Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000393 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000393
Unique NameTCONS_00000393
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1802

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000393 ID=TCONS_00000393|Name=TCONS_00000393|organism=Clytia hemisphaerica|type=transcript|length=1802bp
CAGCGGGTGACTTTAATACAAAAATCTTTTAGCATCAACTTATACGTAGG
ggattcttaaaaaaaattcagagaCTGTCATTTTAAGCATTCGACTCGCT
CGGAACAAGACGGAATTAAATAATTTGAAGTATATCATAAACATTTCAAt
tgtttatttacatttttgatTATTAAAAAAAGGGGATTTTGAAGATTTAC
AATCATCATCATTTAGTATAAAACTCTTTTAATGATCAAGAAATTTGTTA
ATTGCATTTTATGATAATTATCATCAACAGCTAACGAGAATTCATCAGAC
ATTTTTGAAGTACTATTCAGACTGACTGGAGATTTGAATATCGGACAAAA
CTTTGAATTATAACCGGacagttgatttcgttttggaCAACGTTGACCTT
ACTTTCAGATCTCACACGAGCGCGAACGCAGGATGACGTGGCCCTATAAT
CCAGTACCATCCTATCATGTACCACACCATGGACCATATAACTTCCCTGG
ACATTACCCCCTGAATTATTACGgATATCCAAGAAAGCAAAGACGTGAGC
GTACAACATTTACCAAAGGACAATTAGAAATATTGGAGAATTTATTCCGT
GAGACGAAGTACCCTGATGTTTTTATGCGCGAAGACGTAGCAAGAAGAAT
CAGCCTACCTGAATCTAGAGTCCAGGTTTGGTTTAAAAACAGGCGTGCAA
AACACCGACAGAAATCCAAGAAATCATCATCTACATCACAAAGTACGAAC
TCAGATTCCAGTCCTGAACGAGGAGACCGTTCGCCTGCCCTCCAATCTCC
TAACTCTGATAAATCACACAACATTGACCCACCACCACTTTCGTCACCGG
CAAAACCGAACCATAGCAACAGCAACCATAGCAACAGCAACCATAGCAGC
AGtaataacaacaataataatgGCAGTAATGGAAACACAACATCAGAATC
AACAAACGAGTTTAATAACAACAAATCCCAATGCACATTCAATAACAACC
ATTTACCTCAAAATCCATTAACACCAACCACGCCTACAAACACGGGCGGA
TATCCGCCACTCGAAAGAGCACCCTCGTATCCTAACTACATCCCTCAATC
TTTCCAGCAATCGCAAAGAGGATATGGTGGACAATCAGATTCGTCATACT
GTCCATATTCACCGACCAGCGGTCGTCAATCTTTCTACCAATCCTCACAT
CTGCACCCACATTCAACTAGCGATTACCAGCCATGTGCAGTAGATGTTCA
TGGCTCTACACCTTTAAGTCCTGGTTGGAATACATATGGTCCGAACATAT
GAGACTAGTTTAAATAACTACATTTAAGTGATTCACCAAAGAATAGtgat
gtcagatctaacaagtTTCCCACAATCTAACAAGATCGAAGTGACACAAA
CTAAACCCTAATTGAAAATAAGACAGAGACATGTCTCTTTAAGAAATGGT
TAGTGGTTTCCGCATATTCAATTGTTGATAAAACAGTAGAAGAAGTAATT
GGTAGCGAACCAACGACAGGATAACTCTTAATTCCGAAATTCTGTATGCG
CGGCAAGGGAAAAAGGAAACTTAATTTATTCAGGTCATATTGGCTTTTAA
TTTAGTTTGAAACAAGATTTCTCATCTCGCCTATCAgttttctgttttca
aatttgaaatgtaaTAAATTGTAAAGAGCTGAAACTGCAGAAAATTTAGA
ACGatacaatttctttttttaaagatatttttttgaacttttagaaattt
ttcgtttttccaaTAATTCTAAGACAAACGAATATATTATTGTGTATAGC
Tg
Run BLAST on NCBI

transcript from alignment at sc0000002:17050..24246+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000393 ID=TCONS_00000393|Name=TCONS_00000393|organism=Clytia hemisphaerica|type=transcript|length=7197bp|location=Sequence derived from alignment at sc0000002:17050..24246+ (Clytia hemisphaerica)
