Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000255 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000255
Unique NameTCONS_00000255
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3219

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000255 ID=TCONS_00000255|Name=TCONS_00000255|organism=Clytia hemisphaerica|type=transcript|length=3219bp
caGAAAATAGAAAACTGATGTTTATATAAAATGGTTGTGATGGCGGTGAA
CAATCGGTATTGTAGTGACTGTTTAGAATCAGGGGAATTTCTACCCCTGA
GACTTGTCATGATGAATTTGGATAGCGGTCTTTGGATGTGTCCCAAAGAT
GATtgtACATTTCCCTTATCTTCTCCATCCATGCAGTTATACATGGAAGA
AGATTTGACCACTGAACGTGTTTTGCTGTTGACAGGAAACAAAAGTAAAC
AATTAGAGagaCCACCAACTCCAGACTCACTAGTAGCAAGTATTTCATCA
AACAAACAAAGTGACATGTTACAACAAACACAATATGCAGTAAGTACTAC
TTCATCAAGTGGAAGTCGAAAACGTAAACATTCAGATGGTGGCTCATCAA
GCAGATCAACCAAAACAAATAGTTTTCGCAGTGTCAGCAATTCAAACATT
ACAGATCCAATATCGTCAGATTCTTCGAGCTTGATGGCTAACAAAAAGTA
TCCTTCAGTACCTCTATGGGAAAATGAAGAACTGCTGTGCTGGCTGGATT
CAATGCTTGCACTCATAGTCTTGAACCAAACTTTACAGAATTATCCTGAA
GAGTCCAAAGGTACCCTAAATAAATTACTCAGCGAATACAAACATAATAC
TGATATTTACAATGTGACAAAAGACTATGAAACAATAAGAGCAAGCATGC
ACACTTTACGGAAATCGACACTCAACTTCATTCAACCAAAGATGTTATCC
AGCTTCACCGAGGAGGATTCTCCTCTCTTGTCTCTACAGCTTTTAATGAA
AACCAATGCTGAGCTTTATGAAGATTGCGAAGTGGAATACTCGAGTAAAT
TCACTTGTAACCAATGTCAATTCGAAAAAACTGATGGGTTCAAGAAAACC
ATACTGACTCTCCCAGAAGGATATCCAGATTTGAATTTCGTAGAGAATTT
ATACTACAAAAGGAATTGTTACAAATGCAATGCACCAGAGCAAAAGAACG
TTTTCTATATTGAGAAataTCCAGCTGCGTTGTTTGTGTACTGCAGTACA
GGGGTAGGTTGTCGAAAATACTGGAATTGGTTCAACTTCACATCGCCGGC
TGGAGACAATTATATTGTGACGCAAATTGTCCAATACTCTAGAAAGAAGC
ACCACTTCATTTTGTGGAGTTACTCTTACAAAGATAAATTATGGATAGAA
GCTGATGATTTAAAACACCCAGTGGTCCAGTATCAACATGAACGACCCAC
ATGTCGGTCTCATGAGGTCCACTTCATGGTCCTGGAGAAAGTTTCAACAC
TTGAGGAAGcgataaagaaaaatgaacagAAAAATCTTAGCTCCGAGCAA
ACTGGATCCGAAAGCGCACCCGTGACCCCTGAATCCCTGGAATCACCGCT
TTGCTCTGGTAATAGTAGTGTTATTGTACAATACTCTGGGCAATCGAGTC
GCAAAACCTCGCTTTGTAGCAGTGATGGTATTTTACCGAACGGAAGATTA
TTGAATGATAGCGACCGCCCAAGCGAAGGGCGTAAGGATAATCGCGATCT
TCCAGATGATCAACTTCGAAAGAAATCCTTGTTGCACGTACCTTATTACA
AGCCGTTTACAGCACGTTCAAAGCGTACAGCTAGAGAAAGTCCTACAAAT
TACAACCAGAATGCAACATCTTCTCATCTTAAATCTGAAAGCAGTAGCAT
GTCGCACAGTACACCAGCAAAACAGACTGTTCTAAACAACCCTGACATTT
TACAACAAACCACTAAAACATCAGACATAAAGGCGGATCCTACGAACGCG
ATTTTCAGTCAAGCTTTAGCTAACGAACTCGGTGATTTTTATTCGGATCT
TTTAGACCAACAATCTATGGACACTACCCAAGAAGATGGCATGTTTGATT
CGACACAAATTTCCCAGGGAACTATTCCTAACCAAATGTCGTCTGATCAA
TTCAGCTCTACCACCCAAAACCAACAGCAAGACTCTACAATCGACGTTCA
ACAAACTCTAGAACGTCGATTTAGTAACGATGTTGATTCGTTGAGTGATA
TAGTTGATATAGGTACTGCAATCGCCGGAGGTTCTTTTTCAAGTACCGTA
TCTAACGATAAAACTGGATTTAAAGATTATGGAAACCCTTTGAAAAGACT
TATGGAGGAAGAGGAAGATATCAAAGGAGTTTTCCAAGCTTCTTCTGTCA
ATTTACAGATGTTTAATAAGACTGAAACGAATGATACCTCTTCAAGTGGG
TCGCATGTAACACCAATGGATATAAATACTGATTTTGGTGAAATTAAGTC
ACCAACCGAGGACGAACCCAAGGTCGATTTTGCAATCACCATGTCGACGA
ACAGTTATTCTGGAGCGTATTCGGACGTCAAACTGTCTGACGAGGAATTA
GAAGAAATTTTAAACGGGTGATGAGTTAAGAATTGAATCGAATATCTACC
GGTAACACAGTTATGTGTGTATGTCACGTGTATAATAAATCGCATAAACT
GGTCGCTCTTTGTTTGAACGGGAACTGGAAGAGATTAATTCTGATTTCGA
CTCAGAAATTTACTGTAGAGAGTCTCAAAACAGAATGAGAATCAATATGA
CATAAATAGTAGAGGTAAAGGTATAGCGttctacagtatgtggcccccaa
aacgtcaatcaaatttgaaatgtctctcaaatctagaggaaaaaaggttt
tacaaaaatttttgctgcatgaaaagctttaacatctctactttatttcc
tggaagttctttttcaaaattttcaatttcaacaatatttttaaatcgct
