Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000395 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000395
Unique NameTCONS_00000395
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1568

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000395 ID=TCONS_00000395|Name=TCONS_00000395|organism=Clytia hemisphaerica|type=transcript|length=1568bp
GTAAAGGGAAAGGTCATCATTTTCGAGCTTTGTTGAAACTCAGCAAAAAG
GTTTTTGAGCCATcttataaaagtttttgaacCGTAATAACATCGGCGCG
ATACTTTGGTGGAACTTATAAGTGAAATCGCTCACATTTTAGTGTGCTCG
GAACTTACAATGTTAACTAGCTATATCTCACACGAGCGCGAACGCAGGAT
GACGTGGCCCTATAATCCAGTACCATCCTATCATGTACCACACCATGGAC
CATATAACTTCCCTGGACATTACCCCCTGAATTATTACGgATATCCAAGA
AAGCAAAGACGTGAGCGTACAACATTTACCAAAGGACAATTAGAAATATT
GGAGAATTTATTCCGTGAGACGAAGTACCCTGATGTTTTTATGCGCGAAG
ACGTAGCAAGAAGAATCAGCCTACCTGAATCTAGAGTCCAGGTTTGGTTT
AAAAACAGGCGTGCAAAACACCGACAGAAATCCAAGAAATCATCATCTAC
ATCACAAAGTACGAACTCAGATTCCAGTCCTGAACGAGGAGACCGTTCGC
CTGCCCTCCAATCTCCTAACTCTGATAAATCACACAACATTGACCCACCA
CCACTTTCGTCACCGGCAAAACCGAACCATAGCAACAGCAACCATAGCAA
CAGCAACCATAGCAGCAGtaataacaacaataataatgGCAGTAATGGAA
ACACAACATCAGAATCAACAAACGAGTTTAATAACAACAAATCCCAATGC
ACATTCAATAACAACCATTTACCTCAAAATCCATTAACACCAACCACGCC
TACAAACACGGGCGGATATCCGCCACTCGAAAGAGCACCCTCGTATCCTA
ACTACATCCCTCAATCTTTCCAGCAATCGCAAAGAGGATATGGTGGACAA
TCAGATTCGTCATACTGTCCATATTCACCGACCAGCGGTCGTCAATCTTT
CTACCAATCCTCACATCTGCACCCACATTCAACTAGCGATTACCAGCCAT
GTGCAGTAGATGTTCATGGCTCTACACCTTTAAGTCCTGGTTGGAATACA
TATGGTCCGAACATATGAGACTAGTTTAAATAACTACATTTAAGTGATTC
ACCAAAGAATAGtgatgtcagatctaacaagtTTCCCACAATCTAACAAG
ATCGAAGTGACACAAACTAAACCCTAATTGAAAATAAGACAGAGACATGT
CTCTTTAAGAAATGGTTAGTGGTTTCCGCATATTCAATTGTTGATAAAAC
AGTAGAAGAAGTAATTGGTAGCGAACCAACGACAGGATAACTCTTAATTC
CGAAATTCTGTATGCGCGGCAAGGGAAAAAGGAAACTTAATTTATTCAGG
TCATATTGGCTTTTAATTTAGTTTGAAACAAGATTTCTCATCTCGCCTAT
CAgttttctgttttcaaatttgaaatgtaaTAAATTGTAAAGAGCTGAAA
CTGCAGAAAATTTAGAACGatacaatttctttttttaaagatattttttt
gaacttttagaaatttttcgtttttccaaTAATTCTAAGACAAACGAATA
TATTATTGTGTATAGCTg
Run BLAST on NCBI

protein sequence of Otx-related-1

>TCONS_00000395-protein ID=TCONS_00000395-protein|Name=Otx-related-1|organism=Clytia hemisphaerica|type=polypeptide|length=302bp
MLTSYISHERERRMTWPYNPVPSYHVPHHGPYNFPGHYPLNYYGYPRKQR
RERTTFTKGQLEILENLFRETKYPDVFMREDVARRISLPESRVQVWFKNR
RAKHRQKSKKSSSTSQSTNSDSSPERGDRSPALQSPNSDKSHNIDPPPLS