CAGCGGGTGACTTTAATACAAAAATCTTTTAGCATCAACTTATACGTAGG ggattcttaaaaaaaattcagagaCTGTCATTTTAAGCATTCGACTCGCT CGGAACAAGACGGAATTAAATAATTTGAAGTATATCATAAACATTTCAAt tgtttatttacatttttgatTATTAAAAAAAGGGGATTTTGAAGATTTAC AATCATCATCATTTAGTATAAAACTCTTTTAATGATCAAGAAATTTGTTA ATTGCATTTTATGATAATTATCATCAACAGCTAACGAGAATTCATCAGAC ATTTTTGAAGTACTATTCAGACTGACTGGAGATTTGAATATCGGACAAAA CTTTGAATTATAACCGGacagttgatttcgttttggaCAACGTTGACCTT ACTTTCAGGTAAGTGGGACATTAATATTTTGAGAATTCAAAACTGATTTT ATCGATGATGATTAATTTtgaactacagttgacgctctctaagtAGATTT TCACGCGCGATAGGATTTTCAACTTCGTTAACTGCGTAATATCAGCTTTT GGATGCTTACTggtagcgctagataatatttCTCTGGCGTCCATAGGTAA CATGggtaaagcctgggatacacggggacggggttgttggattttcattg aataagaGAGCATATCGAATAGTTGAGCATCGTTTATTAGAATTTTTTGT TGACGGCAACTTCCATCATTATCGAATAATGAAGTGTATGGACAAGTTGA ACGTCAACCCTGTTCTAGTCAGTAGCGATAAAGTGATAGAAACTAGACTA AGAGGAAAAAGGTTAACTTTTATCTTGATCAGAATGGAAGGTCACCTTGT ATGAGCGAGAATACGAAATTCCGTTTAACATATTACCAGGGATAAAGTGG AACTCGGTCTAGTCACGGCTAGGATCAATTGGCGTATTGTTGTCTTGATT CTGTTGTTTCTTTCTAATTGGGTAACAAGGAAATTACACAATTTCTAATT GGTTAACGAGGAAAATAAACTCCTCTTCACGCAAAATTCAACACAGTGTT CTGTCTTTTCGATTCAAATGCTTTGCACAATGACCATGAGATATTGGGTG TATTATAACCACTGATCTTAATAAACTCTGGCTATAaccaccatctttga tcggagttttttctTAAAGTGGTGAACCCGCAAAGAAGCCGTCGCAGTTT TAAAAATTAATGTCAAGCGGCGCTACACTATCACAAGTATTAAAAGCAAT GTAGACCTAGTACTCGAAAATGTTGAAACATCTTCTAGAAAGAGTGTGCC TAATGTAGAATGAAACCTAAAAATTACNTGAAATATCTTCTAGAAAGAGT AAAAAAGTGTGCCTAATGTAGAATGAAACCTAAGAATTACAAGATTAAGA AGCAACCTACGTAAAATAGTTTCAACCAACTTCCgaagaaaatattaatt ttttaatgCGTTGCACTGTAGTGTATATTACATAATTTTCTTGGTAGATA CCCACAATTTTTCATGATCAGTAACCAACATTTGTTACAAAGAGAAAACT TTAACTGTGAGGACGAGGGTGaagttttttgaccatttttgttcagagaa acaaaacatttacaaaaatcaggagCCGATCCTactttaaaatctgaaaa atctaaatcacACACCAAATAATTTTCGTTTTGTTTAAAttcacttttta atgaaatatacaaacaaaatcgAATTATacatttaagaaaataaattcgT GATcgttgatgatttttaaaagatttgaaattaaAGCGATTTTTTAACTG GATTTTTAACTAGTTTtctgtttaaaattttgatagttAGGCTAAGTAGT GATTCTAAACTTCTAAATCGGAATTACATGAATAAAATTCTGCTAATCTC AAATGATGGGCAAATCATCTCTGTCTCTTTGTACCAAGAAATTTCAGGAG TTTCGAAATCGATGGAAGTCTCTTAAGGTTAAATTAAGATGGCGTTcctc aagaaattttttttgacagtttCCTTTCGCCTTTCCATCAGTAGAAAATT AAtgactttatgaaatttgtctcTCTCGTGGGAAATTTTACCATCAGTTT Tcaacgaaaaatgttttttcactcattttttttttttttgagtttcaaaa tttttatggTTAAGTCATTACACCTAGCACACCAGGCGCCTTGAGAATGT TCTAATTCATTTTCATTCTGTTCTTCAATCTTTGAAAGAGGAACATTGAA GAAAAAGGACTGTTTAAAAAGTCAACCTAATTGATATATACCCCTCACAC AAATATTAGTGGtctaaaaaagagagaaaacagcaaaaaaaaaagtaaag catAATCAAAAATccgtcttcaaaaattttctcacaatGAAATTTTATAA