taaagatagcttttttctaatggccccaaaaacggaggtttgcaatttta
gcgacttctcgagatatctttaagatatgaatacaaaattttgaccatag
ttttgaaatgtgatttagagggttttgggcataaatttgtttgataaaat
ttttacagtatacccctggttgtcaaaacggtggtttggggcccccaaaa
cgtaggtgtagttaaaattaaattattaagcctagtggtaatagggggaa
ctatgaacatatttgtgttttcccttaaatttacgacccgatggatgtaa
aatttatgatttttataaagtatttcaagattttcgatgatgcaaagtcc
aaactgaaaatttagaaattttcaaaatgacaattttgatttacaacgtc
ttaatcaagtttctgaaaa
Run BLAST on NCBI

protein sequence of TCONS_00000255-protein

>TCONS_00000255-protein ID=TCONS_00000255-protein|Name=TCONS_00000255-protein|organism=Clytia hemisphaerica|type=polypeptide|length=796bp
MVVMAVNNRYCSDCLESGEFLPLRLVMMNLDSGLWMCPKDDCTFPLSSPS
MQLYMEEDLTTERVLLLTGNKSKQLERPPTPDSLVASISSNKQSDMLQQT
QYAVSTTSSSGSRKRKHSDGGSSSRSTKTNSFRSVSNSNITDPISSDSSS
LMANKKYPSVPLWENEELLCWLDSMLALIVLNQTLQNYPEESKGTLNKLL
SEYKHNTDIYNVTKDYETIRASMHTLRKSTLNFIQPKMLSSFTEEDSPLL
SLQLLMKTNAELYEDCEVEYSSKFTCNQCQFEKTDGFKKTILTLPEGYPD
LNFVENLYYKRNCYKCNAPEQKNVFYIEKYPAALFVYCSTGVGCRKYWNW
FNFTSPAGDNYIVTQIVQYSRKKHHFILWSYSYKDKLWIEADDLKHPVVQ
YQHERPTCRSHEVHFMVLEKVSTLEEAIKKNEQKNLSSEQTGSESAPVTP
ESLESPLCSGNSSVIVQYSGQSSRKTSLCSSDGILPNGRLLNDSDRPSEG
RKDNRDLPDDQLRKKSLLHVPYYKPFTARSKRTARESPTNYNQNATSSHL
KSESSSMSHSTPAKQTVLNNPDILQQTTKTSDIKADPTNAIFSQALANEL
GDFYSDLLDQQSMDTTQEDGMFDSTQISQGTIPNQMSSDQFSSTTQNQQQ
DSTIDVQQTLERRFSNDVDSLSDIVDIGTAIAGGSFSSTVSNDKTGFKDY
GNPLKRLMEEEEDIKGVFQASSVNLQMFNKTETNDTSSSGSHVTPMDINT
DFGEIKSPTEDEPKVDFAITMSTNSYSGAYSDVKLSDEELEEILNG
Run BLAST on NCBI

transcript from alignment at sc0000001:2445250..2452430-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000255 ID=TCONS_00000255|Name=TCONS_00000255|organism=Clytia hemisphaerica|type=transcript|length=7181bp|location=Sequence derived from alignment at sc0000001:2445250..2452430- (Clytia hemisphaerica)
CAGAAAATAGAAAACTGATGTTTATATAAAATGGTTGTGATGGCGGTGAA CAATCGGTATTGTAGTGACTGTTTAGAATCAGGGGAATTTCTACCCCTGA GACTTGTCATGATGAATTTGGATAGCGGTCTTTGGATGTGTCCCAAAGAT GATGTAAGATTATATTAATTTTTCTCAATTCGGTATTGTAGTGACTGTTT AGAATCAGGGGAATTTTTACCCCTGAGACTTGTTATGATGAATTTGGATA GCAGTCTTTGGATGTGTCAGAAAGAGAATGTAAGATTATCTTAATTTTTC TCGATTCCTTAATTTAGGTGTTATGTCTATACCCTTTTCAGTTTGCATGA TGCACCAATAAAATAATTGATATAATCCTAGTATGTTGGTATACCTGCCA TTATTTTTGAGAGTGTGAATAATTTGTGAATTTTTTTTTTCATTTCAGTG TACATTTCCCTTATCTTCTCCATCCATGCAGTTATACATGGAAGAAGATT TGACCACTGAACGTGTTTTGCTGTTGACAGGAAACAAAAGTAAACAATTA GAGGTTAGTAGAATTTGATTGAAACAAAAGTCATTCAAAAACCAAAAAAA ACAAAGATAAAAGTAAAAAATTTGTAGTGTCATTATGTCGTATCAGACAT CACAACAATTCAAACACAGCTAAAATAGAACAAAAACGGAACAAAAACAA AGACTCAAAAAATCTGCCTTTCATTTAAGATTCTTTAAGAAATTAGTTTT AGTTTTTTGAGCGATGACTCTTTTGATCGTTTTGGTGTCCCAGACCTTAC ATTATCTTTTTTTATTTTCCAGAGACCACCAACTCCAGACTCACTAGTAG CAAGTATTTCATCAAACAAACAAAGTGACATGTTACAACAAACACAATAT GCAGTAAGTACTACTTCATCAAGTGGAAGTCGAAAACGTAAACATTCAGA TGGTGGCTCATCAAGCAGATCAACCAAAACAAATAGTTTTCGCAGTGTCA GCAATTCAAACATTACAGATCCAATATCGTCAGATTCTTCGAGCTTGATG GCTAACAAAAAGTATCCTTCAGTACCTCTATGGGAAAATGAAGAACTGCT GTGCTGGCTGGATTCAATGCTTGCACTCATAGTCTTGAACCAAACTTTAC AGAATTATCCTGAAGAGTCCAAAGGTACCCTAAATAAATTACTCAGCGAA TACAAACATAATACTGATATTTACAATGTGACAAAAGACTATGAAACAAT AAGAGCAAGCATGCACACTTTACGGAAATCGACACTCAACTTCATTCAAC CAAAGATGTTATCCAGCTTCACCGAGGAGGATTCTCCTCTCTTGTCTCTA CAGCTTTTAATGAAAACCAATGCTGAGCTTTATGAAGATTGCGAAGTGGA