SPAKPNHSNSNHSNSNHSSSNNNNNNGSNGNTTSESTNEFNNNKSQCTFN
NNHLPQNPLTPTTPTNTGGYPPLERAPSYPNYIPQSFQQSQRGYGGQSDS
SYCPYSPTSGRQSFYQSSHLHPHSTSDYQPCAVDVHGSTPLSPGWNTYGP
NI
Run BLAST on NCBI

transcript from alignment at sc0000002:20126..24246+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000395 ID=TCONS_00000395|Name=TCONS_00000395|organism=Clytia hemisphaerica|type=transcript|length=4121bp|location=Sequence derived from alignment at sc0000002:20126..24246+ (Clytia hemisphaerica)
GTAAAGGGAAAGGTCATCATTTTCGAGCTTTGTTGAAACTCAGCAAAAAG GTTTTTGAGCCATcttataaaagtttttgaacCGTAATAACATCGGCGCG ATACTTTGGTGGAACTTATAAGTGAAATCGCTCACATTTTAGTGTGCTCG GAACTTACAATGTTAACTAGCTATGTAAGTATACAATGAAGTCTTGAATT GAAAAAAGGCTTGCCAAAGACAGGGGCCAcggctccactttgaaagtATT AGGGCCACATAATATACTGACTAAGGAGACGCCACTGGATGGGGCCGACG GGTGAAAAGCAATTTTTAGCTCTTTTAGATTACCTAAAACAGACCTGTTT TAGGCGATCTGAAGGTTTAAGGTTATTAAACAGAATTTGACTTGAttggt aaattttctttttgttttgaaaaaatgtgccTCCCCCCCGCTGGCGCAGC GCCTGTAAAGACTACTATTGGTTAATGTCAGAGGATGCTATCGTCTGTTA GAGGGACAGTTAACGCTGGGAAAACTTATAAGCGCGTAGTTTACTGTCGT AATGAGGGGTTACGGAAAGAATAGTGGCGGAAAAGTTAGGAACAAACACT GCTAGCACAGTAAAAACCGTCATCAATGTTCACCTTGTACCGGGCTTATC TTCGGCACTCAAATTAATCCCACTTTCTAAATTATTTCCGTTTTAGTGAT CTTGTCTAAGTTGATCTTTGCTTTAGAATTTTAGACAGTAAAGTACAGTA AGAACGGGAGTACAATACAAACacaatattcaatttcaaaatattatagt aaaagattttttcaagtgACTCTTCGATACTGAATAAATTCAACTTACGC GACATTGAGAACGTTGGGTTACAAAAAGATTAGGTTAATGGGTCAAGGAG AAACACTCTTCCTCCAAAGCGAAGGTTTGAAAACAGACTTATCTTTTCCC AAGCTAATTAATTTACCTTTCAACATTGCAACATGCATAGTGcggttttt tttgtcaaataagGCCACATATCAACCTTAACTATCGAGACTTTATGAGA AAACTTTActtaaaataagagaaaaactGACCCTCAAAATTAGGATTTTA CTAATATCAAAATAGTATTAGTTCGATAAGGGGAGCTTCAGGAAGCAGCA AGGTGGCGATACATGTAGAGTTCGTTACTTTGCCAAAAAGAAATTACGAA ACCCTGCTAATGTTAATTACTAGTTTGTTAGCGTTTTTTGCAAGATGATA TGTGATATCTTCAATTCAATTTTCGGATGATCATGACAGAAGGCTGATAA TCTGGTTAAAGCGTTACCTACTCACCATTAGCTCTGGATCATATACCACA CATTAACTAAATCGAGATCTCAAATACTTTATTAATATTGACATTGTgtt taacttatttttaacaTCTTTATTTCAGATCTCACACGAGCGCGAACGCA GGATGACGTGGCCCTATAATCCAGTACCATCCTATCATGTACCACACCAT GGACCATATAACTTCCCTGGACATTACCCCCTGAATTATTACGGTAAgac ttttcaaactcgagatgtATAAAAGTCAAAACCTCAAAACGGCGCTAATT TTTCGCTGCCAGACCCTGCTGAAAATATCTGAATTTTCACTTTTgaagaa aaaggtcaaattctGTTTTTCGAGTAATTCTGGTAAACGAAGAATACCTT AAAAAGACTAGTAATATTTCCGTTGGTTGAAATTGTCACAAATACCAAAT