GCTTAGCTAAAGATTATCCGGCCACACAATTTTTATCATCGTCATAAAAA TCATTCGAAAGCTAATTGATAATAAAATATTATTGTCTCCTACCCTTTTG TTCAGAAAGAATTTTCCACGCGTTTCGTACATTATCACGACTCTCTCCTG ATGGACTTTTTGAACCAACTGATCTCATTGGGTATCCAGAACAATAActt caattttaaaacaaaaggttTTTATTGCTTCATATACAGTAACAGAAAAG TTACCTAGAAACTCCAAGTAGAATCTAGCCTTTATTTAAttgtatttttc tattgttctaaaatCAATCACGTGTGTAATCGTAAGCTaaaaagctaaat tttattGACGATACAAAAATAAAGGGGACAAAGTCTGCATATTTTATGCA ATGAGAAAAACATCTGGGGGTGTTGTAGAGAGTTGAGAGTGAAAAAAGGT GCGTAACAagattttcgaagatttttttgaTTAATCCAAGATAGTAACGA CTTAAACCGAtcagcgaaaaaaaaaaacgtttcacttcattataattttt taaggttttgaaatAATTCATCGGACTAATATTATTGATGATCATTATAA GCTTGGTATTTCTTTAAGtattttgttattcaaattcactacattttttt tatattgtacaaacttcTTTTGGTTGGTAAAGGGAAAGGTCATCATTTTC GAGCTTTGTTGAAACTCAGCAAAAAGGTTTTTGAGCCATcttataaaagt ttttgaacCGTAATAACATCGGCGCGATACTTTGGTGGAACTTATAAGTG AAATCGCTCACATTTTAGTGTGCTCGGAACTTACAATGTTAACTAGCTAT GTAAGTATACAATGAAGTCTTGAATTGAAAAAAGGCTTGCCAAAGACAGG GGCCAcggctccactttgaaagtATTAGGGCCACATAATATACTGACTAA GGAGACGCCACTGGATGGGGCCGACGGGTGAAAAGCAATTTTTAGCTCTT TTAGATTACCTAAAACAGACCTGTTTTAGGCGATCTGAAGGTTTAAGGTT ATTAAACAGAATTTGACTTGAttggtaaattttctttttgttttgaaaaa atgtgccTCCCCCCCGCTGGCGCAGCGCCTGTAAAGACTACTATTGGTTA ATGTCAGAGGATGCTATCGTCTGTTAGAGGGACAGTTAACGCTGGGAAAA CTTATAAGCGCGTAGTTTACTGTCGTAATGAGGGGTTACGGAAAGAATAG TGGCGGAAAAGTTAGGAACAAACACTGCTAGCACAGTAAAAACCGTCATC AATGTTCACCTTGTACCGGGCTTATCTTCGGCACTCAAATTAATCCCACT TTCTAAATTATTTCCGTTTTAGTGATCTTGTCTAAGTTGATCTTTGCTTT AGAATTTTAGACAGTAAAGTACAGTAAGAACGGGAGTACAATACAAACac aatattcaatttcaaaatattatagtaaaagattttttcaagtgACTCTT CGATACTGAATAAATTCAACTTACGCGACATTGAGAACGTTGGGTTACAA AAAGATTAGGTTAATGGGTCAAGGAGAAACACTCTTCCTCCAAAGCGAAG GTTTGAAAACAGACTTATCTTTTCCCAAGCTAATTAATTTACCTTTCAAC ATTGCAACATGCATAGTGcggttttttttgtcaaataagGCCACATATCA ACCTTAACTATCGAGACTTTATGAGAAAACTTTActtaaaataagagaaa aactGACCCTCAAAATTAGGATTTTACTAATATCAAAATAGTATTAGTTC GATAAGGGGAGCTTCAGGAAGCAGCAAGGTGGCGATACATGTAGAGTTCG TTACTTTGCCAAAAAGAAATTACGAAACCCTGCTAATGTTAATTACTAGT TTGTTAGCGTTTTTTGCAAGATGATATGTGATATCTTCAATTCAATTTTC GGATGATCATGACAGAAGGCTGATAATCTGGTTAAAGCGTTACCTACTCA CCATTAGCTCTGGATCATATACCACACATTAACTAAATCGAGATCTCAAA TACTTTATTAATATTGACATTGTgtttaacttatttttaacaTCTTTATT TCAGATCTCACACGAGCGCGAACGCAGGATGACGTGGCCCTATAATCCAG TACCATCCTATCATGTACCACACCATGGACCATATAACTTCCCTGGACAT TACCCCCTGAATTATTACGGTAAgacttttcaaactcgagatgtATAAAA GTCAAAACCTCAAAACGGCGCTAATTTTTCGCTGCCAGACCCTGCTGAAA ATATCTGAATTTTCACTTTTgaagaaaaaggtcaaattctGTTTTTCGAG TAATTCTGGTAAACGAAGAATACCTTAAAAAGACTAGTAATATTTCCGTT GGTTGAAATTGTCACAAATACCAAATACAGAACTAAGCGTTACGTACTTT