ATACTCGAGTAAATTCACTTGTAACCAATGTCAATTCGAAAAAACTGATG GGTAAGAAATCATCCCTACGTCTTCTTATTTTTGCTAAAATCTTTTATTT GAGCACTGGTCGATTGTATAGGTTTAATCTGGGTATTGTGGTTTAAACAT AATTCGATGAATATTCAGTTTTGATGGTTATTATTTCTTTTTGATTTTTT ACTAGGTTCAAGAAAACCATACTGACTCTCCCAGAAGGATATCCAGATTT GAATTTCGTAGAGAATTTATACTACAAAAGGAATTGTTACAAATGCAATG CACCAGAGCAAAAGAACGTTTTCTATATTGAGAAGTAAGTACTTACTTTT CATCAAAGTTATTCACAAATCAAACCTCTAATAATAGCTAACGCGTATAC TCATGTGACAGACCAGGGCAGACAGTGAAATGTACAGGGTTCGAATTAAC GTATCGCGTTTCGCAATTCGTGATGCGTTTTTGTACGAAGCAAAAATTTA AAAACTCACCAAAATCGCAATACAACCTATATAAAAATTTTTACAGCTCA CTAAGTCAGTTTTATTAAATGAGCGTCCAAGCAAATAGAACTGTTATTTG GCTTATAAATTAGTTTGGAGAGTGGAAAATGCATTGTATATTTATAAAAA CGCATCGTGAACTATCTAAAATATTTCGCCCCTGCAGCGCACAGATTTAA CTTACTTTGTTCACTAAAAGGTGCCATTCACTTTTAAATCGTCAAATTCA ATCCCTGAATGTATATTTAGGACAAAATTACACCTTTCAATTTACCAGGA AAATCGAGCGTCCAAGATAACAAATTTTTTTTTTACATAATATTTGGTCA CTTCTCCATAAAATTATTCTCTTGCCAAAAATATTGTAATGTCAGTTGTT AACTTTTGGTTACTTACTCTGACTTTTTTCCCTGATTTGATGCTTTATCA TGACGTGCTAATAATCTCTAATCAAACCTCATTTAACCTTCTCTAAGGAA GGACATGGATAATGCAAAGTAATTCATTCATGTAATTCCTTTTCAAATTT TAGATATCCAGCTGCGTTGTTTGTGTACTGCAGTACAGGGGTAGGTTGTC GAAAATACTGGAATTGGTTCAACTTCACATCGCCGGCTGGAGACAATTAT ATTGTGACGCAAATTGTCCAATACTCTAGAAAGAAGCACCACTTCATTTT GTGGAGTTACTCTTACAAAGGTAGGTGTTTAAACTGTGTTTTAATTCAAT ATTCCCAGCATTCAAGATTACTGACAGTAATATTCAAGGCAAAATTGAGT AAAATTGCTTTGGTGCTTGGTGCATCTTCACCAATGCTCTTTAATATTCT GTCCGAAACCTTGAACTTGCTTGTTTTGTCCTGGTACTACCATTGCTTTT GAAAAAAACTTTCTTGTAGAAGTCAAGCTAAGCATAAGTGTGCAAAACCT GACTTCTTGAGAAAGGGGACTTCCAGTCTTTTAAAAATAGGATGCAAGCT GCTATTAAACCAGTTAGCTGTTTTTTTGCATCCTATGAAAACACAAAGAC AACATTCTACTGTCAAAACTAGAACAGTACTTTTTAAATGTGCTGATTCG AAGAAAACCCAGAGCTGAAAAAATTGTTTTCTTCTTGAAACAAATCTTCA CAGAAAAAAGTACTGTAAATATTTTTGAGAATAATTAACCTTCGGTTCCG AAATTTTCTGAGACTTTGTTTTCTGTATATATAGACTAGAGAAAATTTTC AAATTTCAAAAAATAGTTATCCCAACAGATTCAAAAACTTTAAAATAAAA AAGATTAGTATTGTGAAATCGATAACTTTAGTAAAATGTTGTAAAGGCGC GCGATATTGGGAAAAGTTTTCACCTTCTAAACGATTTGTTTATCGTTTCA AAAAACGGTTAGTATACTTAATTTTTACAAAATCGATTTTGCTTCGATCT TTTATCGAATATTTCTCGATTTTTCCTCGATTTTTCATTCGATACTTTTT ATTGAAATATAGTCAAGCCTTGAATATTTGGGATTTTGTTTTCACTTCGT TCTCTCAAGATGAACAGGTTAGCCATTCCATTCCATTATTGGCGAAGTTG AAATACAACATTCAAATTTTCTATATTTGGCTATATTTAGCTGTAAAGTT CAACTTGTACACTCTTTTAATCCTGACTCTTCCCTTTATCTTATAGGTTG ATGTTATAAACAAAGTTAACATAAAATATCTAGAAAGTTTTATGATAAAT ACTTTCTCCCCTTTTAAGACCCCATTACTTAACATGGGTTCTTAAAAGTG AAAGTGTTTTCAGGCTAAAGTCGTAAGTATAAAGGCCATGAATCTTTCCG GCGTGATATTTTTCTAGCTTTTCAGCTTTTAGACGATGATTCTTTTGCAG TATAACTTTTCATCGAATCTCCTTCATTTCGCCGTTTTTTGTTTCATTCT TCAATCAATGTTTCTACTTTATGCGTTCTCTCTTCTTACATCGCGAAAAG TCCTTTTCCAACTACCCATATCCTTTTCAAAACTACTATATATTTGATCG CTGAGTGATTTCACTGAAGATTGCCATCCTAGATGGCATCAAACTTTGAG TATGAAATTAACTTATAAATCGTTTTTTTTTACTCAAACTAGTATATTTG AGCACTGTGTTATTTAGACAGTACCAAGTAAGTGAGTAAGTAAGTTGTCT GTGTGTTTGATAAAGGGTACAATATGAAAGGGGTAAGGGTTATTAGGGGA GAATTTTTGTGTAGGGGGGTTCAGCATGGGGCGCTTGTTATGCATAACTG AGGGGTTTCTTACCAGTGCAGCCCTAGGGGAGAATAATAGGACTGCTCTA CTATTATTGTGTTACTTTAATTATCTGGATTTTCACGTTCGATAGAATTC ATCTGTTGTTTTGGTTTCCCTTCTTTTCTACTTTCTCATTTATACTGCCA GGGAATAATATTTGCTCTTATTGTTGTTCTTTAGATAAATTATGGATAGA AGCTGATGATTTAAAACACCCAGTGGTCCAGTATCAACATGAACGACCCA AATGTCGGTCTCATGAGGTCCACTTCATGGTCCTGGAGAAAGTTTCAACA CTTGAGGAAGCGATAAAGAAAAATGAACAGAAAAATCTTAGCTCCGAGCA