCTTGGTGTGGTCAATAATATCTTCACTTTTGCTTTTTTGT TGCTCTTCAACGTCCCTAAAATAGGTAAGAAATTCGTTTTAATGAAAATC AGTCAAGACAAAGAATGTATAATGAATGACTCAATTGTTAACAAGACAAA TGTCAATCTGACAGAATCGACGATCAATTCAATAAACCTtattggagttt ttgatttttctaaaatagcGATGCATTGttggattgtttcgagtgtatta attacaatagaattcactcgaggaattcctaagaaaaatcaaaaactcca ataaggtctattgaaccaaatcgaacggATGTCTTTGGACAATTTACTTT TAACAATTTCTCAAAACTCatgaaaaacaatgaaactaatGAAAGTAACC AAACTTCAACAAAAAGTTATTGGACCTTATAAAAAGCGTTTAAACATAAT TTTATTACATTTCTTATTTTCTTAGGTGTTGTATGGACAAATTGGTGTTT GATAGCTACTTGCTTCATATGTCTATTACTCCTTACAAGATTCAAAGAGA AATATTATCGCATGAAAATTGATGGCATTTCGGTGACATCAATTGAAAGG AGAGTAGAAAGTACTATCGAAAGAAGACTACACGGAATAAATTCGATGGC ACCAACAGCTAAAAGGTTTATCTCTGATATGAGAGGGATTGCTGTTGTTA GTTTTTCAAGCGATGACATCATTACCTCACCCAATTTGGAGCCAACACCT AACCGAAGCTACAGTTATTGATGGAAATAACACGGCTAATGCAAATAAAC CAGCAACAACTTTGAAACTGTAAAAG

Coding sequence (CDS) from alignment at sc0000002:36021..40946+

>TCONS_00000396 ID=TCONS_00000396|Name=TCONS_00000396|organism=Clytia hemisphaerica|type=CDS|length=14922bp|location=Sequence derived from alignment at sc0000002:36021..40946+ (Clytia hemisphaerica)
ATGGCATCAAATGAAGACACAGTCAAAGAGGTTGTGCTAACAAACGGAAA
ACAACTAACTGCAATCAACGAAGACTATACATCGACCATCGACCCTGGCA
CTCCTATAATTGTCAACAATGATCAATCTAGCTCGTCGCCAGCAAATCCT
GGTTCAAAACCAAATGAAGACATCTTGCTCCCGAGTTCACAGAGACGTAA
TTCAAAACAAAGCGACAGCCCTGTACCCCCGAATTCACAGAGACGTAATT
CAAAACAAAGCGACAACCCTGTACCCCCGAATTCATCGAGACGTAACTCA
AAACAAAGCGACCCTGAAGTGCCAAATTCACCGAGACGTAACTCTAAGCA
AAGCGAGAGCCCTACGCTGCCAAATTCACAGAGACGTAATTCAGAACAAA
GTGAAGACTCAAATTCACAGAAACGTAACTCTAAACAAAGCGAGAGCCCT
GTGCTCCCGAACTCACAGAGGCGTAATTCAAAACAGAGCGACGATCCTGT
AAACCCAAAGTCCCGATCACGCAATTCCAAACAAAGCGAAGATTTAAATT
CACAGAGACGTAGCTCAAAACAACAAGAAAGTCCTAAAGACTTTGATCTC
GAAGAAAACGCACTTACAATTTTACCCAGAGTAAACAATGTTTTATCTCC
AAGTGATACATCATTTGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAA
ATAGAAAACCATCAAAAAGCGCAATTAAAAGATTCAAAGCTAACAACAAG
CAGGATGAAACAACAAAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGG
GCTTTCAGGCATAAAACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTC
TAGACATACATATCCCGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGC
TATGCAGTTAGCATTGAGGGAAATGAACCTCCATATGATTTTGATCAACA
ATATGGACGATTACCGAGGCCAACAATGGCGGCACCACAACCTCGAACAC
GTATCTATAAAACTCGTTGGTACATTCTTGCCGTTTTTACGGCGTACGTT
GCAATGCAGTATTTTATATGGAACTCCTTTGGACCCATCGCATCTTCAGT
TAAAACAGCTTATGGATGGGAAAATTCAGATATTACATTGTTAGCCAGTT
GGGATACCATTCTATATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTG
CAAAAAAGAGGTTTAAGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGT
CATTGGAGCTTTATTTCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAA
CGTACATGAACACCGGACAAATCTTAAACGGTCTTGGTGGGATGTTAGCA
CAAGCTGCTGGTCCTGTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCG
GACCCGAGCCACCGCTATTTCCACTTTAGCATCACAAGGCGGGCTTGCTC
TATCTTATATCATTGGACCAGCTATAGTCAAGGAAGAAGCACACATTCGG
GAAAGTTTCCCAAACATCACAACACGCGCTTTAGAAGCGGAGCTACGAGA
TGAGATCAGCACTTTCATGTACAAAGAACTTCTAGTCACATGTTTTATAA
CAGCATGTGCTATGCTTTATTTCCCTAACAAGCCCAAACTACCACCATCA
CTGTCCGCTAGTTTAACAAAACTACAGTTTCGTGATGGATTTAAAAGACT
TTTTAAAATGAGAAATTATTGGTATATTCTGTTCATTGCTGCATCTTCAA
CTGGTATCTACAGTGGTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGAT
CATGGTCTTGGCATCACACAAagtgAATGTGGTTTAATGGGTTTTGCTTC
AACAGTGTTCAGCGCAATCGGCGGAATAGCGCTTGGTTATTTATCGGACA
AGTGGCCCGGACACATGAGACATTTATTGATCATATTATTTAGTTTGGCT
TTTATCATGTTTTGTTGGATCACAGTGATTTGTTTGAAAGTGTTTACTTA
TAGATTGGATATGTTGTACATTCCATGTCTGATTGGTGGCTTTTGTATCA
ACGGATCAACTCCCTTGATGTACGAGATGATCATAGAATTAACTTACCCT
ATACCAGAAACTGTCAGCATCGGATTTCTTGGTGTGGTCAATAATATCTT
CACTTTTGCTTTTTTGTTGCTCTTCAACGTCCCTAAAATAGGTGTTGTAT
GGACAAATTGGTGTTTGATAGCTACTTGCTTCATATGTCTATTACTCCTT
ACAAGATTCAAAGAGAAATATTATCGCATGAAAATTGATGGCATTTCGGT
GACATCAATTGAAAGGAGAGTAGAAAGTACTATCGAAAGAAGACTACACG
GAATAAATTCGATGGCACCAACAGCTAAAAGGTTTATCTCTGATATGAGA
GGGATTGCTGTTGTTAGTTTTTCAAGCGATGACATCATTACCTCACCCAA
TTTGGAGCCAACACCTAACCGAAGCTACAGTTATTGAATGGCATCAAATG
AAGACACAGTCAAAGAGGTTGTGCTAACAAACGGAAAACAACTAACTGCA
ATCAACGAAGACTATACATCGACCATCGACCCTGGCACTCCTATAATTGT
CAACAATGATCAATCTAGCTCGTCGCCAGCAAATCCTGGTTCAAAACCAA
ATGAAGACATCTTGCTCCCGAGTTCACAGAGACGTAATTCAAAACAAAGC
GACAGCCCTGTACCCCCGAATTCACAGAGACGTAATTCAAAACAAAGCGA
CAACCCTGTACCCCCGAATTCATCGAGACGTAACTCAAAACAAAGCGACC
CTGAAGTGCCAAATTCACCGAGACGTAACTCTAAGCAAAGCGAGAGCCCT
ACGCTGCCAAATTCACAGAGACGTAATTCAGAACAAAGTGAAGACTCAAA
TTCACAGAAACGTAACTCTAAACAAAGCGAGAGCCCTGTGCTCCCGAACT
CACAGAGGCGTAATTCAAAACAGAGCGACGATCCTGTAAACCCAAAGTCC
CGATCACGCAATTCCAAACAAAGCGAAGATTTAAATTCACAGAGACGTAG
CTCAAAACAACAAGAAAGTCCTAAAGACTTTGATCTCGAAGAAAACGCAC
TTACAATTTTACCCAGAGTAAACAATGTTTTATCTCCAAGTGATACATCA
TTTGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAAATAGAAAACCATC
AAAAAGCGCAATTAAAAGATTCAAAGCTAACAACAAGCAGGATGAAACAA
CAAAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGGGCTTTCAGGCATA
AAACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTCTAGACATACATAT
CCCGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGCTATGCAGTTAGCA
TTGAGGGAAATGAACCTCCATATGATTTTGATCAACAATATGGACGATTA
CCGAGGCCAACAATGGCGGCACCACAACCTCGAACACGTATCTATAAAAC
TCGTTGGTACATTCTTGCCGTTTTTACGGCGTACGTTGCAATGCAGTATT
TTATATGGAACTCCTTTGGACCCATCGCATCTTCAGTTAAAACAGCTTAT
GGATGGGAAAATTCAGATATTACATTGTTAGCCAGTTGGGATACCATTCT
ATATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTGCAAAAAAGAGGTT
TAAGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGTCATTGGAGCTTTA
TTTCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAACGTACATGAACAC
CGGACAAATCTTAAACGGTCTTGGTGGGATGTTAGCACAAGCTGCTGGTC
CTGTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCGGACCCGAGCCACC
GCTATTTCCACTTTAGCATCACAAGGCGGGCTTGCTCTATCTTATATCAT
TGGACCAGCTATAGTCAAGGAAGAAGCACACATTCGGGAAAGTTTCCCAA
ACATCACAACACGCGCTTTAGAAGCGGAGCTACGAGATGAGATCAGCACT
TTCATGTACAAAGAACTTCTAGTCACATGTTTTATAACAGCATGTGCTAT
GCTTTATTTCCCTAACAAGCCCAAACTACCACCATCACTGTCCGCTAGTT
TAACAAAACTACAGTTTCGTGATGGATTTAAAAGACTTTTTAAAATGAGA
AATTATTGGTATATTCTGTTCATTGCTGCATCTTCAACTGGTATCTACAG
TGGTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGATCATGGTCTTGGCA
TCACACAAagtgAATGTGGTTTAATGGGTTTTGCTTCAACAGTGTTCAGC
GCAATCGGCGGAATAGCGCTTGGTTATTTATCGGACAAGTGGCCCGGACA
CATGAGACATTTATTGATCATATTATTTAGTTTGGCTTTTATCATGTTTT
GTTGGATCACAGTGATTTGTTTGAAAGTGTTTACTTATAGATTGGATATG
TTGTACATTCCATGTCTGATTGGTGGCTTTTGTATCAACGGATCAACTCC
CTTGATGTACGAGATGATCATAGAATTAACTTACCCTATACCAGAAACTG
TCAGCATCGGATTTCTTGGTGTGGTCAATAATATCTTCACTTTTGCTTTT
TTGTTGCTCTTCAACGTCCCTAAAATAGGTGTTGTATGGACAAATTGGTG
TTTGATAGCTACTTGCTTCATATGTCTATTACTCCTTACAAGATTCAAAG
AGAAATATTATCGCATGAAAATTGATGGCATTTCGGTGACATCAATTGAA
AGGAGAGTAGAAAGTACTATCGAAAGAAGACTACACGGAATAAATTCGAT
GGCACCAACAGCTAAAAGGTTTATCTCTGATATGAGAGGGATTGCTGTTG
TTAGTTTTTCAAGCGATGACATCATTACCTCACCCAATTTGGAGCCAACA
CCTAACCGAAGCTACAGTTATTGAATGGCATCAAATGAAGACACAGTCAA
AGAGGTTGTGCTAACAAACGGAAAACAACTAACTGCAATCAACGAAGACT
ATACATCGACCATCGACCCTGGCACTCCTATAATTGTCAACAATGATCAA
TCTAGCTCGTCGCCAGCAAATCCTGGTTCAAAACCAAATGAAGACATCTT
GCTCCCGAGTTCACAGAGACGTAATTCAAAACAAAGCGACAGCCCTGTAC
CCCCGAATTCACAGAGACGTAATTCAAAACAAAGCGACAACCCTGTACCC
CCGAATTCATCGAGACGTAACTCAAAACAAAGCGACCCTGAAGTGCCAAA
TTCACCGAGACGTAACTCTAAGCAAAGCGAGAGCCCTACGCTGCCAAATT
CACAGAGACGTAATTCAGAACAAAGTGAAGACTCAAATTCACAGAAACGT
AACTCTAAACAAAGCGAGAGCCCTGTGCTCCCGAACTCACAGAGGCGTAA
TTCAAAACAGAGCGACGATCCTGTAAACCCAAAGTCCCGATCACGCAATT
CCAAACAAAGCGAAGATTTAAATTCACAGAGACGTAGCTCAAAACAACAA
GAAAGTCCTAAAGACTTTGATCTCGAAGAAAACGCACTTACAATTTTACC
CAGAGTAAACAATGTTTTATCTCCAAGTGATACATCATTTGAAGAAATCG
TTTTGTGTGACCCCCCACTGGCAAATAGAAAACCATCAAAAAGCGCAATT
AAAAGATTCAAAGCTAACAACAAGCAGGATGAAACAACAAAGTCTTCACT
TAAAAAGAGTCCACTTTTGGCCGGGCTTTCAGGCATAAAACAGAAATTTA
GTTCAGTTCGCTTCAGCTCGATTCTAGACATACATATCCCGTCCGAAACT
CATCCCCAGAGCGATGAGCCAAGCTATGCAGTTAGCATTGAGGGAAATGA
ACCTCCATATGATTTTGATCAACAATATGGACGATTACCGAGGCCAACAA
TGGCGGCACCACAACCTCGAACACGTATCTATAAAACTCGTTGGTACATT
CTTGCCGTTTTTACGGCGTACGTTGCAATGCAGTATTTTATATGGAACTC
CTTTGGACCCATCGCATCTTCAGTTAAAACAGCTTATGGATGGGAAAATT
CAGATATTACATTGTTAGCCAGTTGGGATACCATTCTATATGTGATTTTT
TCGTTAGAAGTTTGTTGGCTAGTGCAAAAAAGAGGTTTAAGGAAATCATT
TCTCTGTTCATTGTTTCTGGTGGTCATTGGAGCTTTATTTCGTTGCTTTG
CTGTCCGAGAAACAAAAGTCAAAACGTACATGAACACCGGACAAATCTTA
AACGGTCTTGGTGGGATGTTAGCACAAGCTGCTGGTCCTGTGGTCTCCAG
TAATTGGTTCCCACCAGATGAGCGGACCCGAGCCACCGCTATTTCCACTT
TAGCATCACAAGGCGGGCTTGCTCTATCTTATATCATTGGACCAGCTATA
GTCAAGGAAGAAGCACACATTCGGGAAAGTTTCCCAAACATCACAACACG
