Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000259 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000259
Unique NameTCONS_00000259
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3858

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000259 ID=TCONS_00000259|Name=TCONS_00000259|organism=Clytia hemisphaerica|type=transcript|length=3858bp
ctaatttgagctctgatactcacggtaatctattcaagctgctcactaca
ctttcttattcccttgctatttgtcctatttttttctgattttgatcgac
aggtaggtccattcagcatgttgcttgtttttattatttcagaAATTGTA
TAAAAAACCTGTCAAGTAAAATATGACAGAAAGGTTATCTTCTCCAAAAG
CAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTATCatcaaat
cttttcaaattaCGTGAAAATGACTCATTGTGTGACGTGACCCTCATTTC
TGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTAGTG
AATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAAGAC
GAGGTCCCATTGAAAGGAGTGGATACAAAATCACTAACAGTGCTGGTCAA
TTATGCATACACCGGAGTAATCTTCATCGACGAAGTCAACGTACAAACTA
TTTTGGAAACTGCCGATCTTCTACAATTTCAAACAGCAAAATCATTATGT
TGTGACTTCATTAAGGAACAATTGAGTACTGAAAACTGTCTGGATATCTT
CCAGTTTGCAGATGTATTCCATTGTGATGACGTTTTGTCTTTATCTCAAG
GTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAGAGTTTCTCT
TCCATCAATTATCACACTTTTGTTAAACTGATATCTGATGATTGTTTGAA
TATTCACCAAGAAGGAGAGGTCATTACTATGATTTCAAAATGGATTGAAG
CTGACGAGATAAACCGCAAAGagaaattattttcacttttccaATACGTC
AGATGGCCATACGTTGATCCAATCAAACTGCAAGAAATCAAGAACCAACG
CTTAATTGTTAACAATCGACTCTCACTACCAGAGATTGATAATGTGTTCT
CTGCAACTGAAGATTACAGCGATGTTGACAAGGTGGTTACTCTACATTCA
GAAGATTGCAGCATCACACCTTCCCTTAGTATGAGACATTCCTATGCATC
ATGGCTGTATGTGCTGGGTGGTGAACAATCATTCTTAATGGGAATGAAAT
CTACAGAAATTTTCGAAATGAATACATCGACGTGGAGTTACGGTTTCTCA
TTGAACAGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAATT
GTATGTTATCGGTGGCATGTGTCTGGGTGAGAAATTAAGAAGCGTCGAAA
GATATTTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGCCTCGTTGAAAAAT
TGTAAAGGTGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGC
TGGTGGATCTAGTGGCGGCGAACCCGCCTGCAAATACGTCGAACGATATG
ATGAGAGTAATAACCAATGGACACCAGTAGCCTGTATGAAGTCTAGACGA
CGAAGGTTTGGCCTCTGCCAGTTCAAAGGCAAACTCTACGCTTTCGGTGG
ATTCCAAGATAGCCTTGGTGACTTGAAAGCGTGTGAAGTTTATGATCCAG
AGGCTAATATATGGGAGAGTATTGCGTCTATGAAAACGAATCGTTGTGAT
CTTGGAGTAGCTGTTTTGTCAGGTTACATCTACGTGGCGGGTGGTGTCAA
CTCTTACACCGGTTCCATCAACACAGTGGAAAGATACGACCCGTCTTCAG
ATCAATGGACGTTGTGCCATCCTTTGTCGCAAGCCAGGGGTGGTCACTCC
ATGGTCAGTTATTTCGGACGGCTAATAGTCATTGGTGGAATGAACAGTTA
CATGCAAACGTGCCGCGATGCTGAGTGGTATAATGAGGTAACTGACCAAT
GGACGTCACTAGCATACACTAACGTGCCTCGATTCGGAAGCGTGGCTGTT
GTTCTTCCATTCTGTAAACAAGGTTCTGGACCCTCGCCTCCACCGGCCTC
AAAAAGCCAGGACAATGAAGAGGAATGAGAGTATGTATGGAATTTTGACA
AAGAAAGGGAGTGATGCTTTTTCtccctttttgatttttcactttAACTT
TGAAGAAAAACTGCCCACATACTTTACGGCACTGGGGCATTTTTAAATGA
CACAGACCAAGACTTGCCAAGacgactacacgtttttttataaggatatg
ccttaaaatgttcttaacttgttcttagtaaTTTGGACAtctaagcctta
tgttctcatatagcttgttcttagaaaaaaacgtgtataactTTTTAGAT
TTAGTCGGAACAATAAGCCACAGCCATCTTCCTGTAACACAATAATGAAG
AATGCATAACATGTTCTCTTGACGCGTCTTATCTATTGACTATACAGTCA
ACtttttctaattcgaacttctataattcgaatctttctgtaattcgaac
taaaacattggtcccctcagctggaaattagttttaaatgctctctttaa
tttctctaattcgaataaaagtCTAAatagtcccttgaagatcgaattag
agagaggcaACTGTAGATTTAGTCCTTTAGGGATCATACAAATGTTGTTT
AGCGTTAACTGATTAAGGGTTTTCATggtaataaaagaaataaacttAAT
AAGGGTGTatgattttattcatttttgtcggctgaaaaaaattaatgatt
tgaTATGTATTTGATtgataatttatgaaaattattATTGACAAGGAATC
ATAACAATGTCATTaataatttaacaaaaaatatcattcttTGGATTGAT
ATGTTTTCACACATTTCAAACTCTGTTGCAACCCGAACACTCAGGGGGTG
GAAGTTACActacaaaaaataacaatacagtggagtctccataactcaaa
cactcacggggaacacaaatttgttcaagttaaggaaatttcgagttata
gagtaaggtttataaggcattgttaactgaagggacctgAAAACTTGCTC
GAGTTAaggaaaatttcgagttatagaggttcgagttaaagagactcacT
GTATAAACCCTTTTTAAAGAGATTTTGAGGGGAATCTGTCTTTCAAACTC
TTCAAATTGTACATACATTTTATTAtaagtttttatttatataGTTTATT
ATTTGTTACTGTTGTGCACAGGAAATTATGAACATTGTGTTTTCGGCAAT
TTAgacaaaaatagttttttatattaagcaatattatggaaaaattgaat
ttttatgaCTCGGAGAAAGCAGCGCATGTTTTTTAATAATTCTACCTCTA
TATCAGGcttgcattatgcttagcattctattgttcttaaacaaaagatc
caatgtttaggtaccaaaagcTGAGCCTATGTATCTacttatagaaaaaa
acatgCAGCCCTCTGCTGTACTAAGTTGTACTGTATTTATGATTAAGGTT
TTTGATTTTAAGTATCGGAACTAGTAGGACCCGAATTTCCAGAGGCAAAT
TACATTCCTAACTGAAAtataaccactgacctttacgAACCCTCTGAAAG
TCATACcagttttaaaagtttgttcCAAAGATATTGTCAGTCTGTAATTT
TTTGCATATTACTATCGAAGGGGAAAAGACTTTCGGACTACTTAGGACTA
TTGTTTCGGCTCTAAATACAGAAAGAGTTTCATGGTTCGAAAAAGAAAGC
TTGTAACCTTAGTTTATTGACACTTTTTACCGtttatttatgaatttttt
ttcagttttttgaatttttagttgCTGCTTATATATAAATATTATAGTAT
TGgacattttataaaaagtgaaatttgatttttattgatTGTATTTTTAC
TTAAAGTCGCGAATTTAATGAAATAGCCTGTTAATATTATCGATCAGTGT
AAAAAATG
Run BLAST on NCBI

protein sequence of TCONS_00000259-protein

>TCONS_00000259-protein ID=TCONS_00000259-protein|Name=TCONS_00000259-protein|organism=Clytia hemisphaerica|type=polypeptide|length=601bp
MTERLSSPKAREIQNINIHTKTLSSNLFKLRENDSLCDVTLISDGIEIRA
HRVVLAACSEYFHAMFTSGMSETGKDEVPLKGVDTKSLTVLVNYAYTGVI
FIDEVNVQTILETADLLQFQTAKSLCCDFIKEQLSTENCLDIFQFADVFH
CDDVLSLSQGLFNKNWKKIVESESFSSINYHTFVKLISDDCLNIHQEGEV
ITMISKWIEADEINRKEKLFSLFQYVRWPYVDPIKLQEIKNQRLIVNNRL
SLPEIDNVFSATEDYSDVDKVVTLHSEDCSITPSLSMRHSYASWLYVLGG
EQSFLMGMKSTEIFEMNTSTWSYGFSLNRPRTSFAAVAHGDKLYVIGGMC
LGEKLRSVERYLEKEGRWKRLASLKNCKGDVKAAVIDDVVYVAGGSSGGE
PACKYVERYDESNNQWTPVACMKSRRRRFGLCQFKGKLYAFGGFQDSLGD
LKACEVYDPEANIWESIASMKTNRCDLGVAVLSGYIYVAGGVNSYTGSIN
TVERYDPSSDQWTLCHPLSQARGGHSMVSYFGRLIVIGGMNSYMQTCRDA
EWYNEVTDQWTSLAYTNVPRFGSVAVVLPFCKQGSGPSPPPASKSQDNEE
E
Run BLAST on NCBI