AACTGGATCCGAAAGCGCACCCGTGACCCCTGAATCCCTGGAATCACCGC TTTGCTCTGGAAATAGTAGTGTTATTGTACAATACTCTGGGCAATCGAGT CGCAAAACCTCGCTTTGTAGCAGTGATGGTATTTTACCGAACGGAAGATT ATCGAATGATAGCGACCGCCCAATTGAAGGGCGTAAGGACAGTGGCGAAC TTCCAAATGATCAACTTCGAAAGAAATCCTTGTTGCACGTACCTTATTAC AAGCCGTTTACAGCACGTTCAAAGCAANCAGTACCAAGTAAGTGAGTAAG TAAGTTGTCTGTGTGTTTGATAAAGGGTACAATATGAAAGGGGTAAGGGT TATTAGGGGAGAATTTTTGTGTAGGGGGGTTCAGCATGGGGCGCTTGTTA TGCATAACTGAGGGGTTTCTTTACCAGTGCAGCCCTAGGAGAGAATAATA GGACTGCTCTACTATTATTGTGTTACTTTAATTATCTGGATTTTCACGTT CGATAGAATTCATCTGTTGTTTTGGTTTCCCTTCTTTTCTACTTTCTCAT TTATACTGCCAGGGAATAATATTTGCTCTTATTGTTGTTCTTTAGATAAA TTATGGATAGAAGCTGATGATTTAAAACACCCAGTGGTCCAGTATCAACA TGAACGACCCACATGTCGGTCTCATGAGGTCCACTTCATGGTCCTGGAGA AAGTTTCAACACTTGAGGAAGCGATAAAGAAAAATGAACAGAAAAATCTT AGCTCCGAGCAAACTGGATCCGAAAGCGCACCCGTGACCCCTGAATCCCT GGAATCACCGCTTTGCTCTGGTAATAGTAGTGTTATTGTACAATACTCTG GGCAATCGAGTCGCAAAACCTCGCTTTGTAGCAGTGATGGTATTTTACCG AACGGAAGATTATTGAATGATAGCGACCGCCCAAGCGAAGGGCGTAAGGA TAATCGCGATCTTCCAGATGATCAACTTCGAAAGAAATCCTTGTTGCACG TACCTTATTACAAGCCGTTTACAGCACGTTCAAAGCGTACAGCTAGAGAA AGTCCTACAAATTACAACCAGAATGCAACATCTTCTCATCTTAAATCTGA AAGCAGTAGCATGTCGCACAGTACACCAGCAAAACAGACTGTTCTAAACA ACCCTGACATTTTACAACAAACCACTAAAACATCAGACATAAAGGCGGAT CCTACGAACGCGATTTTCAGTCAAGCTTTAGCTAACGAACTCGGTGATTT TTATTCGGATCTTTTAGACCAACAATCTATGGACACTACCCAAGAAGATG GCATGTTTGATTCGACACAAATTTCCCAGGGAACTATTCCTAACCAAATG TCGTCTGATCAATTCAGCTCTACCACCCAAAACCAACAGCAAGACTCTAC AATCGACGTTCAACAAACTCTAGAACGTCGATTTAGTAACGATGTTGATT CGTTGAGTGATATAGTTGATATAGGTACTGCAATCGCCGGAGGTTCTTTT TCAAGTACCGTATCTAACGATAAAACTGGATTTAAAGATTATGGAAACCC TTTGAAAAGACTTATGGAGGAAGAGGAAGATATCAAAGGAGTTTTCCAAG CTTCTTCTGTCAATTTACAGATGTTTAATAAGACTGAAACGAATGATACC TCTTCAAGTGGGTCGCATGTAACACCAATGGATATAAATACTGATTTTGG TGAAATTAAGTCACCAACCGAGGACGAACCCAAGGTCGATTTTGCAATCA CCATGTCGACGAACAGTTATTCTGGAGCGTATTCGGACGTCAAACTGTCT GACGAGGAATTAGAAGAAATTTTAAACGGGTGATGAGTTAAGAATTGAAT CGAATATCTACCGGTAACACAGTTATGTGTGTATGTCACGTGTATAATAA ATCGCATAAACTGGTCGCTCTTTGTTTGAACGGGAACTGGAAGAGATTAA TTCTGATTTCGACTCAGAAATTTACTGTAGAGAGTCTCAAAACAGAATGA GAATCAATATGACATAAATAGTAGAGGTAAAGGTATAGCGTTCTACAGTA TGTGGCCCCCAAAACGTCAATCAAATTTGAAATGTCTCTCAAATCTAGAG GAAAAAAGGTTTTACAAAAATTTTTGCTGCATGAAAAGCTTTAACATCTC TACTTTATTTCCTGGAAGTTCTTTTTCAAAATTTTCAATTTCAACAATAT TTTTAAATCGCTTAAAGATAGCTTTTTTCTAATGGCCCCAAAAACGGAGG TTTGCAATTTTAGCGACTTCTCGAGATATCTTTAAGATATGAATACAAAA TTTTGACCATAGTTTTGAAATGTGATTTAGAGGGTTTTGGGCATAAATTT GTTTGATAAAATTTTTACAGTATACCCCTGGTTGTCAAAACGGTGGTTTG GGGCCCCCAAAACGTAGGTGTAGTTAAAATTAAATTATTAAGCCTAGTGG TAATAGGGGGAACTATGAACATATTTGTGTTTTCCCTTAAATTTACGACC CGATGGATGTAAAATTTATGATTTTTATAAAGTATTTCAAGATTTTCGAT GATGCAAAGTCCAAACTGAAAATTTAGAAATTTTCAAAATGACAATTTTG ATTTACAACGTCTTAATCAAGTTTCTGAAAA

Coding sequence (CDS) from alignment at sc0000001:2445250..2452430-

>TCONS_00000255 ID=TCONS_00000255|Name=TCONS_00000255|organism=Clytia hemisphaerica|type=CDS|length=14346bp|location=Sequence derived from alignment at sc0000001:2445250..2452430- (Clytia hemisphaerica)
ATAAATTATGGATAGAAGCTGATGATTTAAAACACCCAGTGGTCCAGTAT
CAACATGAACGACCCACATGTCGGTCTCATGAGGTCCACTTCATGGTCCT
GGAGAAAGTTTCAACACTTGAGGAAGCGATAAAGAAAAATGAACAGAAAA
ATCTTAGCTCCGAGCAAACTGGATCCGAAAGCGCACCCGTGACCCCTGAA
TCCCTGGAATCACCGCTTTGCTCTGGTAATAGTAGTGTTATTGTACAATA