CATTGGTACAACAAAACGGAGGAAAGTTAAACTCggtaatattgaaaata aaacgaAAAGTAACTAACTTACAGTCTCATGGTACAGTTTCCATTCTACT TCACTCGACTGTCTTTTCCTAAaggaatacatgtttttttttataagcat acaaaaatccgaaaacaggctcaaagatgcttaggtcgaaagcttaataa tgctgaaaaatgcttgaggggatgcttaaatctaaagcataaatttaagg aaatacaaaaaatccgtaaaattccagccaaaaaaagccaaaatcaggaa aaacatttttcgtaggctcaagttatgcttgccatatgcttaatttttcc ccatatctgagcctagatatgcttataagtacaatgcttataaaaaaaat aatttAGATTTCTAGGtaataatatttaaaatattttgttaaatttcagg ATATCCAAGAAAGCAAAGACGTGAGCGTACAACATTTACCAAAGGACAAT TAGAAATATTGGAGAATTTATTCCGTGAGACGAAGTACCCTGATGTTTTT ATGCGCGAAGACGTAGCAAGAAGAATCAGCCTACCTGAATCTAGAGTCCA GGTTAGTTATTATGAAATCTCAACATCTTCTGATATTATGATAATCTTCA TCGCACAACCTATAACACAAGtataataaagaaatattaaggAGCAATAT GTGAGTGGTCTAAAGCAATTAGCTCATAGATAGCCGAAATCGCTGGCCCT GTTAAAATAATGGAAACGCGGTCTATGGGTTGTAGACTACTGGGGTATCT ATGTAAAATAAAGACTTTATGcagaaagtttttgtttgtttttgtttttg taatgaaaaattaactctggcTGGCCGGCGAATTCATAGCAAACGCAGTG TATTTATTAGcgtaaatatgtacttgaggcgAACCGAACTTTTCGAACGG CTAATTGTAATTATTTTCGTACCTTGGACCGTCGAAATTCGCCGTTTGCC GGGCCTAAATAAGACCCTTAAGCTTTATGTATCTAATACATTGCAAGTTT TGGCTGATTCGAACACGATCGGGAACTtctttgttcgaattataggagAT GAAAGCATTTAATAAGAGGCTCCACTTGACGAAATTTAGTCCAAATTATA AAGAGATTAAAATAATAGAAATCGATAATCTCCGAttatttaacattttc aaacttttttcatattccaGGTTTGGTTTAAAAACAGGCGTGCAAAACAC CGACAGAAATCCAAGAAATCATCATCTACATCACAAAGTACGAACTCAGA TTCCAGTCCTGAACGAGGAGACCGTTCGCCTGCCCTCCAATCTCCTAACT CTGATAAATCACACAACATTGACCCACCACCACTTTCGTCACCGGCAAAA CCGAACCATAGCAACAGCAACCATAGCAACAGCAACCATAGCAGCAGtaa taacaacaataataatgGCAGTAATGGAAACACAACATCAGAATCAACAA ACGAGTTTAATAACAACAAATCCCAATGCACATTCAATAACAACCATTTA CCTCAAAATCCATTAACACCAACCACGCCTACAAACACGGGCGGATATCC GCCACTCGAAAGAGCACCCTCGTATCCTAACTACATCCCTCAATCTTTCC AGCAATCGCAAAGAGGATATGGTGGACAATCAGATTCGTCATACTGTCCA TATTCACCGACCAGCGGTCGTCAATCTTTCTACCAATCCTCACATCTGCA CCCACATTCAACTAGCGATTACCAGCCATGTGCAGTAGATGTTCATGGCT CTACACCTTTAAGTCCTGGTTGGAATACATATGGTCCGAACATATGAGAC TAGTTTAAATAACTACATTTAAGTGATTCACCAAAGAATAGtgatgtcag atctaacaagtTTCCCACAATCTAACAAGATCGAAGTGACACAAACTAAA CCCTAATTGAAAATAAGACAGAGACATGTCTCTTTAAGAAATGGTTAGTG GTTTCCGCATATTCAATTGTTGATAAAACAGTAGAAGAAGTAATTGGTAG CGAACCAACGACAGGATAACTCTTAATTCCGAAATTCTGTATGCGCGGCA AGGGAAAAAGGAAACTTAATTTATTCAGGTCATATTGGCTTTTAATTTAG TTTGAAACAAGATTTCTCATCTCGCCTATCAgttttctgttttcaaattt gaaatgtaaTAAATTGTAAAGAGCTGAAACTGCAGAAAATTTAGAACGat acaatttctttttttaaagatatttttttgaacttttagaaatttttcgt ttttccaaTAATTCTAAGACAAACGAATATATTATTGTGTATAGCTg