ACAGAACTAAGCGTTACGTACTTTCATTGGTACAACAAAACGGAGGAAAG TTAAACTCggtaatattgaaaataaaacgaAAAGTAACTAACTTACAGTC TCATGGTACAGTTTCCATTCTACTTCACTCGACTGTCTTTTCCTAAagga atacatgtttttttttataagcatacaaaaatccgaaaacaggctcaaag atgcttaggtcgaaagcttaataatgctgaaaaatgcttgaggggatgct taaatctaaagcataaatttaaggaaatacaaaaaatccgtaaaattcca gccaaaaaaagccaaaatcaggaaaaacatttttcgtaggctcaagttat gcttgccatatgcttaatttttccccatatctgagcctagatatgcttat aagtacaatgcttataaaaaaaataatttAGATTTCTAGGtaataatatt taaaatattttgttaaatttcaggATATCCAAGAAAGCAAAGACGTGAGC GTACAACATTTACCAAAGGACAATTAGAAATATTGGAGAATTTATTCCGT GAGACGAAGTACCCTGATGTTTTTATGCGCGAAGACGTAGCAAGAAGAAT CAGCCTACCTGAATCTAGAGTCCAGGTTAGTTATTATGAAATCTCAACAT CTTCTGATATTATGATAATCTTCATCGCACAACCTATAACACAAGtataa taaagaaatattaaggAGCAATATGTGAGTGGTCTAAAGCAATTAGCTCA TAGATAGCCGAAATCGCTGGCCCTGTTAAAATAATGGAAACGCGGTCTAT GGGTTGTAGACTACTGGGGTATCTATGTAAAATAAAGACTTTATGcagaa agtttttgtttgtttttgtttttgtaatgaaaaattaactctggcTGGCC GGCGAATTCATAGCAAACGCAGTGTATTTATTAGcgtaaatatgtacttg aggcgAACCGAACTTTTCGAACGGCTAATTGTAATTATTTTCGTACCTTG GACCGTCGAAATTCGCCGTTTGCCGGGCCTAAATAAGACCCTTAAGCTTT ATGTATCTAATACATTGCAAGTTTTGGCTGATTCGAACACGATCGGGAAC TtctttgttcgaattataggagATGAAAGCATTTAATAAGAGGCTCCACT TGACGAAATTTAGTCCAAATTATAAAGAGATTAAAATAATAGAAATCGAT AATCTCCGAttatttaacattttcaaacttttttcatattccaGGTTTGG TTTAAAAACAGGCGTGCAAAACACCGACAGAAATCCAAGAAATCATCATC TACATCACAAAGTACGAACTCAGATTCCAGTCCTGAACGAGGAGACCGTT CGCCTGCCCTCCAATCTCCTAACTCTGATAAATCACACAACATTGACCCA CCACCACTTTCGTCACCGGCAAAACCGAACCATAGCAACAGCAACCATAG CAACAGCAACCATAGCAGCAGtaataacaacaataataatgGCAGTAATG GAAACACAACATCAGAATCAACAAACGAGTTTAATAACAACAAATCCCAA TGCACATTCAATAACAACCATTTACCTCAAAATCCATTAACACCAACCAC GCCTACAAACACGGGCGGATATCCGCCACTCGAAAGAGCACCCTCGTATC CTAACTACATCCCTCAATCTTTCCAGCAATCGCAAAGAGGATATGGTGGA CAATCAGATTCGTCATACTGTCCATATTCACCGACCAGCGGTCGTCAATC TTTCTACCAATCCTCACATCTGCACCCACATTCAACTAGCGATTACCAGC CATGTGCAGTAGATGTTCATGGCTCTACACCTTTAAGTCCTGGTTGGAAT ACATATGGTCCGAACATATGAGACTAGTTTAAATAACTACATTTAAGTGA TTCACCAAAGAATAGtgatgtcagatctaacaagtTTCCCACAATCTAAC AAGATCGAAGTGACACAAACTAAACCCTAATTGAAAATAAGACAGAGACA TGTCTCTTTAAGAAATGGTTAGTGGTTTCCGCATATTCAATTGTTGATAA AACAGTAGAAGAAGTAATTGGTAGCGAACCAACGACAGGATAACTCTTAA TTCCGAAATTCTGTATGCGCGGCAAGGGAAAAAGGAAACTTAATTTATTC AGGTCATATTGGCTTTTAATTTAGTTTGAAACAAGATTTCTCATCTCGCC TATCAgttttctgttttcaaatttgaaatgtaaTAAATTGTAAAGAGCTG AAACTGCAGAAAATTTAGAACGatacaatttctttttttaaagatatttt tttgaacttttagaaatttttcgtttttccaaTAATTCTAAGACAAACGA ATATATTATTGTGTATAGCTg