CTCTGGGCAATCGAGTCGCAAAACCTCGCTTTGTAGCAGTGATGGTATTT
TACCGAACGGAAGATTATTGAATGATAGCGACCGCCCAAGCGAAGGGCGT
AAGGATAATCGCGATCTTCCAGATGATCAACTTCGAAAGAAATCCTTGTT
GCACGTACCTTATTACAAGCCGTTTACAGCACGTTCAAAGCGTACAGCTA
GAGAAAGTCCTACAAATTACAACCAGAATGCAACATCTTCTCATCTTAAA
TCTGAAAGCAGTAGCATGTCGCACAGTACACCAGCAAAACAGACTGTTCT
AAACAACCCTGACATTTTACAACAAACCACTAAAACATCAGACATAAAGG
CGGATCCTACGAACGCGATTTTCAGTCAAGCTTTAGCTAACGAACTCGGT
GATTTTTATTCGGATCTTTTAGACCAACAATCTATGGACACTACCCAAGA
AGATGGCATGTTTGATTCGACACAAATTTCCCAGGGAACTATTCCTAACC
AAATGTCGTCTGATCAATTCAGCTCTACCACCCAAAACCAACAGCAAGAC
TCTACAATCGACGTTCAACAAACTCTAGAACGTCGATTTAGTAACGATGT
TGATTCGTTGAGTGATATAGTTGATATAGGTACTGCAATCGCCGGAGGTT
CTTTTTCAAGTACCGTATCTAACGATAAAACTGGATTTAAAGATTATGGA
AACCCTTTGAAAAGACTTATGGAGGAAGAGGAAGATATCAAAGGAGTTTT
CCAAGCTTCTTCTGTCAATTTACAGATGTTTAATAAGACTGAAACGAATG
ATACCTCTTCAAGTGGGTCGCATGTAACACCAATGGATATAAATACTGAT
TTTGGTGAAATTAAGTCACCAACCGAGGACGAACCCAAGGTCGATTTTGC
AATCACCATGTCGACGAACAGTTATTCTGGAGCGTATTCGGACGTCAAAC
TGTCTGACGAGGAATTAGAAGAAATTTTAAACGGGTGAATATCCAGCTGC
GTTGTTTGTGTACTGCAGTACAGGGGTAGGTTGTCGAAAATACTGGAATT
GGTTCAACTTCACATCGCCGGCTGGAGACAATTATATTGTGACGCAAATT
GTCCAATACTCTAGAAAGAAGCACCACTTCATTTTGTGGAGTTACTCTTA
CAAAGGTTCAAGAAAACCATACTGACTCTCCCAGAAGGATATCCAGATTT
GAATTTCGTAGAGAATTTATACTACAAAAGGAATTGTTACAAATGCAATG
CACCAGAGCAAAAGAACGTTTTCTATATTGAGAAAGACCACCAACTCCAG
ACTCACTAGTAGCAAGTATTTCATCAAACAAACAAAGTGACATGTTACAA
CAAACACAATATGCAGTAAGTACTACTTCATCAAGTGGAAGTCGAAAACG
TAAACATTCAGATGGTGGCTCATCAAGCAGATCAACCAAAACAAATAGTT
TTCGCAGTGTCAGCAATTCAAACATTACAGATCCAATATCGTCAGATTCT
TCGAGCTTGATGGCTAACAAAAAGTATCCTTCAGTACCTCTATGGGAAAA
TGAAGAACTGCTGTGCTGGCTGGATTCAATGCTTGCACTCATAGTCTTGA
ACCAAACTTTACAGAATTATCCTGAAGAGTCCAAAGGTACCCTAAATAAA
TTACTCAGCGAATACAAACATAATACTGATATTTACAATGTGACAAAAGA
CTATGAAACAATAAGAGCAAGCATGCACACTTTACGGAAATCGACACTCA
ACTTCATTCAACCAAAGATGTTATCCAGCTTCACCGAGGAGGATTCTCCT
CTCTTGTCTCTACAGCTTTTAATGAAAACCAATGCTGAGCTTTATGAAGA
TTGCGAAGTGGAATACTCGAGTAAATTCACTTGTAACCAATGTCAATTCG
AAAAAACTGATGGTGTACATTTCCCTTATCTTCTCCATCCATGCAGTTAT
ACATGGAAGAAGATTTGACCACTGAACGTGTTTTGCTGTTGACAGGAAAC
AAAAGTAAACAATTAGAGATGGTTGTGATGGCGGTGAACAATCGGTATTG
TAGTGACTGTTTAGAATCAGGGGAATTTCTACCCCTGAGACTTGTCATGA
TGAATTTGGATAGCGGTCTTTGGATGTGTCCCAAAGATGATATAAATTAT
GGATAGAAGCTGATGATTTAAAACACCCAGTGGTCCAGTATCAACATGAA
CGACCCACATGTCGGTCTCATGAGGTCCACTTCATGGTCCTGGAGAAAGT
TTCAACACTTGAGGAAGCGATAAAGAAAAATGAACAGAAAAATCTTAGCT
CCGAGCAAACTGGATCCGAAAGCGCACCCGTGACCCCTGAATCCCTGGAA
TCACCGCTTTGCTCTGGTAATAGTAGTGTTATTGTACAATACTCTGGGCA
ATCGAGTCGCAAAACCTCGCTTTGTAGCAGTGATGGTATTTTACCGAACG
GAAGATTATTGAATGATAGCGACCGCCCAAGCGAAGGGCGTAAGGATAAT
CGCGATCTTCCAGATGATCAACTTCGAAAGAAATCCTTGTTGCACGTACC
TTATTACAAGCCGTTTACAGCACGTTCAAAGCGTACAGCTAGAGAAAGTC
CTACAAATTACAACCAGAATGCAACATCTTCTCATCTTAAATCTGAAAGC
AGTAGCATGTCGCACAGTACACCAGCAAAACAGACTGTTCTAAACAACCC
TGACATTTTACAACAAACCACTAAAACATCAGACATAAAGGCGGATCCTA
CGAACGCGATTTTCAGTCAAGCTTTAGCTAACGAACTCGGTGATTTTTAT
TCGGATCTTTTAGACCAACAATCTATGGACACTACCCAAGAAGATGGCAT
GTTTGATTCGACACAAATTTCCCAGGGAACTATTCCTAACCAAATGTCGT
CTGATCAATTCAGCTCTACCACCCAAAACCAACAGCAAGACTCTACAATC
GACGTTCAACAAACTCTAGAACGTCGATTTAGTAACGATGTTGATTCGTT
GAGTGATATAGTTGATATAGGTACTGCAATCGCCGGAGGTTCTTTTTCAA
GTACCGTATCTAACGATAAAACTGGATTTAAAGATTATGGAAACCCTTTG
AAAAGACTTATGGAGGAAGAGGAAGATATCAAAGGAGTTTTCCAAGCTTC