transcript from alignment at sc0000001:2456748..2467092-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000259 ID=TCONS_00000259|Name=TCONS_00000259|organism=Clytia hemisphaerica|type=transcript|length=10345bp|location=Sequence derived from alignment at sc0000001:2456748..2467092- (Clytia hemisphaerica)
CTAATTTGAGCTCTGATACTCACGGTAATCTATTCAAGCTGCTCACTACA CTTTCTTATTCCCTTGCTATTTGTCCTATTTTTTTCTGATTTTGATCGAC AGGTAGGTCCATTCAGCATGTTGCTTGTTTTTATTATTTCAGAAATTGTA TAAAAAACCTGTCAAGTAAAATATGACAGAAAGGTTATCTTCTCCAAAAG CAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTATCATCAAAT CTTTTCAAATTACGTGAAAATGACTCATTGTGTGACGTGACCCTCATTTC TGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTAGTG AATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAAGAC GAGGTAAAACCCTTTATTTGTTGCATCTCAATAATGTGAACCCAAGGCTG ATTTTTGCTTTGAAAATCTCAGTATTAAAAATTCTTGAGTCAATTTTTCA TTCCATGGAAATTTTATTCATCCTGATCATTACCTAGCTCTAAACCTTTT TCATTAATGATCATTTCGATTGATTCTAATTTTAGCAAGCTGAATAGGAT ATTCTATAAGTCAGCCGATTAGAAAGATTGCATCACATTAGTATTATTCT ATAATAATGTCAAGTTTTGTGCCATTACAAAAAAAAACATTTTCGAGCAC TTTTGAAAAGTATTTGGACTGAAAATTGCTCTCAATTTTGACAAAAAATA AATGGAGCCAAAATTTATAATTTTAAAATTGAACATGTTTTTTCAAGGTC CCATTGAAAGGAGTGGATACAAAATCACTAACAGTGCTGGTCAATTATGC ATACACCGGAGTAATCTTCATCGACGAAGTCAACGTACAAACTATTTTGG AAACTGCCGATCTTCTACAATTTCAAACAGCAAAATCATTATGTTGTGAC TTCATTAAGGAACAATTGAGTACTGAAAACTGTCTGGATATCTTCCAGTT TGCAGATGTATTCCATTGTGATGACGTTTTGTCTTTATCTCAAGGTCTTT TTAACAAAAACTGGAAGAAGATTGTGNATGATGTTTTGTCTTTATCTCAA GGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAGAGTTTCTC TTCCATCAATTATCACACTTTTGTTAAACTGATATCTGATGATTGTTTGA ATATTCACCAAGAAGGAGAGGTATGAAATAATTTTCTTTATTTCTCAACA TTAAAAAGACCTCCTTTGAGACCTCGTAGGCCATGCCCAAAATAGGTAAT CATTAGAACACGAACCACGAACGTTTTATTTTTGTTTTTGAGAACTTTTA TACAAAAAACTCTTTTGTTTGCCACAAAACATATATTTTAGACTTTCGAC ATTCTGCTGAAAATTATATTTTGAATTTATTGGAAAAATATGCAACGTTT ATACATACTACTCTATCACTAACCCTGATATCCTGGCTTTAAACTTCTTT TTTGATGTTTCTGGTTTACCGCCTGGTCTTCTCAAAGCTTTTTAGATTCA AATATCAGAAGGTAGCATATATGTAAACTTTACCAATTCAAATATTGCGC TGAGCTAAAAAAAAATTTAACCCTGGGTTATTAAGCATCTAGGTAGACCA AGCTGTAAATAGCAGAAACATCAAAATAAGAAAATAATTTACAGCTTTGA TATCCAGGCTGTTCTATCTCCATACTTTTGTTTTGTTGAATGATATCTTG ACTTAAAAGTATTTATTCCTTCATGTTTAGGTCATTACTATGATTTCAAA ATGGATTGAAGCTGACGAGATAAACCGCAAAGAGAAATTATTTTCACTTT TCCAATACGTCAGATGGCCATACGTTGATCCAATCAAACTGCAAGAAATC AAGAACCAACGCTTAATTGTTAACAATCGACTCTCACTACCAGAGATTGA TAATGTGTTCTCTGCAACTGAAGATTACAGCGATGTTGACAAGGTGGATT AAAGTGGATTAAATTTCGCGTGGCTTTTTTTTTTCCGAGAATCGAGAGTC CAAAATTTTAGCCTCTGCCTCTTTTTCATCCAATTTCTTTTATTTTCTCT AAGAGTTATTGGCCAAAATTAGGTTTTTTAATTTTTGGCGAGGACTAATT TTCGCAAAAATGGCCAAAATTTGTGAAGATTGCAAAAATTAATCCACGCA AAATGTAAGTTACTTGAATCTTTATTTGATTTAGGTTTTCACAGCATTTT CTTCGCTTGATTTTATCCGAAGGCATAGTGGGAACAAGGAGGGGAGGTTT TAGATATGATAGAGGACCCCGTCAACAAATTTCAAATGAATTCCAGGTGC TAAAACTTCGGATCCCTCTATATTTTAAGAAATCAAGAAACTGTGTTGGT TATGCAATTTACCTAATATTCTAATTCGAAAAAAGTACTATATTATCACA AAAAAATGGCCAAAATTCGCAAAAGTCCACGCAAAATTTAATATAGCTGA GTTCGTTGAATCTTTATTGGATTCAGGGTTTTCGCCGCTTTTTCTCTCGA AGATCGAATTAGAGAGAGTTAATATGGATGTACTAATTTAAAACTTTGAC TCATTAACTTTATTCTAGGTGGTTACTCTACATTCAGAAGATTGCAGCAT CACACCTTCCCTTAGTATGAGACATTCCTATGCATCATGGCTGTATGTGC TGGGTGGTGAACAATCATTCTTAATGGGAATGAAATCTACAGAAATTTTC GAAATGAATACATCGACGTGGAGTTACGGTTTCTCATTGAACAGACCAAG GACTTCTTTTGCTGCTGTAGCACATGGTGATAAATTGTGAGTTTCTTTCC GTCTACTCTAGATCTAGTGGTAACCTCGTCCCTGTGTACTCCAGGCTTTA TTTGCGTTACTGATGGACGCCAGAGAATAATATTATCTAGCGCCATCATT AAGCATAAAAAAGCTGATTGATAATACGCAGGGAACGAGGTTGCTAGACT AGTAATTTTAAATATTCCTAGACTGGAGTCGTATATAATCCATGCAAATC AGTAATATGGATATGATAATAGGATAATTGTTACAGGATAATATCAGTTT GTATAGACAATATGCCTCTTTCATTATTTTTTGCCTATTTTGTTATCTAA AATCTTTAGTTGGACTGGTTGAAAAAGGGCAAGTAAAACAAACTTTTGTT CCCACTTTGAAGCAAATGGATTTTAACATTGTCTGATTTCAAAAAGTGAG ACTTCTGAGTGAGATATTATCCTTCCATTATGTTCTTCATTTTTTTTCGA AACTGTAGGTATGTTATCGGTGGCATGTGTCTGGGTGAGAAATTAAGAAG CGTCGAAAGATATTTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGCCTCGT TGAAAAATTGTAAAGGTAAAGATAATTTATTCACCCAGTGCTCAAATCTT TGTTGGATGAATGTCTCTCCTAAAAGGAAATTTCAATATACGCCCATCGA CAAAAATTCTTAAACGCCAGGGGCGCTTATTCGAAGAAGTAAGGTGTGAT TTTGATAAGCATTATTAGTAAAAATATGTATTATGCATGCTATTTTTATT GTTTTTGAAGGTTTAAATGTTGGGAAATTTTGTAAACTGAGGCTCGAGTT TTTTCTAATATTTGAGCATGGATATAGTGATAAGAATTGTGTTCATCCAA TCAAGTTTTTGATTAAAAAAAATAGGAATTTCATTTTTTTAATCCGTCTA CTGAGTCATCTAGACTGGGAGCACTTAAAAAAATTATTTGATTTTAAGTA GCCTGGAATTATTAGGATTATTACTAGAATTAATTATGATTTTAGAGACT TAAAGTAGGATTTCAGTGATTTTCTTTCAAATTGGTAATCTAGTCAAATA CTCCTAGTCTCTGAACTTAACGTCGTCAAACATTATCCAAAAACGAGAAG ATTATATTCTATTCTATAGGTTTGCCCACTAAAAAATCTTCCAACCATTC TAGGTGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGCTGGT GGATCTAGTGGCGGCGAACCCGCCTGCAAGTAAGAATTTCTCTTATTCTG TTTTGCTCACTTTTCATACTTTGTAAATGGGTCTTTTCATAAATTACTTT GAGTGCAACATCTGTCTCGTTTTGAAAGCATCACTAAGGTTATTTTAAAT CCCTTGAAGATTCAGGTGTAAACTTTTTAAATAGAGTAAACTTCTTTTAA TTCACCTGGGAGATAATTCATCTGGGAATCGATTACCATAGCAACATTTG AATGTGGGGTGAGCGTAAGGTCTCAGCCAACTTTCTCCGATTCGAACCTC TATGCTCTGAATCTCTCTGTAATTCGAACTAAAGCATTGGTCCGCTCAGC TGGAAAGTCGTATAAAAACACTCTCTGTAATTCGAATCTTTTTCCAATTC GTAGAAAATTCTTGGCCCTTGAAGGTCGAAANAATTCGAATTTTTCTCCA ATTTGCAGAAAATTGTTGGTCCTATGAAGATTGATTTTAGAGAGAGTCAA CTGTATAAGTGAAGACCAGGCCCGGCGGAACAACCGTAAGAGTGGGGAGG ATGAAGGCTCAAAATGAGATAAAATTTGCTAGGAATTGAGAAAAAATCTC CTTTGCTTAAAAGTGGGGAAGCTGAAGTCTCCCCAGCCTGAAGACGAATG GGTGCACTTTCTTTTCTTCCTATAGATACGTCGAACGATATGATGAGAGT AATAACCAATGGACGCCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTT TGGCCTCTGCCAGTTCAAAGGCAAACTATACGCTTTCGGTGGATTCCAAG ATAGCCTGGGTGACTTGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAAT ATATGGGAGAGTATTGCGTCTATGAAAACGAATCGTTGTGATCTTGGAGT AGCTGTTTTGTCAGGTAAGCTCAATTTTCTGGCGAGTAAGCTCAAGCTTA ATTGCAAAATTTGTTAAACTTATTCTTTCAAAATACCCAGGGGGGGGGCA CGCAGTTACTACAAGACATGATGTGTAGTAAGTGCTTTTTCAACACTATT TTTCAGGACCACCACCCTTTGCAGTTACTACACCTTGGTAGTAACTGTTT TCAGAAAAGATTTCCAGGTACCACCCCTGTTTTTGAGTGATATCATCAAA AACATGCTCGAAATTACCCTAAATTGCGACTATTTTTCTACCTAAAGCCA TTTTTGCACTAGATTTTCTCTTAATTTACTTGGTTAACAGCTGTTGAGAA CATTTTAATGATAATTAGGGAAAGCATAATTTCAAAGTTGGGTCTGAGAA AAATTTCAAATTTTTTTTCGTCCATNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNCTACACTGTGTAGTAACTGTTTTCATAA CTTCTGAATACAGTACCACCACGGTAGTAAGTGTCATACTGTCTTGTAGT AACTGCGTGCCCCCCCCCCTGAAATACCCTGGATTTAACGGTCAAGATAA AAGGAACTCTTTACTTTCATTTCTGTATGGACCTCTAGATTATTGATATC AAACTAATCCATGTATTGTGTTTACTCCGATAGCTCATTTACTGCTCATA TGAAATCCGCGTATAGTCATTGTGATTTATGATCATGACCATAGAAGTCT TTCATATTTGTTGAAGTTACGTAACTTCCGCTATTATTACTTTCGATTTT CGTCAGGGATCACCTTTTACAGATCCGAACGTTTGCTTCCATAATGGTAA AAAATTACGTAACTTAACCGAACATGAAAAACCTCTAGATACAGATCTTA GAGAGTCAGAAATTTGGATTGTCCCAATTTGAATCACGGGAGGGAATTCA TAATGGTAGATTCTCGATAAAAGACCCTCTAAAAACCACCACGTCAAGTC ATAATGACTGTACACGGATTTGCATACGATCAGTAACTGAGTCCATACTG AGGGAGTAGTNCAGCCAACTTTCTCTAATTCGAACCTCTATGCTCTGAAT CTCTCTGTAATTCGAACTAAAACATTGGTCCGCTCAGCTGGAAAGTCGTA TAAAAACACTCTCCGTAATTCGAATTTTTCTCCAATTTGCAGAAAATTGT TGGTCCTATGAAGATTGATTTTAGAGAGAGTCAACTGTATAAGTGAAGAC CAGGCCCGGCGGAACAACCGTAAGAGTGGGGAGGATGAAGGCTCAAAATG AGATAAAATTTGCTAGGAATTGAGAAAAAAATCTCCTTTGCTTAAAAGTG GGAAAGCTGAAGTCTCCCCAGCCTGAAGACGAATGGGTGCACTTTCTTTT CTTCCTATAGATACGTCGAACGATATGATGAGAGTAATAACCAATGGACA CCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAGTT CAAAGGCAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGACT TGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAATATATGGGAGAGTATT GCGTCTATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCAGG TAAGCTCAATTTTCTGGCGAGTAAGTTCAAGCTTAATTGCAAAATATCTA AGATTTGTTAAACTTATTCTTTTAAAATACCCCTGATTTAACGGTCAAGT TAATGCCCTTAATTTTCGCGCACTACCACTGCGTGGAAATTAAAGGGTGC GCGCACTAGGTCGCGCGAAAATTAAAAGGTGCGTGAATTAGCAAATAAAT TAATAAACCCAATTAATCATGATTTTTGATAAAAATATGATATTCATAGT ACAGTGTTTAGCAGACACCATCGAGCAAACAAGATTAGTGTCCGCTAATT AAAGTGTTGTATTTACTCCGATAGTTCATTTACTGCTCATATGAAATCCG CGTATAGTCATTGGGATTTATGATCATAACCATAGAAGTCTTTCATATTT GTTGAAGTTACGTAACTTCCGCTATTATTACTTTCGATTTTCGTCAGGCA TCACCTTTTACAGATTCGAACGTTTGCTTCCATAATGGCAAAAAATTACG TAACTTAACCTAACATGAAAAACCTCTATACAGATCTTTAGATTGTCCCA ATTTGAATCACGGGAGGGAATTCATAATGGTAGATTCTCAATAAAAGACC CTCTAAAAAAACACCACGTCAAGTCACAATGACTGTACACGGATTTGCAT ACGAACAGTAACTACTGAGTCCCTACTGAGACAGTAGTTGTCTGTTTTGT TACTATTTCTTTGGCTATATCTACCCATATACCAGTACGTTGAGTTAAAC ATTTAGGTTACATCTACGTGGCGGGTGGTGTCAACTCTTACACCGGTTCC ATCAACACAGTGGAAAGATACGACCCGTCTTCAGATCAATGGACGTTGTG CCATCCTTTGTCGCAAGCCAGGGGTGGTCACTCCATGGTCAGTTATTTCG GACGGCTAATAGTCATTGGTGGAATGAACAGTTACATGCAAACGTGCCGC GATGCTGAGTGGTATAATGAGGTATTATTAGTTTTTATAAATACTTCCGT TTTCAAAATCCCCTTCTCTCTAAGTGACCTTGTGAGAGTTTACTAGGGGC TGTTAATACGGTTAGCCAATTCTTTGGTTCGTATATAAAAATAGCGTTTT TAAGCAAATAATGAATGCATAAGCAGGAAACTTCGAGTATCGAGAAGAAA TATATTAAACCGTTTCTTTAATCCTTATGTAGAAATAGTGTTTTATGTAT GGGCTCGCATTTTCTTCAAATCAGGTAACTGACCAATGGACGTCACTAGC ATACACTAACGTGCCTCGATTCGGAAGCGTGGCTGTTGTTCTTCCATTCT GTAAACAAGGTTCTGGACCCTCGCCTCCACCGGCCTCAAAAAGCCAGGAC AATGAAGAGGAATGAGAGTATGTATGGAATTTTGACAAAGAAAGGGAGTG ATGCTTTTTCTCCCTTTTTGATTTTTCACTTTAACTTTGAAGAAAAACTG CCCACATACTTTACGGCACTGGGGCATTTTTAAATGACACAGACCAAGAC TTGCCAAGACGACTACACGTTTTTTTATAAGGATATGCCTTAAAATGTTC TTAACTTGTTCTTAGTAATTTGGACATCTAAGCCTTATGTTCTCATATAG CTTGTTCTTAGAAAAAAACGTGTATAACTTTTTAGATTTAGTCGGAACAA TAAGCCACAGCCATCTTCCTGTAACACAATAATGAAGAATGCATAACATG TTCTCTTGACGCGTCTTATCTATTGACTATACAGTCAACTTTTTCTAATT CGAACTTCTATAATTCGAATCTTTCTGTAATTCGAACTAAAACATTGGTC CCCTCAGCTGGAAATTAGTTTTAAATGCTCTCTTTAATTTCTCTAATTCG AATAAAAGTCTAAATAGTCCCTTGAAGATCGAATTAGAGAGAGGCAACTG TAGATTTAGTCCTTTAGGGATCATACAAATGTTGTTTAGCGTTAACTGAT TAAGGGTTTTCATGGTAATAAAAGAAATAAACTTAATAAGGGTGTATGAT TTTATTCATTTTTGTCGGCTGAAAAAAATTAATGATTTGATATGTATTTG ATTGATAATTTATGAAAATTATTATTGACAAGGAATCATAACAATGTCAT TAATAATTTAACAAAAAATATCATTCTTTGGATTGATATGTTTTCACACA TTTCAAACTCTGTTGCAACCCGAACACTCAGGGGGTGGAAGTTACACTAC AAAAAATAACAATACAGTGGAGTCTCCATAACTCAAACACTCACGGGGAA CACAAATTTGTTCAAGTTAAGGAAATTTCGAGTTATAGAGTAAGGTTTAT AAGGCATTGTTAACTGAAGGGACCTGAAAACTTGCTCGAGTTAAGGAAAA TTTCGAGTTATAGAGGTTCGAGTTAAAGAGACTCACTGTATAAACCCTTT TTAAAGAGATTTTGAGGGGAATCTGTCTTTCAAACTCTTCAAATTGTACA TACATTTTATTATAAGTTTTTATTTATATAGTTTATTATTTGTTACTGTT GTGCACAGGAAATTATGAACATTGTGTTTTCGGCAATTTAGACAAAAATA GTTTTTTATATTAAGCAATATTATGGAAAAATTGAATTTTTATGACTCGG AGAAAGCAGCGCATGTTTTTTAATAATTCTACCTCTATATCAGGCTTGCA TTATGCTTAGCATTCTATTGTTCTTAAACAAAAGATCCAATGTTTAGGTA CCAAAAGCTGAGCCTATGTATCTACTTATAGAAAAAAACATGCAGCCCTC TGCTGTACTAAGTTGTACTGTATTTATGATTAAGGTTTTTGATTTTAAGT ATCGGAACTAGTAGGACCCGAATTTCCAGAGGCAAATTACATTCCTAACT GAAATATAACCACTGACCTTTACGAACCCTCTGAAAGTCATACCAGTTTT AAAAGTTTGTTCCAAAGATATTGTCAGTCTGTAATTTTTTGCATATTACT ATCGAAGGGGAAAAGACTTTCGGACTACTTAGGACTATTGTTTCGGCTCT AAATACAGAAAGAGTTTCATGGTTCGAAAAAGAAAGCTTGTAACCTTAGT TTATTGACACTTTTTACCGTTTATTTATGAATTTTTTTTCAGTTTTTTGA ATTTTTAGTTGCTGCTTATATATAAATATTATAGTATTGGACATTTTATA AAAAGTGAAATTTGATTTTTATTGATTGTATTTTTACTTAAAGTCGCGAA TTTAATGAAATAGCCTGTTAATATTATCGATCAGTGTAAAAAATG

Coding sequence (CDS) from alignment at sc0000001:2456748..2467092-

>TCONS_00000259 ID=TCONS_00000259|Name=TCONS_00000259|organism=Clytia hemisphaerica|type=CDS|length=18060bp|location=Sequence derived from alignment at sc0000001:2456748..2467092- (Clytia hemisphaerica)
