Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

Otx-related-1 (polypeptide) - C. hemisphaerica

Overview
NameOtx-related-1
Unique NameTCONS_00000395-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length302

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000395-protein ID=TCONS_00000395-protein|Name=Otx-related-1|organism=Clytia hemisphaerica|type=polypeptide|length=302bp
MLTSYISHERERRMTWPYNPVPSYHVPHHGPYNFPGHYPLNYYGYPRKQR
RERTTFTKGQLEILENLFRETKYPDVFMREDVARRISLPESRVQVWFKNR
RAKHRQKSKKSSSTSQSTNSDSSPERGDRSPALQSPNSDKSHNIDPPPLS
SPAKPNHSNSNHSNSNHSSSNNNNNNGSNGNTTSESTNEFNNNKSQCTFN
NNHLPQNPLTPTTPTNTGGYPPLERAPSYPNYIPQSFQQSQRGYGGQSDS
SYCPYSPTSGRQSFYQSSHLHPHSTSDYQPCAVDVHGSTPLSPGWNTYGP
NI
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000267XLOC_000267Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000395TCONS_00000395Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR017970Homeobox_CS
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 49..111
e-value: 3.4E-23
score: 93.0
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 50..106
e-value: 1.3E-21
score: 76.1
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 47..107
score: 19.84
NoneNo IPR availableGENE3D1.10.10.60coord: 43..117
e-value: 5.3E-29
score: 99.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 99..274
NoneNo IPR availableCDDcd00086homeodomaincoord: 50..105
e-value: 4.10486E-21
score: 83.4468
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 82..105
IPR009057Homeobox domain-likeSUPERFAMILY46689Homeodomain-likecoord: 27..108

Blast
BLAST of Otx-related-1 vs. Swiss-Prot (Human)
Match: OTX1 (Homeobox protein OTX1 OS=Homo sapiens GN=OTX1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.554e-30
Identity = 58/98 (59.18%), Postives = 71/98 (72.45%), Query Frame = 0
Query:   30 GPYNFPGHYPLNYYGYPRKQRRERTTFTKGQLEILENLFRETKYPDVFMREDVARRISLPESRVQVWFKNRRAKHRQKSKKSSST-SQSTNSDSSPER 126
            GP     H  + Y   PRKQRRERTTFT+ QL++LE LF +T+YPD+FMRE+VA +I+LPESRVQVWFKNRRAK RQ+ +  S T S+     SSP R
Sbjct:   19 GPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR 116          
The following BLAST results are available for this feature:
BLAST of Otx-related-1 vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
OTX11.554e-3059.18Homeobox protein OTX1 OS=Homo sapiens GN=OTX1 PE=1... [more]
back to top