CGCTTTAGAAGCGGAGCTACGAGATGAGATCAGCACTTTCATGTACAAAG
AACTTCTAGTCACATGTTTTATAACAGCATGTGCTATGCTTTATTTCCCT
AACAAGCCCAAACTACCACCATCACTGTCCGCTAGTTTAACAAAACTACA
GTTTCGTGATGGATTTAAAAGACTTTTTAAAATGAGAAATTATTGGTATA
TTCTGTTCATTGCTGCATCTTCAACTGGTATCTACAGTGGTTGGGCAGCT
GTGTTGTATTTGAACCTAAGTGATCATGGTCTTGGCATCACACAAagtgA
ATGTGGTTTAATGGGTTTTGCTTCAACAGTGTTCAGCGCAATCGGCGGAA
TAGCGCTTGGTTATTTATCGGACAAGTGGCCCGGACACATGAGACATTTA
TTGATCATATTATTTAGTTTGGCTTTTATCATGTTTTGTTGGATCACAGT
GATTTGTTTGAAAGTGTTTACTTATAGATTGGATATGTTGTACATTCCAT
GTCTGATTGGTGGCTTTTGTATCAACGGATCAACTCCCTTGATGTACGAG
ATGATCATAGAATTAACTTACCCTATACCAGAAACTGTCAGCATCGGATT
TCTTGGTGTGGTCAATAATATCTTCACTTTTGCTTTTTTGTTGCTCTTCA
ACGTCCCTAAAATAGGTGTTGTATGGACAAATTGGTGTTTGATAGCTACT
TGCTTCATATGTCTATTACTCCTTACAAGATTCAAAGAGAAATATTATCG
CATGAAAATTGATGGCATTTCGGTGACATCAATTGAAAGGAGAGTAGAAA
GTACTATCGAAAGAAGACTACACGGAATAAATTCGATGGCACCAACAGCT
AAAAGGTTTATCTCTGATATGAGAGGGATTGCTGTTGTTAGTTTTTCAAG
CGATGACATCATTACCTCACCCAATTTGGAGCCAACACCTAACCGAAGCT
ACAGTTATTGAATGGCATCAAATGAAGACACAGTCAAAGAGGTTGTGCTA
ACAAACGGAAAACAACTAACTGCAATCAACGAAGACTATACATCGACCAT
CGACCCTGGCACTCCTATAATTGTCAACAATGATCAATCTAGCTCGTCGC
CAGCAAATCCTGGTTCAAAACCAAATGAAGACATCTTGCTCCCGAGTTCA
CAGAGACGTAATTCAAAACAAAGCGACAGCCCTGTACCCCCGAATTCACA
GAGACGTAATTCAAAACAAAGCGACAACCCTGTACCCCCGAATTCATCGA
GACGTAACTCAAAACAAAGCGACCCTGAAGTGCCAAATTCACCGAGACGT
AACTCTAAGCAAAGCGAGAGCCCTACGCTGCCAAATTCACAGAGACGTAA
TTCAGAACAAAGTGAAGACTCAAATTCACAGAAACGTAACTCTAAACAAA
GCGAGAGCCCTGTGCTCCCGAACTCACAGAGGCGTAATTCAAAACAGAGC
GACGATCCTGTAAACCCAAAGTCCCGATCACGCAATTCCAAACAAAGCGA
AGATTTAAATTCACAGAGACGTAGCTCAAAACAACAAGAAAGTCCTAAAG
ACTTTGATCTCGAAGAAAACGCACTTACAATTTTACCCAGAGTAAACAAT
GTTTTATCTCCAAGTGATACATCATTTGAAGAAATCGTTTTGTGTGACCC
CCCACTGGCAAATAGAAAACCATCAAAAAGCGCAATTAAAAGATTCAAAG
CTAACAACAAGCAGGATGAAACAACAAAGTCTTCACTTAAAAAGAGTCCA
CTTTTGGCCGGGCTTTCAGGCATAAAACAGAAATTTAGTTCAGTTCGCTT
CAGCTCGATTCTAGACATACATATCCCGTCCGAAACTCATCCCCAGAGCG
ATGAGCCAAGCTATGCAGTTAGCATTGAGGGAAATGAACCTCCATATGAT
TTTGATCAACAATATGGACGATTACCGAGGCCAACAATGGCGGCACCACA
ACCTCGAACACGTATCTATAAAACTCGTTGGTACATTCTTGCCGTTTTTA
CGGCGTACGTTGCAATGCAGTATTTTATATGGAACTCCTTTGGACCCATC
GCATCTTCAGTTAAAACAGCTTATGGATGGGAAAATTCAGATATTACATT
GTTAGCCAGTTGGGATACCATTCTATATGTGATTTTTTCGTTAGAAGTTT
GTTGGCTAGTGCAAAAAAGAGGTTTAAGGAAATCATTTCTCTGTTCATTG
TTTCTGGTGGTCATTGGAGCTTTATTTCGTTGCTTTGCTGTCCGAGAAAC
AAAAGTCAAAACGTACATGAACACCGGACAAATCTTAAACGGTCTTGGTG
GGATGTTAGCACAAGCTGCTGGTCCTGTGGTCTCCAGTAATTGGTTCCCA
CCAGATGAGCGGACCCGAGCCACCGCTATTTCCACTTTAGCATCACAAGG
CGGGCTTGCTCTATCTTATATCATTGGACCAGCTATAGTCAAGGAAGAAG
CACACATTCGGGAAAGTTTCCCAAACATCACAACACGCGCTTTAGAAGCG
GAGCTACGAGATGAGATCAGCACTTTCATGTACAAAGAACTTCTAGTCAC
ATGTTTTATAACAGCATGTGCTATGCTTTATTTCCCTAACAAGCCCAAAC
TACCACCATCACTGTCCGCTAGTTTAACAAAACTACAGTTTCGTGATGGA