TTCTGTCAATTTACAGATGTTTAATAAGACTGAAACGAATGATACCTCTT
CAAGTGGGTCGCATGTAACACCAATGGATATAAATACTGATTTTGGTGAA
ATTAAGTCACCAACCGAGGACGAACCCAAGGTCGATTTTGCAATCACCAT
GTCGACGAACAGTTATTCTGGAGCGTATTCGGACGTCAAACTGTCTGACG
AGGAATTAGAAGAAATTTTAAACGGGTGAATATCCAGCTGCGTTGTTTGT
GTACTGCAGTACAGGGGTAGGTTGTCGAAAATACTGGAATTGGTTCAACT
TCACATCGCCGGCTGGAGACAATTATATTGTGACGCAAATTGTCCAATAC
TCTAGAAAGAAGCACCACTTCATTTTGTGGAGTTACTCTTACAAAGGTTC
AAGAAAACCATACTGACTCTCCCAGAAGGATATCCAGATTTGAATTTCGT
AGAGAATTTATACTACAAAAGGAATTGTTACAAATGCAATGCACCAGAGC
AAAAGAACGTTTTCTATATTGAGAAAGACCACCAACTCCAGACTCACTAG
TAGCAAGTATTTCATCAAACAAACAAAGTGACATGTTACAACAAACACAA
TATGCAGTAAGTACTACTTCATCAAGTGGAAGTCGAAAACGTAAACATTC
AGATGGTGGCTCATCAAGCAGATCAACCAAAACAAATAGTTTTCGCAGTG
TCAGCAATTCAAACATTACAGATCCAATATCGTCAGATTCTTCGAGCTTG
ATGGCTAACAAAAAGTATCCTTCAGTACCTCTATGGGAAAATGAAGAACT
GCTGTGCTGGCTGGATTCAATGCTTGCACTCATAGTCTTGAACCAAACTT
TACAGAATTATCCTGAAGAGTCCAAAGGTACCCTAAATAAATTACTCAGC
GAATACAAACATAATACTGATATTTACAATGTGACAAAAGACTATGAAAC
AATAAGAGCAAGCATGCACACTTTACGGAAATCGACACTCAACTTCATTC
AACCAAAGATGTTATCCAGCTTCACCGAGGAGGATTCTCCTCTCTTGTCT
CTACAGCTTTTAATGAAAACCAATGCTGAGCTTTATGAAGATTGCGAAGT
GGAATACTCGAGTAAATTCACTTGTAACCAATGTCAATTCGAAAAAACTG
ATGGTGTACATTTCCCTTATCTTCTCCATCCATGCAGTTATACATGGAAG
AAGATTTGACCACTGAACGTGTTTTGCTGTTGACAGGAAACAAAAGTAAA
CAATTAGAGATGGTTGTGATGGCGGTGAACAATCGGTATTGTAGTGACTG
TTTAGAATCAGGGGAATTTCTACCCCTGAGACTTGTCATGATGAATTTGG
ATAGCGGTCTTTGGATGTGTCCCAAAGATGATATAAATTATGGATAGAAG
CTGATGATTTAAAACACCCAGTGGTCCAGTATCAACATGAACGACCCACA
TGTCGGTCTCATGAGGTCCACTTCATGGTCCTGGAGAAAGTTTCAACACT
TGAGGAAGCGATAAAGAAAAATGAACAGAAAAATCTTAGCTCCGAGCAAA
CTGGATCCGAAAGCGCACCCGTGACCCCTGAATCCCTGGAATCACCGCTT
TGCTCTGGTAATAGTAGTGTTATTGTACAATACTCTGGGCAATCGAGTCG
CAAAACCTCGCTTTGTAGCAGTGATGGTATTTTACCGAACGGAAGATTAT
TGAATGATAGCGACCGCCCAAGCGAAGGGCGTAAGGATAATCGCGATCTT
CCAGATGATCAACTTCGAAAGAAATCCTTGTTGCACGTACCTTATTACAA
GCCGTTTACAGCACGTTCAAAGCGTACAGCTAGAGAAAGTCCTACAAATT
ACAACCAGAATGCAACATCTTCTCATCTTAAATCTGAAAGCAGTAGCATG
TCGCACAGTACACCAGCAAAACAGACTGTTCTAAACAACCCTGACATTTT
ACAACAAACCACTAAAACATCAGACATAAAGGCGGATCCTACGAACGCGA
TTTTCAGTCAAGCTTTAGCTAACGAACTCGGTGATTTTTATTCGGATCTT
TTAGACCAACAATCTATGGACACTACCCAAGAAGATGGCATGTTTGATTC
GACACAAATTTCCCAGGGAACTATTCCTAACCAAATGTCGTCTGATCAAT
TCAGCTCTACCACCCAAAACCAACAGCAAGACTCTACAATCGACGTTCAA
CAAACTCTAGAACGTCGATTTAGTAACGATGTTGATTCGTTGAGTGATAT
AGTTGATATAGGTACTGCAATCGCCGGAGGTTCTTTTTCAAGTACCGTAT
CTAACGATAAAACTGGATTTAAAGATTATGGAAACCCTTTGAAAAGACTT
ATGGAGGAAGAGGAAGATATCAAAGGAGTTTTCCAAGCTTCTTCTGTCAA
TTTACAGATGTTTAATAAGACTGAAACGAATGATACCTCTTCAAGTGGGT
CGCATGTAACACCAATGGATATAAATACTGATTTTGGTGAAATTAAGTCA
CCAACCGAGGACGAACCCAAGGTCGATTTTGCAATCACCATGTCGACGAA
CAGTTATTCTGGAGCGTATTCGGACGTCAAACTGTCTGACGAGGAATTAG
AAGAAATTTTAAACGGGTGAATATCCAGCTGCGTTGTTTGTGTACTGCAG
TACAGGGGTAGGTTGTCGAAAATACTGGAATTGGTTCAACTTCACATCGC
CGGCTGGAGACAATTATATTGTGACGCAAATTGTCCAATACTCTAGAAAG
AAGCACCACTTCATTTTGTGGAGTTACTCTTACAAAGGTTCAAGAAAACC
ATACTGACTCTCCCAGAAGGATATCCAGATTTGAATTTCGTAGAGAATTT
ATACTACAAAAGGAATTGTTACAAATGCAATGCACCAGAGCAAAAGAACG
TTTTCTATATTGAGAAAGACCACCAACTCCAGACTCACTAGTAGCAAGTA
TTTCATCAAACAAACAAAGTGACATGTTACAACAAACACAATATGCAGTA
AGTACTACTTCATCAAGTGGAAGTCGAAAACGTAAACATTCAGATGGTGG
CTCATCAAGCAGATCAACCAAAACAAATAGTTTTCGCAGTGTCAGCAATT
CAAACATTACAGATCCAATATCGTCAGATTCTTCGAGCTTGATGGCTAAC