GTAACTGACCAATGGACGTCACTAGCATACACTAACGTGCCTCGATTCGG
AAGCGTGGCTGTTGTTCTTCCATTCTGTAAACAAGGTTCTGGACCCTCGC
CTCCACCGGCCTCAAAAAGCCAGGACAATGAAGAGGAATGAGTTACATCT
ACGTGGCGGGTGGTGTCAACTCTTACACCGGTTCCATCAACACAGTGGAA
AGATACGACCCGTCTTCAGATCAATGGACGTTGTGCCATCCTTTGTCGCA
AGCCAGGGGTGGTCACTCCATGGTCAGTTATTTCGGACGGCTAATAGTCA
TTGGTGGAATGAACAGTTACATGCAAACGTGCCGCGATGCTGAGTGGTAT
AATGAGATACGTCGAACGATATGATGAGAGTAATAACCAATGGACACCAG
TAGCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAGTTCAAA
GGCAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGACTTGAA
AGCGTGTGAAGTTTATGATCCAGAGGCTAATATATGGGAGAGTATTGCGT
CTATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCAGGTGAC
GTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGCTGGTGGATCTAG
TGGCGGCGAACCCGCCTGCAAGTATGTTATCGGTGGCATGTGTCTGGGTG
AGAAATTAAGAAGCGTCGAAAGATATTTAGAAAAAGAAGGCCGTTGGAAG
CGTTTGGCCTCGTTGAAAAATTGTAAAGGTGGTTACTCTACATTCAGAAG
ATTGCAGCATCACACCTTCCCTTAGTATGAGACATTCCTATGCATCATGG
CTGTATGTGCTGGGTGGTGAACAATCATTCTTAATGGGAATGAAATCTAC
AGAAATTTTCGAAATGAATACATCGACGTGGAGTTACGGTTTCTCATTGA
ACAGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAATTGTCA
TTACTATGATTTCAAAATGGATTGAAGCTGACGAGATAAACCGCAAAGAG
AAATTATTTTCACTTTTCCAATACGTCAGATGGCCATACGTTGATCCAAT
CAAACTGCAAGAAATCAAGAACCAACGCTTAATTGTTAACAATCGACTCT
CACTACCAGAGATTGATAATGTGTTCTCTGCAACTGAAGATTACAGCGAT
GTTGACAAGGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAG
AGTTTCTCTTCCATCAATTATCACACTTTTGTTAAACTGATATCTGATGA
TTGTTTGAATATTCACCAAGAAGGAGAGGTCCCATTGAAAGGAGTGGATA
CAAAATCACTAACAGTGCTGGTCAATTATGCATACACCGGAGTAATCTTC
ATCGACGAAGTCAACGTACAAACTATTTTGGAAACTGCCGATCTTCTACA
ATTTCAAACAGCAAAATCATTATGTTGTGACTTCATTAAGGAACAATTGA
GTACTGAAAACTGTCTGGATATCTTCCAGTTTGCAGATGTATTCCATTGT
GATGACGTTTTGTCTTTATCTCAAGATGACAGAAAGGTTATCTTCTCCAA
AAGCAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTATCATCA
AATCTTTTCAAATTACGTGAAAATGACTCATTGTGTGACGTGACCCTCAT
TTCTGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTA
GTGAATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAA
GACGAGGTAACTGACCAATGGACGTCACTAGCATACACTAACGTGCCTCG
ATTCGGAAGCGTGGCTGTTGTTCTTCCATTCTGTAAACAAGGTTCTGGAC
CCTCGCCTCCACCGGCCTCAAAAAGCCAGGACAATGAAGAGGAATGAGTT
ACATCTACGTGGCGGGTGGTGTCAACTCTTACACCGGTTCCATCAACACA
GTGGAAAGATACGACCCGTCTTCAGATCAATGGACGTTGTGCCATCCTTT
GTCGCAAGCCAGGGGTGGTCACTCCATGGTCAGTTATTTCGGACGGCTAA
TAGTCATTGGTGGAATGAACAGTTACATGCAAACGTGCCGCGATGCTGAG
TGGTATAATGAGATACGTCGAACGATATGATGAGAGTAATAACCAATGGA
CACCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAG
TTCAAAGGCAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGA
CTTGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAATATATGGGAGAGTA
TTGCGTCTATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCA
GGTGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGCTGGTGG
ATCTAGTGGCGGCGAACCCGCCTGCAAGTATGTTATCGGTGGCATGTGTC
TGGGTGAGAAATTAAGAAGCGTCGAAAGATATTTAGAAAAAGAAGGCCGT
TGGAAGCGTTTGGCCTCGTTGAAAAATTGTAAAGGTGGTTACTCTACATT
CAGAAGATTGCAGCATCACACCTTCCCTTAGTATGAGACATTCCTATGCA
TCATGGCTGTATGTGCTGGGTGGTGAACAATCATTCTTAATGGGAATGAA
ATCTACAGAAATTTTCGAAATGAATACATCGACGTGGAGTTACGGTTTCT
CATTGAACAGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAA
TTGTCATTACTATGATTTCAAAATGGATTGAAGCTGACGAGATAAACCGC
AAAGAGAAATTATTTTCACTTTTCCAATACGTCAGATGGCCATACGTTGA
TCCAATCAAACTGCAAGAAATCAAGAACCAACGCTTAATTGTTAACAATC
GACTCTCACTACCAGAGATTGATAATGTGTTCTCTGCAACTGAAGATTAC
AGCGATGTTGACAAGGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAA
TCTGAGAGTTTCTCTTCCATCAATTATCACACTTTTGTTAAACTGATATC
TGATGATTGTTTGAATATTCACCAAGAAGGAGAGGTCCCATTGAAAGGAG
TGGATACAAAATCACTAACAGTGCTGGTCAATTATGCATACACCGGAGTA
ATCTTCATCGACGAAGTCAACGTACAAACTATTTTGGAAACTGCCGATCT
TCTACAATTTCAAACAGCAAAATCATTATGTTGTGACTTCATTAAGGAAC
AATTGAGTACTGAAAACTGTCTGGATATCTTCCAGTTTGCAGATGTATTC
CATTGTGATGACGTTTTGTCTTTATCTCAAGATGACAGAAAGGTTATCTT
CTCCAAAAGCAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTA
TCATCAAATCTTTTCAAATTACGTGAAAATGACTCATTGTGTGACGTGAC
CCTCATTTCTGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAG
CATGTAGTGAATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACT
GGCAAAGACGAGGTAACTGACCAATGGACGTCACTAGCATACACTAACGT
GCCTCGATTCGGAAGCGTGGCTGTTGTTCTTCCATTCTGTAAACAAGGTT
CTGGACCCTCGCCTCCACCGGCCTCAAAAAGCCAGGACAATGAAGAGGAA
TGAGTTACATCTACGTGGCGGGTGGTGTCAACTCTTACACCGGTTCCATC
AACACAGTGGAAAGATACGACCCGTCTTCAGATCAATGGACGTTGTGCCA
TCCTTTGTCGCAAGCCAGGGGTGGTCACTCCATGGTCAGTTATTTCGGAC
GGCTAATAGTCATTGGTGGAATGAACAGTTACATGCAAACGTGCCGCGAT
GCTGAGTGGTATAATGAGATACGTCGAACGATATGATGAGAGTAATAACC
AATGGACACCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTC
TGCCAGTTCAAAGGCAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCT
TGGTGACTTGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAATATATGGG
AGAGTATTGCGTCTATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTT
TTGTCAGGTGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGC
TGGTGGATCTAGTGGCGGCGAACCCGCCTGCAAGTATGTTATCGGTGGCA
TGTGTCTGGGTGAGAAATTAAGAAGCGTCGAAAGATATTTAGAAAAAGAA
GGCCGTTGGAAGCGTTTGGCCTCGTTGAAAAATTGTAAAGGTGGTTACTC
TACATTCAGAAGATTGCAGCATCACACCTTCCCTTAGTATGAGACATTCC
TATGCATCATGGCTGTATGTGCTGGGTGGTGAACAATCATTCTTAATGGG
AATGAAATCTACAGAAATTTTCGAAATGAATACATCGACGTGGAGTTACG
GTTTCTCATTGAACAGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGT
GATAAATTGTCATTACTATGATTTCAAAATGGATTGAAGCTGACGAGATA
AACCGCAAAGAGAAATTATTTTCACTTTTCCAATACGTCAGATGGCCATA
CGTTGATCCAATCAAACTGCAAGAAATCAAGAACCAACGCTTAATTGTTA
ACAATCGACTCTCACTACCAGAGATTGATAATGTGTTCTCTGCAACTGAA