TTTAAAAGACTTTTTAAAATGAGAAATTATTGGTATATTCTGTTCATTGC
TGCATCTTCAACTGGTATCTACAGTGGTTGGGCAGCTGTGTTGTATTTGA
ACCTAAGTGATCATGGTCTTGGCATCACACAAagtgAATGTGGTTTAATG
GGTTTTGCTTCAACAGTGTTCAGCGCAATCGGCGGAATAGCGCTTGGTTA
TTTATCGGACAAGTGGCCCGGACACATGAGACATTTATTGATCATATTAT
TTAGTTTGGCTTTTATCATGTTTTGTTGGATCACAGTGATTTGTTTGAAA
GTGTTTACTTATAGATTGGATATGTTGTACATTCCATGTCTGATTGGTGG
CTTTTGTATCAACGGATCAACTCCCTTGATGTACGAGATGATCATAGAAT
TAACTTACCCTATACCAGAAACTGTCAGCATCGGATTTCTTGGTGTGGTC
AATAATATCTTCACTTTTGCTTTTTTGTTGCTCTTCAACGTCCCTAAAAT
AGGTGTTGTATGGACAAATTGGTGTTTGATAGCTACTTGCTTCATATGTC
TATTACTCCTTACAAGATTCAAAGAGAAATATTATCGCATGAAAATTGAT
GGCATTTCGGTGACATCAATTGAAAGGAGAGTAGAAAGTACTATCGAAAG
AAGACTACACGGAATAAATTCGATGGCACCAACAGCTAAAAGGTTTATCT
CTGATATGAGAGGGATTGCTGTTGTTAGTTTTTCAAGCGATGACATCATT
ACCTCACCCAATTTGGAGCCAACACCTAACCGAAGCTACAGTTATTGAAT
GGCATCAAATGAAGACACAGTCAAAGAGGTTGTGCTAACAAACGGAAAAC
AACTAACTGCAATCAACGAAGACTATACATCGACCATCGACCCTGGCACT
CCTATAATTGTCAACAATGATCAATCTAGCTCGTCGCCAGCAAATCCTGG
TTCAAAACCAAATGAAGACATCTTGCTCCCGAGTTCACAGAGACGTAATT
CAAAACAAAGCGACAGCCCTGTACCCCCGAATTCACAGAGACGTAATTCA
AAACAAAGCGACAACCCTGTACCCCCGAATTCATCGAGACGTAACTCAAA
ACAAAGCGACCCTGAAGTGCCAAATTCACCGAGACGTAACTCTAAGCAAA
GCGAGAGCCCTACGCTGCCAAATTCACAGAGACGTAATTCAGAACAAAGT
GAAGACTCAAATTCACAGAAACGTAACTCTAAACAAAGCGAGAGCCCTGT
GCTCCCGAACTCACAGAGGCGTAATTCAAAACAGAGCGACGATCCTGTAA
ACCCAAAGTCCCGATCACGCAATTCCAAACAAAGCGAAGATTTAAATTCA
CAGAGACGTAGCTCAAAACAACAAGAAAGTCCTAAAGACTTTGATCTCGA
AGAAAACGCACTTACAATTTTACCCAGAGTAAACAATGTTTTATCTCCAA
GTGATACATCATTTGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAAAT
AGAAAACCATCAAAAAGCGCAATTAAAAGATTCAAAGCTAACAACAAGCA
GGATGAAACAACAAAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGGGC
TTTCAGGCATAAAACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTCTA
GACATACATATCCCGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGCTA
TGCAGTTAGCATTGAGGGAAATGAACCTCCATATGATTTTGATCAACAAT
ATGGACGATTACCGAGGCCAACAATGGCGGCACCACAACCTCGAACACGT
ATCTATAAAACTCGTTGGTACATTCTTGCCGTTTTTACGGCGTACGTTGC
AATGCAGTATTTTATATGGAACTCCTTTGGACCCATCGCATCTTCAGTTA
AAACAGCTTATGGATGGGAAAATTCAGATATTACATTGTTAGCCAGTTGG
GATACCATTCTATATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTGCA
AAAAAGAGGTTTAAGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGTCA
TTGGAGCTTTATTTCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAACG
TACATGAACACCGGACAAATCTTAAACGGTCTTGGTGGGATGTTAGCACA
AGCTGCTGGTCCTGTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCGGA
CCCGAGCCACCGCTATTTCCACTTTAGCATCACAAGGCGGGCTTGCTCTA
TCTTATATCATTGGACCAGCTATAGTCAAGGAAGAAGCACACATTCGGGA
AAGTTTCCCAAACATCACAACACGCGCTTTAGAAGCGGAGCTACGAGATG
AGATCAGCACTTTCATGTACAAAGAACTTCTAGTCACATGTTTTATAACA
GCATGTGCTATGCTTTATTTCCCTAACAAGCCCAAACTACCACCATCACT