Coding sequence (CDS) from alignment at sc0000002:20126..24246+

>TCONS_00000395 ID=TCONS_00000395|Name=TCONS_00000395|organism=Clytia hemisphaerica|type=CDS|length=3636bp|location=Sequence derived from alignment at sc0000002:20126..24246+ (Clytia hemisphaerica)
ATGTTAACTAGCTATATCTCACACGAGCGCGAACGCAGGATGACGTGGCC
CTATAATCCAGTACCATCCTATCATGTACCACACCATGGACCATATAACT
TCCCTGGACATTACCCCCTGAATTATTACGgATATCCAAGAAAGCAAAGA
CGTGAGCGTACAACATTTACCAAAGGACAATTAGAAATATTGGAGAATTT
ATTCCGTGAGACGAAGTACCCTGATGTTTTTATGCGCGAAGACGTAGCAA
GAAGAATCAGCCTACCTGAATCTAGAGTCCAGGTTTGGTTTAAAAACAGG
CGTGCAAAACACCGACAGAAATCCAAGAAATCATCATCTACATCACAAAG
TACGAACTCAGATTCCAGTCCTGAACGAGGAGACCGTTCGCCTGCCCTCC
AATCTCCTAACTCTGATAAATCACACAACATTGACCCACCACCACTTTCG
TCACCGGCAAAACCGAACCATAGCAACAGCAACCATAGCAACAGCAACCA
TAGCAGCAGtaataacaacaataataatgGCAGTAATGGAAACACAACAT
CAGAATCAACAAACGAGTTTAATAACAACAAATCCCAATGCACATTCAAT
AACAACCATTTACCTCAAAATCCATTAACACCAACCACGCCTACAAACAC
GGGCGGATATCCGCCACTCGAAAGAGCACCCTCGTATCCTAACTACATCC
CTCAATCTTTCCAGCAATCGCAAAGAGGATATGGTGGACAATCAGATTCG
TCATACTGTCCATATTCACCGACCAGCGGTCGTCAATCTTTCTACCAATC
CTCACATCTGCACCCACATTCAACTAGCGATTACCAGCCATGTGCAGTAG
ATGTTCATGGCTCTACACCTTTAAGTCCTGGTTGGAATACATATGGTCCG
AACATATGAATGTTAACTAGCTATATCTCACACGAGCGCGAACGCAGGAT
GACGTGGCCCTATAATCCAGTACCATCCTATCATGTACCACACCATGGAC
CATATAACTTCCCTGGACATTACCCCCTGAATTATTACGgATATCCAAGA
AAGCAAAGACGTGAGCGTACAACATTTACCAAAGGACAATTAGAAATATT
GGAGAATTTATTCCGTGAGACGAAGTACCCTGATGTTTTTATGCGCGAAG
ACGTAGCAAGAAGAATCAGCCTACCTGAATCTAGAGTCCAGGTTTGGTTT
AAAAACAGGCGTGCAAAACACCGACAGAAATCCAAGAAATCATCATCTAC
ATCACAAAGTACGAACTCAGATTCCAGTCCTGAACGAGGAGACCGTTCGC
CTGCCCTCCAATCTCCTAACTCTGATAAATCACACAACATTGACCCACCA
CCACTTTCGTCACCGGCAAAACCGAACCATAGCAACAGCAACCATAGCAA
CAGCAACCATAGCAGCAGtaataacaacaataataatgGCAGTAATGGAA
ACACAACATCAGAATCAACAAACGAGTTTAATAACAACAAATCCCAATGC
ACATTCAATAACAACCATTTACCTCAAAATCCATTAACACCAACCACGCC
TACAAACACGGGCGGATATCCGCCACTCGAAAGAGCACCCTCGTATCCTA
ACTACATCCCTCAATCTTTCCAGCAATCGCAAAGAGGATATGGTGGACAA
TCAGATTCGTCATACTGTCCATATTCACCGACCAGCGGTCGTCAATCTTT
CTACCAATCCTCACATCTGCACCCACATTCAACTAGCGATTACCAGCCAT
GTGCAGTAGATGTTCATGGCTCTACACCTTTAAGTCCTGGTTGGAATACA
TATGGTCCGAACATATGAATGTTAACTAGCTATATCTCACACGAGCGCGA
ACGCAGGATGACGTGGCCCTATAATCCAGTACCATCCTATCATGTACCAC