GATTACAGCGATGTTGACAAGGTCTTTTTAACAAGAACTGGAAGAAGATT
GTGGAATCTGAGAGTTTCTCTTCCATCAATTATCACACTTTTGTTAAACT
GATATCTGATGATTGTTTGAATATTCACCAAGAAGGAGAGGTCCCATTGA
AAGGAGTGGATACAAAATCACTAACAGTGCTGGTCAATTATGCATACACC
GGAGTAATCTTCATCGACGAAGTCAACGTACAAACTATTTTGGAAACTGC
CGATCTTCTACAATTTCAAACAGCAAAATCATTATGTTGTGACTTCATTA
AGGAACAATTGAGTACTGAAAACTGTCTGGATATCTTCCAGTTTGCAGAT
GTATTCCATTGTGATGACGTTTTGTCTTTATCTCAAGATGACAGAAAGGT
TATCTTCTCCAAAAGCAAGAGAGATTCAAAATATAAACATACATACAAAG
ACTTTATCATCAAATCTTTTCAAATTACGTGAAAATGACTCATTGTGTGA
CGTGACCCTCATTTCTGATGGAATTGAAATCAGAGCGCACCGTGTGGTGC
TGGCAGCATGTAGTGAATACTTTCATGCTATGTTTACAAGTGGAATGAGC
GAAACTGGCAAAGACGAGGTAACTGACCAATGGACGTCACTAGCATACAC
TAACGTGCCTCGATTCGGAAGCGTGGCTGTTGTTCTTCCATTCTGTAAAC
AAGGTTCTGGACCCTCGCCTCCACCGGCCTCAAAAAGCCAGGACAATGAA
GAGGAATGAGTTACATCTACGTGGCGGGTGGTGTCAACTCTTACACCGGT
TCCATCAACACAGTGGAAAGATACGACCCGTCTTCAGATCAATGGACGTT
GTGCCATCCTTTGTCGCAAGCCAGGGGTGGTCACTCCATGGTCAGTTATT
TCGGACGGCTAATAGTCATTGGTGGAATGAACAGTTACATGCAAACGTGC
CGCGATGCTGAGTGGTATAATGAGATACGTCGAACGATATGATGAGAGTA
ATAACCAATGGACACCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTTT
GGCCTCTGCCAGTTCAAAGGCAAACTCTACGCTTTCGGTGGATTCCAAGA
TAGCCTTGGTGACTTGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAATA
TATGGGAGAGTATTGCGTCTATGAAAACGAATCGTTGTGATCTTGGAGTA
GCTGTTTTGTCAGGTGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTA
TGTAGCTGGTGGATCTAGTGGCGGCGAACCCGCCTGCAAGTATGTTATCG
GTGGCATGTGTCTGGGTGAGAAATTAAGAAGCGTCGAAAGATATTTAGAA
AAAGAAGGCCGTTGGAAGCGTTTGGCCTCGTTGAAAAATTGTAAAGGTGG
TTACTCTACATTCAGAAGATTGCAGCATCACACCTTCCCTTAGTATGAGA
CATTCCTATGCATCATGGCTGTATGTGCTGGGTGGTGAACAATCATTCTT
AATGGGAATGAAATCTACAGAAATTTTCGAAATGAATACATCGACGTGGA
GTTACGGTTTCTCATTGAACAGACCAAGGACTTCTTTTGCTGCTGTAGCA
CATGGTGATAAATTGTCATTACTATGATTTCAAAATGGATTGAAGCTGAC
GAGATAAACCGCAAAGAGAAATTATTTTCACTTTTCCAATACGTCAGATG
GCCATACGTTGATCCAATCAAACTGCAAGAAATCAAGAACCAACGCTTAA
TTGTTAACAATCGACTCTCACTACCAGAGATTGATAATGTGTTCTCTGCA
ACTGAAGATTACAGCGATGTTGACAAGGTCTTTTTAACAAGAACTGGAAG
AAGATTGTGGAATCTGAGAGTTTCTCTTCCATCAATTATCACACTTTTGT
TAAACTGATATCTGATGATTGTTTGAATATTCACCAAGAAGGAGAGGTCC
CATTGAAAGGAGTGGATACAAAATCACTAACAGTGCTGGTCAATTATGCA
TACACCGGAGTAATCTTCATCGACGAAGTCAACGTACAAACTATTTTGGA
AACTGCCGATCTTCTACAATTTCAAACAGCAAAATCATTATGTTGTGACT
TCATTAAGGAACAATTGAGTACTGAAAACTGTCTGGATATCTTCCAGTTT
GCAGATGTATTCCATTGTGATGACGTTTTGTCTTTATCTCAAGATGACAG
AAAGGTTATCTTCTCCAAAAGCAAGAGAGATTCAAAATATAAACATACAT
ACAAAGACTTTATCATCAAATCTTTTCAAATTACGTGAAAATGACTCATT
GTGTGACGTGACCCTCATTTCTGATGGAATTGAAATCAGAGCGCACCGTG
TGGTGCTGGCAGCATGTAGTGAATACTTTCATGCTATGTTTACAAGTGGA
ATGAGCGAAACTGGCAAAGACGAGGTAACTGACCAATGGACGTCACTAGC
ATACACTAACGTGCCTCGATTCGGAAGCGTGGCTGTTGTTCTTCCATTCT
GTAAACAAGGTTCTGGACCCTCGCCTCCACCGGCCTCAAAAAGCCAGGAC
AATGAAGAGGAATGAGTTACATCTACGTGGCGGGTGGTGTCAACTCTTAC
ACCGGTTCCATCAACACAGTGGAAAGATACGACCCGTCTTCAGATCAATG
GACGTTGTGCCATCCTTTGTCGCAAGCCAGGGGTGGTCACTCCATGGTCA
GTTATTTCGGACGGCTAATAGTCATTGGTGGAATGAACAGTTACATGCAA
ACGTGCCGCGATGCTGAGTGGTATAATGAGATACGTCGAACGATATGATG
AGAGTAATAACCAATGGACACCAGTAGCCTGTATGAAGTCTAGACGACGA
AGGTTTGGCCTCTGCCAGTTCAAAGGCAAACTCTACGCTTTCGGTGGATT
CCAAGATAGCCTTGGTGACTTGAAAGCGTGTGAAGTTTATGATCCAGAGG
CTAATATATGGGAGAGTATTGCGTCTATGAAAACGAATCGTTGTGATCTT
GGAGTAGCTGTTTTGTCAGGTGACGTGAAAGCGGCAGTAATAGATGACGT
TGTTTATGTAGCTGGTGGATCTAGTGGCGGCGAACCCGCCTGCAAGTATG
TTATCGGTGGCATGTGTCTGGGTGAGAAATTAAGAAGCGTCGAAAGATAT
TTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGCCTCGTTGAAAAATTGTAA
AGGTGGTTACTCTACATTCAGAAGATTGCAGCATCACACCTTCCCTTAGT
ATGAGACATTCCTATGCATCATGGCTGTATGTGCTGGGTGGTGAACAATC
ATTCTTAATGGGAATGAAATCTACAGAAATTTTCGAAATGAATACATCGA
CGTGGAGTTACGGTTTCTCATTGAACAGACCAAGGACTTCTTTTGCTGCT
GTAGCACATGGTGATAAATTGTCATTACTATGATTTCAAAATGGATTGAA
GCTGACGAGATAAACCGCAAAGAGAAATTATTTTCACTTTTCCAATACGT
CAGATGGCCATACGTTGATCCAATCAAACTGCAAGAAATCAAGAACCAAC
GCTTAATTGTTAACAATCGACTCTCACTACCAGAGATTGATAATGTGTTC
TCTGCAACTGAAGATTACAGCGATGTTGACAAGGTCTTTTTAACAAGAAC
TGGAAGAAGATTGTGGAATCTGAGAGTTTCTCTTCCATCAATTATCACAC
TTTTGTTAAACTGATATCTGATGATTGTTTGAATATTCACCAAGAAGGAG
AGGTCCCATTGAAAGGAGTGGATACAAAATCACTAACAGTGCTGGTCAAT
TATGCATACACCGGAGTAATCTTCATCGACGAAGTCAACGTACAAACTAT
TTTGGAAACTGCCGATCTTCTACAATTTCAAACAGCAAAATCATTATGTT
GTGACTTCATTAAGGAACAATTGAGTACTGAAAACTGTCTGGATATCTTC
CAGTTTGCAGATGTATTCCATTGTGATGACGTTTTGTCTTTATCTCAAGA
TGACAGAAAGGTTATCTTCTCCAAAAGCAAGAGAGATTCAAAATATAAAC
ATACATACAAAGACTTTATCATCAAATCTTTTCAAATTACGTGAAAATGA
CTCATTGTGTGACGTGACCCTCATTTCTGATGGAATTGAAATCAGAGCGC
ACCGTGTGGTGCTGGCAGCATGTAGTGAATACTTTCATGCTATGTTTACA
AGTGGAATGAGCGAAACTGGCAAAGACGAGGTAACTGACCAATGGACGTC
ACTAGCATACACTAACGTGCCTCGATTCGGAAGCGTGGCTGTTGTTCTTC
CATTCTGTAAACAAGGTTCTGGACCCTCGCCTCCACCGGCCTCAAAAAGC
CAGGACAATGAAGAGGAATGAGTTACATCTACGTGGCGGGTGGTGTCAAC
TCTTACACCGGTTCCATCAACACAGTGGAAAGATACGACCCGTCTTCAGA
TCAATGGACGTTGTGCCATCCTTTGTCGCAAGCCAGGGGTGGTCACTCCA
TGGTCAGTTATTTCGGACGGCTAATAGTCATTGGTGGAATGAACAGTTAC
ATGCAAACGTGCCGCGATGCTGAGTGGTATAATGAGATACGTCGAACGAT
ATGATGAGAGTAATAACCAATGGACACCAGTAGCCTGTATGAAGTCTAGA
CGACGAAGGTTTGGCCTCTGCCAGTTCAAAGGCAAACTCTACGCTTTCGG
TGGATTCCAAGATAGCCTTGGTGACTTGAAAGCGTGTGAAGTTTATGATC
CAGAGGCTAATATATGGGAGAGTATTGCGTCTATGAAAACGAATCGTTGT
GATCTTGGAGTAGCTGTTTTGTCAGGTGACGTGAAAGCGGCAGTAATAGA
TGACGTTGTTTATGTAGCTGGTGGATCTAGTGGCGGCGAACCCGCCTGCA
AGTATGTTATCGGTGGCATGTGTCTGGGTGAGAAATTAAGAAGCGTCGAA
AGATATTTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGCCTCGTTGAAAAA
TTGTAAAGGTGGTTACTCTACATTCAGAAGATTGCAGCATCACACCTTCC
CTTAGTATGAGACATTCCTATGCATCATGGCTGTATGTGCTGGGTGGTGA
ACAATCATTCTTAATGGGAATGAAATCTACAGAAATTTTCGAAATGAATA