GTCCGCTAGTTTAACAAAACTACAGTTTCGTGATGGATTTAAAAGACTTT
TTAAAATGAGAAATTATTGGTATATTCTGTTCATTGCTGCATCTTCAACT
GGTATCTACAGTGGTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGATCA
TGGTCTTGGCATCACACAAagtgAATGTGGTTTAATGGGTTTTGCTTCAA
CAGTGTTCAGCGCAATCGGCGGAATAGCGCTTGGTTATTTATCGGACAAG
TGGCCCGGACACATGAGACATTTATTGATCATATTATTTAGTTTGGCTTT
TATCATGTTTTGTTGGATCACAGTGATTTGTTTGAAAGTGTTTACTTATA
GATTGGATATGTTGTACATTCCATGTCTGATTGGTGGCTTTTGTATCAAC
GGATCAACTCCCTTGATGTACGAGATGATCATAGAATTAACTTACCCTAT
ACCAGAAACTGTCAGCATCGGATTTCTTGGTGTGGTCAATAATATCTTCA
CTTTTGCTTTTTTGTTGCTCTTCAACGTCCCTAAAATAGGTGTTGTATGG
ACAAATTGGTGTTTGATAGCTACTTGCTTCATATGTCTATTACTCCTTAC
AAGATTCAAAGAGAAATATTATCGCATGAAAATTGATGGCATTTCGGTGA
CATCAATTGAAAGGAGAGTAGAAAGTACTATCGAAAGAAGACTACACGGA
ATAAATTCGATGGCACCAACAGCTAAAAGGTTTATCTCTGATATGAGAGG
GATTGCTGTTGTTAGTTTTTCAAGCGATGACATCATTACCTCACCCAATT
TGGAGCCAACACCTAACCGAAGCTACAGTTATTGAATGGCATCAAATGAA
GACACAGTCAAAGAGGTTGTGCTAACAAACGGAAAACAACTAACTGCAAT
CAACGAAGACTATACATCGACCATCGACCCTGGCACTCCTATAATTGTCA
ACAATGATCAATCTAGCTCGTCGCCAGCAAATCCTGGTTCAAAACCAAAT
GAAGACATCTTGCTCCCGAGTTCACAGAGACGTAATTCAAAACAAAGCGA
CAGCCCTGTACCCCCGAATTCACAGAGACGTAATTCAAAACAAAGCGACA
ACCCTGTACCCCCGAATTCATCGAGACGTAACTCAAAACAAAGCGACCCT
GAAGTGCCAAATTCACCGAGACGTAACTCTAAGCAAAGCGAGAGCCCTAC
GCTGCCAAATTCACAGAGACGTAATTCAGAACAAAGTGAAGACTCAAATT
CACAGAAACGTAACTCTAAACAAAGCGAGAGCCCTGTGCTCCCGAACTCA
CAGAGGCGTAATTCAAAACAGAGCGACGATCCTGTAAACCCAAAGTCCCG
ATCACGCAATTCCAAACAAAGCGAAGATTTAAATTCACAGAGACGTAGCT
CAAAACAACAAGAAAGTCCTAAAGACTTTGATCTCGAAGAAAACGCACTT
ACAATTTTACCCAGAGTAAACAATGTTTTATCTCCAAGTGATACATCATT
TGAAGAAATCGTTTTGTGTGACCCCCCACTGGCAAATAGAAAACCATCAA
AAAGCGCAATTAAAAGATTCAAAGCTAACAACAAGCAGGATGAAACAACA
AAGTCTTCACTTAAAAAGAGTCCACTTTTGGCCGGGCTTTCAGGCATAAA
ACAGAAATTTAGTTCAGTTCGCTTCAGCTCGATTCTAGACATACATATCC
CGTCCGAAACTCATCCCCAGAGCGATGAGCCAAGCTATGCAGTTAGCATT
GAGGGAAATGAACCTCCATATGATTTTGATCAACAATATGGACGATTACC
GAGGCCAACAATGGCGGCACCACAACCTCGAACACGTATCTATAAAACTC
GTTGGTACATTCTTGCCGTTTTTACGGCGTACGTTGCAATGCAGTATTTT
ATATGGAACTCCTTTGGACCCATCGCATCTTCAGTTAAAACAGCTTATGG
ATGGGAAAATTCAGATATTACATTGTTAGCCAGTTGGGATACCATTCTAT
ATGTGATTTTTTCGTTAGAAGTTTGTTGGCTAGTGCAAAAAAGAGGTTTA
AGGAAATCATTTCTCTGTTCATTGTTTCTGGTGGTCATTGGAGCTTTATT
TCGTTGCTTTGCTGTCCGAGAAACAAAAGTCAAAACGTACATGAACACCG
GACAAATCTTAAACGGTCTTGGTGGGATGTTAGCACAAGCTGCTGGTCCT
GTGGTCTCCAGTAATTGGTTCCCACCAGATGAGCGGACCCGAGCCACCGC
TATTTCCACTTTAGCATCACAAGGCGGGCTTGCTCTATCTTATATCATTG
GACCAGCTATAGTCAAGGAAGAAGCACACATTCGGGAAAGTTTCCCAAAC
ATCACAACACGCGCTTTAGAAGCGGAGCTACGAGATGAGATCAGCACTTT
CATGTACAAAGAACTTCTAGTCACATGTTTTATAACAGCATGTGCTATGC
TTTATTTCCCTAACAAGCCCAAACTACCACCATCACTGTCCGCTAGTTTA
ACAAAACTACAGTTTCGTGATGGATTTAAAAGACTTTTTAAAATGAGAAA
TTATTGGTATATTCTGTTCATTGCTGCATCTTCAACTGGTATCTACAGTG
GTTGGGCAGCTGTGTTGTATTTGAACCTAAGTGATCATGGTCTTGGCATC