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000267XLOC_000267Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000393-exon-sc0000002-1491911889:17050..17457TCONS_00000393-exon-sc0000002-1491911889:17050..17457Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1510915933:17050..17457TCONS_00000393-exon-sc0000002-1510915933:17050..17457Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1575043694:17050..17457TCONS_00000393-exon-sc0000002-1575043694:17050..17457Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1491911889:21554..21668TCONS_00000393-exon-sc0000002-1491911889:21554..21668Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1510915933:21554..21668TCONS_00000393-exon-sc0000002-1510915933:21554..21668Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1575043694:21554..21668TCONS_00000393-exon-sc0000002-1575043694:21554..21668Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1491911889:22349..22500TCONS_00000393-exon-sc0000002-1491911889:22349..22500Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1510915933:22349..22500TCONS_00000393-exon-sc0000002-1510915933:22349..22500Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1575043694:22349..22500TCONS_00000393-exon-sc0000002-1575043694:22349..22500Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1491911889:23120..24246TCONS_00000393-exon-sc0000002-1491911889:23120..24246Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1510915933:23120..24246TCONS_00000393-exon-sc0000002-1510915933:23120..24246Clytia hemisphaericaexon
TCONS_00000393-exon-sc0000002-1575043694:23120..24246TCONS_00000393-exon-sc0000002-1575043694:23120..24246Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:17050..24246 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0.0491152 0.167948 0 0.0711992 0 0 0.127762 0.139478 0 0 7.58039 8.07817 0 0 6.40223 8.85403 11.9144 9.10721 6.71527 7.88306 1.56307 2.95362 1.13947 2.61502 0.14145 0 0 0
Blast
BLAST of TCONS_00000393 vs. Swiss-Prot (Human)
Match: OTX2 (Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 7.239e-26
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 1
Query:  502 HYPLNYYGYPRKQRRERTTFTKGQLEILENLFRETKYPDVFMREDVARRISLPESRVQVWFKNRRAKHR 708
            H  + Y   PRKQRRERTTFT+ QL++LE LF +T+YPD+FMRE+VA +I+LPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
The following BLAST results are available for this feature:
BLAST of TCONS_00000393 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
OTX27.239e-2669.57Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1... [more]
back to top