ACCATGGACCATATAACTTCCCTGGACATTACCCCCTGAATTATTACGgA
TATCCAAGAAAGCAAAGACGTGAGCGTACAACATTTACCAAAGGACAATT
AGAAATATTGGAGAATTTATTCCGTGAGACGAAGTACCCTGATGTTTTTA
TGCGCGAAGACGTAGCAAGAAGAATCAGCCTACCTGAATCTAGAGTCCAG
GTTTGGTTTAAAAACAGGCGTGCAAAACACCGACAGAAATCCAAGAAATC
ATCATCTACATCACAAAGTACGAACTCAGATTCCAGTCCTGAACGAGGAG
ACCGTTCGCCTGCCCTCCAATCTCCTAACTCTGATAAATCACACAACATT
GACCCACCACCACTTTCGTCACCGGCAAAACCGAACCATAGCAACAGCAA
CCATAGCAACAGCAACCATAGCAGCAGtaataacaacaataataatgGCA
GTAATGGAAACACAACATCAGAATCAACAAACGAGTTTAATAACAACAAA
TCCCAATGCACATTCAATAACAACCATTTACCTCAAAATCCATTAACACC
AACCACGCCTACAAACACGGGCGGATATCCGCCACTCGAAAGAGCACCCT
CGTATCCTAACTACATCCCTCAATCTTTCCAGCAATCGCAAAGAGGATAT
GGTGGACAATCAGATTCGTCATACTGTCCATATTCACCGACCAGCGGTCG
TCAATCTTTCTACCAATCCTCACATCTGCACCCACATTCAACTAGCGATT
ACCAGCCATGTGCAGTAGATGTTCATGGCTCTACACCTTTAAGTCCTGGT
TGGAATACATATGGTCCGAACATATGAATGTTAACTAGCTATATCTCACA
CGAGCGCGAACGCAGGATGACGTGGCCCTATAATCCAGTACCATCCTATC
ATGTACCACACCATGGACCATATAACTTCCCTGGACATTACCCCCTGAAT
TATTACGgATATCCAAGAAAGCAAAGACGTGAGCGTACAACATTTACCAA
AGGACAATTAGAAATATTGGAGAATTTATTCCGTGAGACGAAGTACCCTG
ATGTTTTTATGCGCGAAGACGTAGCAAGAAGAATCAGCCTACCTGAATCT
AGAGTCCAGGTTTGGTTTAAAAACAGGCGTGCAAAACACCGACAGAAATC
CAAGAAATCATCATCTACATCACAAAGTACGAACTCAGATTCCAGTCCTG
AACGAGGAGACCGTTCGCCTGCCCTCCAATCTCCTAACTCTGATAAATCA
CACAACATTGACCCACCACCACTTTCGTCACCGGCAAAACCGAACCATAG
CAACAGCAACCATAGCAACAGCAACCATAGCAGCAGtaataacaacaata
ataatgGCAGTAATGGAAACACAACATCAGAATCAACAAACGAGTTTAAT
AACAACAAATCCCAATGCACATTCAATAACAACCATTTACCTCAAAATCC
ATTAACACCAACCACGCCTACAAACACGGGCGGATATCCGCCACTCGAAA
GAGCACCCTCGTATCCTAACTACATCCCTCAATCTTTCCAGCAATCGCAA
AGAGGATATGGTGGACAATCAGATTCGTCATACTGTCCATATTCACCGAC
CAGCGGTCGTCAATCTTTCTACCAATCCTCACATCTGCACCCACATTCAA
CTAGCGATTACCAGCCATGTGCAGTAGATGTTCATGGCTCTACACCTTTA
AGTCCTGGTTGGAATACATATGGTCCGAACATATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000267XLOC_000267Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000395-exon-sc0000002-1491911889:20126..20299TCONS_00000395-exon-sc0000002-1491911889:20126..20299Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1510915933:20126..20299TCONS_00000395-exon-sc0000002-1510915933:20126..20299Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1575043694:20126..20299TCONS_00000395-exon-sc0000002-1575043694:20126..20299Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1491911889:21554..21668TCONS_00000395-exon-sc0000002-1491911889:21554..21668Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1510915933:21554..21668TCONS_00000395-exon-sc0000002-1510915933:21554..21668Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1575043694:21554..21668TCONS_00000395-exon-sc0000002-1575043694:21554..21668Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1491911889:22349..22500TCONS_00000395-exon-sc0000002-1491911889:22349..22500Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1510915933:22349..22500TCONS_00000395-exon-sc0000002-1510915933:22349..22500Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1575043694:22349..22500TCONS_00000395-exon-sc0000002-1575043694:22349..22500Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1491911889:23120..24246TCONS_00000395-exon-sc0000002-1491911889:23120..24246Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1510915933:23120..24246TCONS_00000395-exon-sc0000002-1510915933:23120..24246Clytia hemisphaericaexon
TCONS_00000395-exon-sc0000002-1575043694:23120..24246TCONS_00000395-exon-sc0000002-1575043694:23120..24246Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Otx-related-1TCONS_00000395-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:20126..24246 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0783173 0.0763717 0.00895158 0.0923157 0 0 0.43632 0.328474 0.0482282 0 0.317384 0 8.57685e-09 0 0 0 7.43538 3.73972 0.0019923 6.78447e-10 8.7104 9.65296 4.66897 4.03973 12.1741 12.8192 5.31101 3.78206 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR017970Homeobox_CS
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
Blast
BLAST of TCONS_00000395 vs. Swiss-Prot (Human)
Match: OTX2 (Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.756e-26
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 1
Query:  268 HYPLNYYGYPRKQRRERTTFTKGQLEILENLFRETKYPDVFMREDVARRISLPESRVQVWFKNRRAKHR 474
            H  + Y   PRKQRRERTTFT+ QL++LE LF +T+YPD+FMRE+VA +I+LPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
The following BLAST results are available for this feature:
BLAST of TCONS_00000395 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
OTX24.756e-2669.57Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1... [more]
back to top