CATCGACGTGGAGTTACGGTTTCTCATTGAACAGACCAAGGACTTCTTTT
GCTGCTGTAGCACATGGTGATAAATTGTCATTACTATGATTTCAAAATGG
ATTGAAGCTGACGAGATAAACCGCAAAGAGAAATTATTTTCACTTTTCCA
ATACGTCAGATGGCCATACGTTGATCCAATCAAACTGCAAGAAATCAAGA
ACCAACGCTTAATTGTTAACAATCGACTCTCACTACCAGAGATTGATAAT
GTGTTCTCTGCAACTGAAGATTACAGCGATGTTGACAAGGTCTTTTTAAC
AAGAACTGGAAGAAGATTGTGGAATCTGAGAGTTTCTCTTCCATCAATTA
TCACACTTTTGTTAAACTGATATCTGATGATTGTTTGAATATTCACCAAG
AAGGAGAGGTCCCATTGAAAGGAGTGGATACAAAATCACTAACAGTGCTG
GTCAATTATGCATACACCGGAGTAATCTTCATCGACGAAGTCAACGTACA
AACTATTTTGGAAACTGCCGATCTTCTACAATTTCAAACAGCAAAATCAT
TATGTTGTGACTTCATTAAGGAACAATTGAGTACTGAAAACTGTCTGGAT
ATCTTCCAGTTTGCAGATGTATTCCATTGTGATGACGTTTTGTCTTTATC
TCAAGATGACAGAAAGGTTATCTTCTCCAAAAGCAAGAGAGATTCAAAAT
ATAAACATACATACAAAGACTTTATCATCAAATCTTTTCAAATTACGTGA
AAATGACTCATTGTGTGACGTGACCCTCATTTCTGATGGAATTGAAATCA
GAGCGCACCGTGTGGTGCTGGCAGCATGTAGTGAATACTTTCATGCTATG
TTTACAAGTGGAATGAGCGAAACTGGCAAAGACGAGGTAACTGACCAATG
GACGTCACTAGCATACACTAACGTGCCTCGATTCGGAAGCGTGGCTGTTG
TTCTTCCATTCTGTAAACAAGGTTCTGGACCCTCGCCTCCACCGGCCTCA
AAAAGCCAGGACAATGAAGAGGAATGAGTTACATCTACGTGGCGGGTGGT
GTCAACTCTTACACCGGTTCCATCAACACAGTGGAAAGATACGACCCGTC
TTCAGATCAATGGACGTTGTGCCATCCTTTGTCGCAAGCCAGGGGTGGTC
ACTCCATGGTCAGTTATTTCGGACGGCTAATAGTCATTGGTGGAATGAAC
AGTTACATGCAAACGTGCCGCGATGCTGAGTGGTATAATGAGATACGTCG
AACGATATGATGAGAGTAATAACCAATGGACACCAGTAGCCTGTATGAAG
TCTAGACGACGAAGGTTTGGCCTCTGCCAGTTCAAAGGCAAACTCTACGC
TTTCGGTGGATTCCAAGATAGCCTTGGTGACTTGAAAGCGTGTGAAGTTT
ATGATCCAGAGGCTAATATATGGGAGAGTATTGCGTCTATGAAAACGAAT
CGTTGTGATCTTGGAGTAGCTGTTTTGTCAGGTGACGTGAAAGCGGCAGT
AATAGATGACGTTGTTTATGTAGCTGGTGGATCTAGTGGCGGCGAACCCG
CCTGCAAGTATGTTATCGGTGGCATGTGTCTGGGTGAGAAATTAAGAAGC
GTCGAAAGATATTTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGCCTCGTT
GAAAAATTGTAAAGGTGGTTACTCTACATTCAGAAGATTGCAGCATCACA
CCTTCCCTTAGTATGAGACATTCCTATGCATCATGGCTGTATGTGCTGGG
TGGTGAACAATCATTCTTAATGGGAATGAAATCTACAGAAATTTTCGAAA
TGAATACATCGACGTGGAGTTACGGTTTCTCATTGAACAGACCAAGGACT
TCTTTTGCTGCTGTAGCACATGGTGATAAATTGTCATTACTATGATTTCA
AAATGGATTGAAGCTGACGAGATAAACCGCAAAGAGAAATTATTTTCACT
TTTCCAATACGTCAGATGGCCATACGTTGATCCAATCAAACTGCAAGAAA
TCAAGAACCAACGCTTAATTGTTAACAATCGACTCTCACTACCAGAGATT
GATAATGTGTTCTCTGCAACTGAAGATTACAGCGATGTTGACAAGGTCTT
TTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAGAGTTTCTCTTCCAT
CAATTATCACACTTTTGTTAAACTGATATCTGATGATTGTTTGAATATTC
ACCAAGAAGGAGAGGTCCCATTGAAAGGAGTGGATACAAAATCACTAACA
GTGCTGGTCAATTATGCATACACCGGAGTAATCTTCATCGACGAAGTCAA
CGTACAAACTATTTTGGAAACTGCCGATCTTCTACAATTTCAAACAGCAA
AATCATTATGTTGTGACTTCATTAAGGAACAATTGAGTACTGAAAACTGT
CTGGATATCTTCCAGTTTGCAGATGTATTCCATTGTGATGACGTTTTGTC
TTTATCTCAAGATGACAGAAAGGTTATCTTCTCCAAAAGCAAGAGAGATT
CAAAATATAAACATACATACAAAGACTTTATCATCAAATCTTTTCAAATT
ACGTGAAAATGACTCATTGTGTGACGTGACCCTCATTTCTGATGGAATTG
AAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTAGTGAATACTTTCAT
GCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAAGACGAGGTAACTGA
CCAATGGACGTCACTAGCATACACTAACGTGCCTCGATTCGGAAGCGTGG
CTGTTGTTCTTCCATTCTGTAAACAAGGTTCTGGACCCTCGCCTCCACCG
GCCTCAAAAAGCCAGGACAATGAAGAGGAATGAGTTACATCTACGTGGCG
GGTGGTGTCAACTCTTACACCGGTTCCATCAACACAGTGGAAAGATACGA
CCCGTCTTCAGATCAATGGACGTTGTGCCATCCTTTGTCGCAAGCCAGGG
GTGGTCACTCCATGGTCAGTTATTTCGGACGGCTAATAGTCATTGGTGGA
ATGAACAGTTACATGCAAACGTGCCGCGATGCTGAGTGGTATAATGAGAT
ACGTCGAACGATATGATGAGAGTAATAACCAATGGACACCAGTAGCCTGT
ATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAGTTCAAAGGCAAACT
CTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGACTTGAAAGCGTGTG
AAGTTTATGATCCAGAGGCTAATATATGGGAGAGTATTGCGTCTATGAAA
ACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCAGGTGACGTGAAAGC
GGCAGTAATAGATGACGTTGTTTATGTAGCTGGTGGATCTAGTGGCGGCG
AACCCGCCTGCAAGTATGTTATCGGTGGCATGTGTCTGGGTGAGAAATTA
AGAAGCGTCGAAAGATATTTAGAAAAAGAAGGCCGTTGGAAGCGTTTGGC
CTCGTTGAAAAATTGTAAAGGTGGTTACTCTACATTCAGAAGATTGCAGC
ATCACACCTTCCCTTAGTATGAGACATTCCTATGCATCATGGCTGTATGT
GCTGGGTGGTGAACAATCATTCTTAATGGGAATGAAATCTACAGAAATTT
TCGAAATGAATACATCGACGTGGAGTTACGGTTTCTCATTGAACAGACCA
AGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAATTGTCATTACTATG
ATTTCAAAATGGATTGAAGCTGACGAGATAAACCGCAAAGAGAAATTATT
TTCACTTTTCCAATACGTCAGATGGCCATACGTTGATCCAATCAAACTGC
AAGAAATCAAGAACCAACGCTTAATTGTTAACAATCGACTCTCACTACCA
GAGATTGATAATGTGTTCTCTGCAACTGAAGATTACAGCGATGTTGACAA
GGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAGAGTTTCTC
TTCCATCAATTATCACACTTTTGTTAAACTGATATCTGATGATTGTTTGA
ATATTCACCAAGAAGGAGAGGTCCCATTGAAAGGAGTGGATACAAAATCA
CTAACAGTGCTGGTCAATTATGCATACACCGGAGTAATCTTCATCGACGA
AGTCAACGTACAAACTATTTTGGAAACTGCCGATCTTCTACAATTTCAAA
CAGCAAAATCATTATGTTGTGACTTCATTAAGGAACAATTGAGTACTGAA
AACTGTCTGGATATCTTCCAGTTTGCAGATGTATTCCATTGTGATGACGT
TTTGTCTTTATCTCAAGATGACAGAAAGGTTATCTTCTCCAAAAGCAAGA
GAGATTCAAAATATAAACATACATACAAAGACTTTATCATCAAATCTTTT
CAAATTACGTGAAAATGACTCATTGTGTGACGTGACCCTCATTTCTGATG
GAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTAGTGAATAC
TTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAAGACGAGGT
AACTGACCAATGGACGTCACTAGCATACACTAACGTGCCTCGATTCGGAA
GCGTGGCTGTTGTTCTTCCATTCTGTAAACAAGGTTCTGGACCCTCGCCT
CCACCGGCCTCAAAAAGCCAGGACAATGAAGAGGAATGAGTTACATCTAC
GTGGCGGGTGGTGTCAACTCTTACACCGGTTCCATCAACACAGTGGAAAG
ATACGACCCGTCTTCAGATCAATGGACGTTGTGCCATCCTTTGTCGCAAG
CCAGGGGTGGTCACTCCATGGTCAGTTATTTCGGACGGCTAATAGTCATT
GGTGGAATGAACAGTTACATGCAAACGTGCCGCGATGCTGAGTGGTATAA
TGAGATACGTCGAACGATATGATGAGAGTAATAACCAATGGACACCAGTA
GCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAGTTCAAAGG
CAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGACTTGAAAG
CGTGTGAAGTTTATGATCCAGAGGCTAATATATGGGAGAGTATTGCGTCT
ATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCAGGTGACGT
GAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGCTGGTGGATCTAGTG
GCGGCGAACCCGCCTGCAAGTATGTTATCGGTGGCATGTGTCTGGGTGAG
AAATTAAGAAGCGTCGAAAGATATTTAGAAAAAGAAGGCCGTTGGAAGCG
TTTGGCCTCGTTGAAAAATTGTAAAGGTGGTTACTCTACATTCAGAAGAT
TGCAGCATCACACCTTCCCTTAGTATGAGACATTCCTATGCATCATGGCT
GTATGTGCTGGGTGGTGAACAATCATTCTTAATGGGAATGAAATCTACAG
AAATTTTCGAAATGAATACATCGACGTGGAGTTACGGTTTCTCATTGAAC
AGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAATTGTCATT
ACTATGATTTCAAAATGGATTGAAGCTGACGAGATAAACCGCAAAGAGAA
ATTATTTTCACTTTTCCAATACGTCAGATGGCCATACGTTGATCCAATCA
AACTGCAAGAAATCAAGAACCAACGCTTAATTGTTAACAATCGACTCTCA
CTACCAGAGATTGATAATGTGTTCTCTGCAACTGAAGATTACAGCGATGT
TGACAAGGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATCTGAGAG
TTTCTCTTCCATCAATTATCACACTTTTGTTAAACTGATATCTGATGATT
GTTTGAATATTCACCAAGAAGGAGAGGTCCCATTGAAAGGAGTGGATACA
AAATCACTAACAGTGCTGGTCAATTATGCATACACCGGAGTAATCTTCAT
CGACGAAGTCAACGTACAAACTATTTTGGAAACTGCCGATCTTCTACAAT
TTCAAACAGCAAAATCATTATGTTGTGACTTCATTAAGGAACAATTGAGT
ACTGAAAACTGTCTGGATATCTTCCAGTTTGCAGATGTATTCCATTGTGA
TGACGTTTTGTCTTTATCTCAAGATGACAGAAAGGTTATCTTCTCCAAAA
GCAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTATCATCAAA
TCTTTTCAAATTACGTGAAAATGACTCATTGTGTGACGTGACCCTCATTT
CTGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCATGTAGT
GAATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGGCAAAGA
CGAGGTAACTGACCAATGGACGTCACTAGCATACACTAACGTGCCTCGAT
TCGGAAGCGTGGCTGTTGTTCTTCCATTCTGTAAACAAGGTTCTGGACCC
TCGCCTCCACCGGCCTCAAAAAGCCAGGACAATGAAGAGGAATGAGTTAC
ATCTACGTGGCGGGTGGTGTCAACTCTTACACCGGTTCCATCAACACAGT
GGAAAGATACGACCCGTCTTCAGATCAATGGACGTTGTGCCATCCTTTGT
CGCAAGCCAGGGGTGGTCACTCCATGGTCAGTTATTTCGGACGGCTAATA
GTCATTGGTGGAATGAACAGTTACATGCAAACGTGCCGCGATGCTGAGTG
GTATAATGAGATACGTCGAACGATATGATGAGAGTAATAACCAATGGACA
CCAGTAGCCTGTATGAAGTCTAGACGACGAAGGTTTGGCCTCTGCCAGTT
CAAAGGCAAACTCTACGCTTTCGGTGGATTCCAAGATAGCCTTGGTGACT
TGAAAGCGTGTGAAGTTTATGATCCAGAGGCTAATATATGGGAGAGTATT
GCGTCTATGAAAACGAATCGTTGTGATCTTGGAGTAGCTGTTTTGTCAGG
TGACGTGAAAGCGGCAGTAATAGATGACGTTGTTTATGTAGCTGGTGGAT
CTAGTGGCGGCGAACCCGCCTGCAAGTATGTTATCGGTGGCATGTGTCTG
GGTGAGAAATTAAGAAGCGTCGAAAGATATTTAGAAAAAGAAGGCCGTTG
GAAGCGTTTGGCCTCGTTGAAAAATTGTAAAGGTGGTTACTCTACATTCA
GAAGATTGCAGCATCACACCTTCCCTTAGTATGAGACATTCCTATGCATC
ATGGCTGTATGTGCTGGGTGGTGAACAATCATTCTTAATGGGAATGAAAT
CTACAGAAATTTTCGAAATGAATACATCGACGTGGAGTTACGGTTTCTCA
TTGAACAGACCAAGGACTTCTTTTGCTGCTGTAGCACATGGTGATAAATT
GTCATTACTATGATTTCAAAATGGATTGAAGCTGACGAGATAAACCGCAA
AGAGAAATTATTTTCACTTTTCCAATACGTCAGATGGCCATACGTTGATC
CAATCAAACTGCAAGAAATCAAGAACCAACGCTTAATTGTTAACAATCGA
CTCTCACTACCAGAGATTGATAATGTGTTCTCTGCAACTGAAGATTACAG
CGATGTTGACAAGGTCTTTTTAACAAGAACTGGAAGAAGATTGTGGAATC
TGAGAGTTTCTCTTCCATCAATTATCACACTTTTGTTAAACTGATATCTG
ATGATTGTTTGAATATTCACCAAGAAGGAGAGGTCCCATTGAAAGGAGTG
GATACAAAATCACTAACAGTGCTGGTCAATTATGCATACACCGGAGTAAT
CTTCATCGACGAAGTCAACGTACAAACTATTTTGGAAACTGCCGATCTTC
TACAATTTCAAACAGCAAAATCATTATGTTGTGACTTCATTAAGGAACAA
TTGAGTACTGAAAACTGTCTGGATATCTTCCAGTTTGCAGATGTATTCCA
TTGTGATGACGTTTTGTCTTTATCTCAAGATGACAGAAAGGTTATCTTCT
CCAAAAGCAAGAGAGATTCAAAATATAAACATACATACAAAGACTTTATC
ATCAAATCTTTTCAAATTACGTGAAAATGACTCATTGTGTGACGTGACCC
TCATTTCTGATGGAATTGAAATCAGAGCGCACCGTGTGGTGCTGGCAGCA
TGTAGTGAATACTTTCATGCTATGTTTACAAGTGGAATGAGCGAAACTGG
CAAAGACGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000140XLOC_000140Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000259-proteinTCONS_00000259-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000259-exon-sc0000001-1575043694:2466690..2467092TCONS_00000259-exon-sc0000001-1575043694:2466690..2467092Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2466049..2466295TCONS_00000259-exon-sc0000001-1575043694:2466049..2466295Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2465873..2465991TCONS_00000259-exon-sc0000001-1575043694:2465873..2465991Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2465100..2465312TCONS_00000259-exon-sc0000001-1575043694:2465100..2465312Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2464257..2464474TCONS_00000259-exon-sc0000001-1575043694:2464257..2464474Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2463678..2463784TCONS_00000259-exon-sc0000001-1575043694:2463678..2463784Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2463014..2463089TCONS_00000259-exon-sc0000001-1575043694:2463014..2463089Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2459994..2460232TCONS_00000259-exon-sc0000001-1575043694:2459994..2460232Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2459022..2459236TCONS_00000259-exon-sc0000001-1575043694:2459022..2459236Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1575043694:2456748..2458768TCONS_00000259-exon-sc0000001-1575043694:2456748..2458768Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2466690..2467092TCONS_00000259-exon-sc0000001-1510915933:2466690..2467092Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2466049..2466295TCONS_00000259-exon-sc0000001-1510915933:2466049..2466295Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2465873..2465991TCONS_00000259-exon-sc0000001-1510915933:2465873..2465991Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2465100..2465312TCONS_00000259-exon-sc0000001-1510915933:2465100..2465312Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2464257..2464474TCONS_00000259-exon-sc0000001-1510915933:2464257