AAAAAGTATCCTTCAGTACCTCTATGGGAAAATGAAGAACTGCTGTGCTG
GCTGGATTCAATGCTTGCACTCATAGTCTTGAACCAAACTTTACAGAATT
ATCCTGAAGAGTCCAAAGGTACCCTAAATAAATTACTCAGCGAATACAAA
CATAATACTGATATTTACAATGTGACAAAAGACTATGAAACAATAAGAGC
AAGCATGCACACTTTACGGAAATCGACACTCAACTTCATTCAACCAAAGA
TGTTATCCAGCTTCACCGAGGAGGATTCTCCTCTCTTGTCTCTACAGCTT
TTAATGAAAACCAATGCTGAGCTTTATGAAGATTGCGAAGTGGAATACTC
GAGTAAATTCACTTGTAACCAATGTCAATTCGAAAAAACTGATGGTGTAC
ATTTCCCTTATCTTCTCCATCCATGCAGTTATACATGGAAGAAGATTTGA
CCACTGAACGTGTTTTGCTGTTGACAGGAAACAAAAGTAAACAATTAGAG
ATGGTTGTGATGGCGGTGAACAATCGGTATTGTAGTGACTGTTTAGAATC
AGGGGAATTTCTACCCCTGAGACTTGTCATGATGAATTTGGATAGCGGTC
TTTGGATGTGTCCCAAAGATGATATAAATTATGGATAGAAGCTGATGATT
TAAAACACCCAGTGGTCCAGTATCAACATGAACGACCCACATGTCGGTCT
CATGAGGTCCACTTCATGGTCCTGGAGAAAGTTTCAACACTTGAGGAAGC
GATAAAGAAAAATGAACAGAAAAATCTTAGCTCCGAGCAAACTGGATCCG
AAAGCGCACCCGTGACCCCTGAATCCCTGGAATCACCGCTTTGCTCTGGT
AATAGTAGTGTTATTGTACAATACTCTGGGCAATCGAGTCGCAAAACCTC
GCTTTGTAGCAGTGATGGTATTTTACCGAACGGAAGATTATTGAATGATA
GCGACCGCCCAAGCGAAGGGCGTAAGGATAATCGCGATCTTCCAGATGAT
CAACTTCGAAAGAAATCCTTGTTGCACGTACCTTATTACAAGCCGTTTAC
AGCACGTTCAAAGCGTACAGCTAGAGAAAGTCCTACAAATTACAACCAGA
ATGCAACATCTTCTCATCTTAAATCTGAAAGCAGTAGCATGTCGCACAGT
ACACCAGCAAAACAGACTGTTCTAAACAACCCTGACATTTTACAACAAAC
CACTAAAACATCAGACATAAAGGCGGATCCTACGAACGCGATTTTCAGTC
AAGCTTTAGCTAACGAACTCGGTGATTTTTATTCGGATCTTTTAGACCAA
CAATCTATGGACACTACCCAAGAAGATGGCATGTTTGATTCGACACAAAT
TTCCCAGGGAACTATTCCTAACCAAATGTCGTCTGATCAATTCAGCTCTA
CCACCCAAAACCAACAGCAAGACTCTACAATCGACGTTCAACAAACTCTA
GAACGTCGATTTAGTAACGATGTTGATTCGTTGAGTGATATAGTTGATAT
AGGTACTGCAATCGCCGGAGGTTCTTTTTCAAGTACCGTATCTAACGATA
AAACTGGATTTAAAGATTATGGAAACCCTTTGAAAAGACTTATGGAGGAA
GAGGAAGATATCAAAGGAGTTTTCCAAGCTTCTTCTGTCAATTTACAGAT
GTTTAATAAGACTGAAACGAATGATACCTCTTCAAGTGGGTCGCATGTAA
CACCAATGGATATAAATACTGATTTTGGTGAAATTAAGTCACCAACCGAG
GACGAACCCAAGGTCGATTTTGCAATCACCATGTCGACGAACAGTTATTC
TGGAGCGTATTCGGACGTCAAACTGTCTGACGAGGAATTAGAAGAAATTT
TAAACGGGTGAATATCCAGCTGCGTTGTTTGTGTACTGCAGTACAGGGGT
AGGTTGTCGAAAATACTGGAATTGGTTCAACTTCACATCGCCGGCTGGAG
ACAATTATATTGTGACGCAAATTGTCCAATACTCTAGAAAGAAGCACCAC
TTCATTTTGTGGAGTTACTCTTACAAAGGTTCAAGAAAACCATACTGACT
CTCCCAGAAGGATATCCAGATTTGAATTTCGTAGAGAATTTATACTACAA
AAGGAATTGTTACAAATGCAATGCACCAGAGCAAAAGAACGTTTTCTATA
TTGAGAAAGACCACCAACTCCAGACTCACTAGTAGCAAGTATTTCATCAA
ACAAACAAAGTGACATGTTACAACAAACACAATATGCAGTAAGTACTACT
TCATCAAGTGGAAGTCGAAAACGTAAACATTCAGATGGTGGCTCATCAAG
CAGATCAACCAAAACAAATAGTTTTCGCAGTGTCAGCAATTCAAACATTA
CAGATCCAATATCGTCAGATTCTTCGAGCTTGATGGCTAACAAAAAGTAT
CCTTCAGTACCTCTATGGGAAAATGAAGAACTGCTGTGCTGGCTGGATTC
AATGCTTGCACTCATAGTCTTGAACCAAACTTTACAGAATTATCCTGAAG
AGTCCAAAGGTACCCTAAATAAATTACTCAGCGAATACAAACATAATACT
GATATTTACAATGTGACAAAAGACTATGAAACAATAAGAGCAAGCATGCA
CACTTTACGGAAATCGACACTCAACTTCATTCAACCAAAGATGTTATCCA
GCTTCACCGAGGAGGATTCTCCTCTCTTGTCTCTACAGCTTTTAATGAAA
ACCAATGCTGAGCTTTATGAAGATTGCGAAGTGGAATACTCGAGTAAATT
CACTTGTAACCAATGTCAATTCGAAAAAACTGATGGTGTACATTTCCCTT
ATCTTCTCCATCCATGCAGTTATACATGGAAGAAGATTTGACCACTGAAC
GTGTTTTGCTGTTGACAGGAAACAAAAGTAAACAATTAGAGATGGTTGTG
ATGGCGGTGAACAATCGGTATTGTAGTGACTGTTTAGAATCAGGGGAATT
TCTACCCCTGAGACTTGTCATGATGAATTTGGATAGCGGTCTTTGGATGT
GTCCCAAAGATGATATAAATTATGGATAGAAGCTGATGATTTAAAACACC
CAGTGGTCCAGTATCAACATGAACGACCCACATGTCGGTCTCATGAGGTC
CACTTCATGGTCCTGGAGAAAGTTTCAACACTTGAGGAAGCGATAAAGAA