ACACAAagtgAATGTGGTTTAATGGGTTTTGCTTCAACAGTGTTCAGCGC
AATCGGCGGAATAGCGCTTGGTTATTTATCGGACAAGTGGCCCGGACACA
TGAGACATTTATTGATCATATTATTTAGTTTGGCTTTTATCATGTTTTGT
TGGATCACAGTGATTTGTTTGAAAGTGTTTACTTATAGATTGGATATGTT
GTACATTCCATGTCTGATTGGTGGCTTTTGTATCAACGGATCAACTCCCT
TGATGTACGAGATGATCATAGAATTAACTTACCCTATACCAGAAACTGTC
AGCATCGGATTTCTTGGTGTGGTCAATAATATCTTCACTTTTGCTTTTTT
GTTGCTCTTCAACGTCCCTAAAATAGGTGTTGTATGGACAAATTGGTGTT
TGATAGCTACTTGCTTCATATGTCTATTACTCCTTACAAGATTCAAAGAG
AAATATTATCGCATGAAAATTGATGGCATTTCGGTGACATCAATTGAAAG
GAGAGTAGAAAGTACTATCGAAAGAAGACTACACGGAATAAATTCGATGG
CACCAACAGCTAAAAGGTTTATCTCTGATATGAGAGGGATTGCTGTTGTT
AGTTTTTCAAGCGATGACATCATTACCTCACCCAATTTGGAGCCAACACC
TAACCGAAGCTACAGTTATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000268XLOC_000268Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000396-proteinTCONS_00000396-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000396-exon-sc0000002-1491911889:36021..36908TCONS_00000396-exon-sc0000002-1491911889:36021..36908Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:36021..36908TCONS_00000396-exon-sc0000002-1510915933:36021..36908Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:36021..36908TCONS_00000396-exon-sc0000002-1575043694:36021..36908Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1491911889:37710..38120TCONS_00000396-exon-sc0000002-1491911889:37710..38120Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:37710..38120TCONS_00000396-exon-sc0000002-1510915933:37710..38120Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:37710..38120TCONS_00000396-exon-sc0000002-1575043694:37710..38120Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1491911889:38419..39029TCONS_00000396-exon-sc0000002-1491911889:38419..39029Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:38419..39029TCONS_00000396-exon-sc0000002-1510915933:38419..39029Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:38419..39029TCONS_00000396-exon-sc0000002-1575043694:38419..39029Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1491911889:39517..39703TCONS_00000396-exon-sc0000002-1491911889:39517..39703Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:39517..39703TCONS_00000396-exon-sc0000002-1510915933:39517..39703Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:39517..39703TCONS_00000396-exon-sc0000002-1575043694:39517..39703Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1491911889:40012..40194TCONS_00000396-exon-sc0000002-1491911889:40012..40194Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:40012..40194TCONS_00000396-exon-sc0000002-1510915933:40012..40194Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:40012..40194TCONS_00000396-exon-sc0000002-1575043694:40012..40194Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1491911889:40596..40946TCONS_00000396-exon-sc0000002-1491911889:40596..40946Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1510915933:40596..40946TCONS_00000396-exon-sc0000002-1510915933:40596..40946Clytia hemisphaericaexon