..2464474Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2463678..2463784TCONS_00000259-exon-sc0000001-1510915933:2463678..2463784Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2463014..2463089TCONS_00000259-exon-sc0000001-1510915933:2463014..2463089Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2459994..2460232TCONS_00000259-exon-sc0000001-1510915933:2459994..2460232Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2459022..2459236TCONS_00000259-exon-sc0000001-1510915933:2459022..2459236Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1510915933:2456748..2458768TCONS_00000259-exon-sc0000001-1510915933:2456748..2458768Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2466690..2467092TCONS_00000259-exon-sc0000001-1491911889:2466690..2467092Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2466049..2466295TCONS_00000259-exon-sc0000001-1491911889:2466049..2466295Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2465873..2465991TCONS_00000259-exon-sc0000001-1491911889:2465873..2465991Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2465100..2465312TCONS_00000259-exon-sc0000001-1491911889:2465100..2465312Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2464257..2464474TCONS_00000259-exon-sc0000001-1491911889:2464257..2464474Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2463678..2463784TCONS_00000259-exon-sc0000001-1491911889:2463678..2463784Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2463014..2463089TCONS_00000259-exon-sc0000001-1491911889:2463014..2463089Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2459994..2460232TCONS_00000259-exon-sc0000001-1491911889:2459994..2460232Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2459022..2459236TCONS_00000259-exon-sc0000001-1491911889:2459022..2459236Clytia hemisphaericaexon
TCONS_00000259-exon-sc0000001-1491911889:2456748..2458768TCONS_00000259-exon-sc0000001-1491911889:2456748..2458768Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2456748..2467092 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.302354 0.24845 0 0.31191 0.657069 0.395115 0.40969 0.581256 0.635058 0.732015 0.752799 0.391979 0.730948 0.313825 0.455939 0.411106 0.5099 0.827401 0.767141 1.36411 1.31647 0.203807 0.446037 0.725705 0 0.102415 1.04856 1.5887 1.01871 0.674465
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006652Kelch_1
IPR000210BTB/POZ_dom
IPR011705BACK
IPR015915Kelch-typ_b-propeller
IPR017096BTB-kelch_protein
IPR015916Gal_Oxidase_b-propeller
IPR011333SKP1/BTB/POZ
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000259 vs. Swiss-Prot (Human)
Match: KLH20 (Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4)

HSP 1 Score: 289.271 bits (739), Expect = 3.080e-84
Identity = 178/551 (32.30%), Postives = 275/551 (49.91%), Query Frame = 2
Query:  260 LRENDSLCDVTLISDGIEIRAHRVVLAACSEYFHAMFTSGMSETGKDEVPLKGVDTKSLTVLVNYAYTGVIFIDEVNVQTILETADLLQFQTAKSLCCDFIKEQLSTENCLDIFQFADVFHCDDVLSLSQGLFNKNWKKIVESESFSSINYHTFVKLISDDCLNIHQEGEVITMISKWIEADEINRKEKLFSLFQYVRWPYVDPIKLQEIKNQRLIVNNRLSLPEIDNVFSATEDYSD-VDKVVTLHSEDCSITPSLSMRHSYASWLYVLGGEQSFLMGMKSTEIFEMNTSTWSYGFSLNRPRTSFAAVAHGDKLYVIGGMCLGEKLRSVERYLEKEGRWKRLASLKNCKGDVKAAVIDDVVYVAGGSSGGEPACKYVERYDESNNQWTP-VACMKSRRRRFGLCQFKGKLYAFGGFQDSLGDLKACEVYDPEANIWESIASMKTNRCDLGVAVLSGYIYVAGGVNSYTGSINTVERYDPSSDQWTLCHPLSQARGGHSMVSYFGRLIVIGGMNSYMQTCRDAEWYNEVTDQWTSLAYTNVPRFG-SVAVV 1903
            LR++  LCDV L+    +I AHRV+L+ACS YF AMFT  ++E+ + EV ++ +D +++ +L+++AYT  I ++E NVQT+L  A LLQ    +  CC+F+K QL   NCL I  FAD   C ++L ++      N+++++ESE F  +  +  + +IS D LN+  E +V   +  W++     R+ +L  + Q+VR P + P         + +V    S    D +  + E+  D VD+                     A    +L  E+  + G ++                  RPR        G+ L+ +GG C G+ + SVERY  +   W+ +AS+   +  V  +V+DD++Y  GG  G       VERYD   NQW+  VA   + R   G+    G LYA GG QD +  L   E YDP+ N W  +ASM T R  + VAVL G++Y  GG +  T  +NTVERY+P  ++W    P+   R       Y   +  +GG +   +    AE YN  T+QW+ +      R G  +AVV
Sbjct:   61 LRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSP---------KFLVGTVGS----DPLIKSDEECRDLVDE---------------------AKNYLLLPQERPLMQGPRT------------------RPRKPIRC---GEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSS-YLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGG-QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDG-TSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELS-SAERYNPRTNQWSPVVAMTSRRSGVGLAVV 552          

HSP 2 Score: 107.842 bits (268), Expect = 8.015e-24
Identity = 65/191 (34.03%), Postives = 90/191 (47.12%), Query Frame = 2
Query: 1046 ASWLYVLGGEQSFLMGMKSTEIFEMNTSTWSYGFSLNRPRTSFAAVAHGDKLYVIGGMCLGEKLRSVERYLEKEGRWKRLASLKNCKGDVKAAVIDDVVYVAGGSSGGEPACKYVERYDESNNQWTPVACMKSRRRRFGLCQFKGKLYAFGGFQDSLGDLKACEVYDPEANIWESIASMKTNRCDLGVAVL 1618
              +LY +GG Q  +  +   E ++   + W+   S++  R   A    G  LY +GG      L +VERY  +E RW  +A +   +  +  AV  D++Y  GG           ERY+   NQW+PV  M SRR   GL    G+L A GGF D    LK  EV+DP+AN W     M   R   GV V+
Sbjct:  412 GGFLYAVGG-QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTT-ELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGF-DGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVI 599          
The following BLAST results are available for this feature:
BLAST of TCONS_00000259 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KLH203.080e-8432.30Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE... [more]
back to top