TCONS_00000396-exon-sc0000002-1575043694:40596..40946TCONS_00000396-exon-sc0000002-1575043694:40596..40946Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:36021..40946 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.146481 0.114274 0.729755 0.535464 0.0592614 0.140488 0.0941623 0.0528922 0.0493748 0.0917379 0.029681 0.0780445 0.058452 0.0809373 0.0415884 0.0892615 0.175941 0.13525 0.12457 0.30959 0.0566505 0.0414482 0.151157 0.0916159 0.518992 0.575476 0.040171 0 0.0162583 0.0662584
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00000396 vs. Swiss-Prot (Human)
Match: DIRC2 (Disrupted in renal carcinoma protein 2 OS=Homo sapiens GN=DIRC2 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.011e-61
Identity = 151/444 (34.01%), Postives = 240/444 (54.05%), Query Frame = 3
Query: 1074 PQPRTRIYKTRWYILAVFTAYVAMQYFIWNSFGPIASSVKTAYGWENSDITLLASWDTILYVIFSLEVCWLVQKRGLRKSFLCSLFLVVIGALFRCFAVRETKVKT-YMNTGQILNGLGGMLAQAAGPVVSSNWFPPDERTRATAISTLASQGGLALSYIIGPAIVKEEAHIRESFPNITTRALEAE-----LRDEISTFMYKELLVTCFITACAMLYFPNKPKLPPSLSASLTKLQFRDGFKRLFKMRNYWYILFIAASSTGIYSGWAAVLYLNLSDHGLGITQSECGLMGFASTVFSAIGGIALGYLSDKWPGHMRHLLIILFSLAFIMFCWITVICLKVFTY---RLDMLYIPCLIGGFCINGSTPLMYEMIIELTYPIPETVSIGFLGVVNNIFTFAFLLLFNVPKIGVVWTNWCLIATCFICLLLLTRFKEKYYRMKID 2378
            P P  R+Y  RW +L +F+    +Q  +WN++GPI +S + AYG+ + DI LL  W  I ++       WL+ KRGLR + L + FL+V+G   RC  + +  +K   ++ GQ+LNGL G     A P +S+ WF  DER  ATAI+++ S  G A ++++GP +V          PN T+  L AE     ++D I   +Y E  V C I +  + YFP +P LPPS++A+  +L +R    RL     +  I    A   G+++GW+ VL L L+     ++Q + G +GF S V   + GIA+   +D   G ++ +L++LFS A +   W T+ CL   T+       LY  C++ G  +N S P+ +E+ +E  YP+PE ++ G +  ++N+F    L         + W NWCL  +C + LLL+  F+E Y R+ +D
Sbjct:   42 PGP-GRVYGRRWLVLLLFSLLAFVQGLVWNTWGPIQNSARQAYGFSSWDIALLVLWGPIGFLP-CFAFMWLLDKRGLRITVLLTSFLMVLGTGLRCIPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIASMLSYLGGACAFLVGPLVVPA--------PNGTSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNFRFLMIALAYAIPLGVFAGWSGVLDLILTPAH--VSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLILLLLFSGATLSSTWFTLTCLNSITHLPLTTVTLYASCILLGVFLNSSVPIFFELFVETVYPVPEGITCGVVTFLSNMFMGVLLFFLTFYHTELSWFNWCLPGSCLLSLLLILCFRESYDRLYLD 473          
The following BLAST results are available for this feature:
BLAST of TCONS_00000396 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DIRC24.011e-6134.01Disrupted in renal carcinoma protein 2 OS=Homo sap... [more]
back to top