AAATGAACAGAAAAATCTTAGCTCCGAGCAAACTGGATCCGAAAGCGCAC
CCGTGACCCCTGAATCCCTGGAATCACCGCTTTGCTCTGGTAATAGTAGT
GTTATTGTACAATACTCTGGGCAATCGAGTCGCAAAACCTCGCTTTGTAG
CAGTGATGGTATTTTACCGAACGGAAGATTATTGAATGATAGCGACCGCC
CAAGCGAAGGGCGTAAGGATAATCGCGATCTTCCAGATGATCAACTTCGA
AAGAAATCCTTGTTGCACGTACCTTATTACAAGCCGTTTACAGCACGTTC
AAAGCGTACAGCTAGAGAAAGTCCTACAAATTACAACCAGAATGCAACAT
CTTCTCATCTTAAATCTGAAAGCAGTAGCATGTCGCACAGTACACCAGCA
AAACAGACTGTTCTAAACAACCCTGACATTTTACAACAAACCACTAAAAC
ATCAGACATAAAGGCGGATCCTACGAACGCGATTTTCAGTCAAGCTTTAG
CTAACGAACTCGGTGATTTTTATTCGGATCTTTTAGACCAACAATCTATG
GACACTACCCAAGAAGATGGCATGTTTGATTCGACACAAATTTCCCAGGG
AACTATTCCTAACCAAATGTCGTCTGATCAATTCAGCTCTACCACCCAAA
ACCAACAGCAAGACTCTACAATCGACGTTCAACAAACTCTAGAACGTCGA
TTTAGTAACGATGTTGATTCGTTGAGTGATATAGTTGATATAGGTACTGC
AATCGCCGGAGGTTCTTTTTCAAGTACCGTATCTAACGATAAAACTGGAT
TTAAAGATTATGGAAACCCTTTGAAAAGACTTATGGAGGAAGAGGAAGAT
ATCAAAGGAGTTTTCCAAGCTTCTTCTGTCAATTTACAGATGTTTAATAA
GACTGAAACGAATGATACCTCTTCAAGTGGGTCGCATGTAACACCAATGG
ATATAAATACTGATTTTGGTGAAATTAAGTCACCAACCGAGGACGAACCC
AAGGTCGATTTTGCAATCACCATGTCGACGAACAGTTATTCTGGAGCGTA
TTCGGACGTCAAACTGTCTGACGAGGAATTAGAAGAAATTTTAAACGGGT
GAATATCCAGCTGCGTTGTTTGTGTACTGCAGTACAGGGGTAGGTTGTCG
AAAATACTGGAATTGGTTCAACTTCACATCGCCGGCTGGAGACAATTATA
TTGTGACGCAAATTGTCCAATACTCTAGAAAGAAGCACCACTTCATTTTG
TGGAGTTACTCTTACAAAGGTTCAAGAAAACCATACTGACTCTCCCAGAA
GGATATCCAGATTTGAATTTCGTAGAGAATTTATACTACAAAAGGAATTG
TTACAAATGCAATGCACCAGAGCAAAAGAACGTTTTCTATATTGAGAAAG
ACCACCAACTCCAGACTCACTAGTAGCAAGTATTTCATCAAACAAACAAA
GTGACATGTTACAACAAACACAATATGCAGTAAGTACTACTTCATCAAGT
GGAAGTCGAAAACGTAAACATTCAGATGGTGGCTCATCAAGCAGATCAAC
CAAAACAAATAGTTTTCGCAGTGTCAGCAATTCAAACATTACAGATCCAA
TATCGTCAGATTCTTCGAGCTTGATGGCTAACAAAAAGTATCCTTCAGTA
CCTCTATGGGAAAATGAAGAACTGCTGTGCTGGCTGGATTCAATGCTTGC
ACTCATAGTCTTGAACCAAACTTTACAGAATTATCCTGAAGAGTCCAAAG
GTACCCTAAATAAATTACTCAGCGAATACAAACATAATACTGATATTTAC
AATGTGACAAAAGACTATGAAACAATAAGAGCAAGCATGCACACTTTACG
GAAATCGACACTCAACTTCATTCAACCAAAGATGTTATCCAGCTTCACCG
AGGAGGATTCTCCTCTCTTGTCTCTACAGCTTTTAATGAAAACCAATGCT
GAGCTTTATGAAGATTGCGAAGTGGAATACTCGAGTAAATTCACTTGTAA
CCAATGTCAATTCGAAAAAACTGATGGTGTACATTTCCCTTATCTTCTCC
ATCCATGCAGTTATACATGGAAGAAGATTTGACCACTGAACGTGTTTTGC
TGTTGACAGGAAACAAAAGTAAACAATTAGAGATGGTTGTGATGGCGGTG
AACAATCGGTATTGTAGTGACTGTTTAGAATCAGGGGAATTTCTACCCCT
GAGACTTGTCATGATGAATTTGGATAGCGGTCTTTGGATGTGTCCCAAAG
ATGATATAAATTATGGATAGAAGCTGATGATTTAAAACACCCAGTGGTCC
AGTATCAACATGAACGACCCACATGTCGGTCTCATGAGGTCCACTTCATG
GTCCTGGAGAAAGTTTCAACACTTGAGGAAGCGATAAAGAAAAATGAACA
GAAAAATCTTAGCTCCGAGCAAACTGGATCCGAAAGCGCACCCGTGACCC
CTGAATCCCTGGAATCACCGCTTTGCTCTGGTAATAGTAGTGTTATTGTA
CAATACTCTGGGCAATCGAGTCGCAAAACCTCGCTTTGTAGCAGTGATGG
TATTTTACCGAACGGAAGATTATTGAATGATAGCGACCGCCCAAGCGAAG
GGCGTAAGGATAATCGCGATCTTCCAGATGATCAACTTCGAAAGAAATCC
TTGTTGCACGTACCTTATTACAAGCCGTTTACAGCACGTTCAAAGCGTAC
AGCTAGAGAAAGTCCTACAAATTACAACCAGAATGCAACATCTTCTCATC
TTAAATCTGAAAGCAGTAGCATGTCGCACAGTACACCAGCAAAACAGACT
GTTCTAAACAACCCTGACATTTTACAACAAACCACTAAAACATCAGACAT
AAAGGCGGATCCTACGAACGCGATTTTCAGTCAAGCTTTAGCTAACGAAC
TCGGTGATTTTTATTCGGATCTTTTAGACCAACAATCTATGGACACTACC
CAAGAAGATGGCATGTTTGATTCGACACAAATTTCCCAGGGAACTATTCC
TAACCAAATGTCGTCTGATCAATTCAGCTCTACCACCCAAAACCAACAGC
AAGACTCTACAATCGACGTTCAACAAACTCTAGAACGTCGATTTAGTAAC
GATGTTGATTCGTTGAGTGATATAGTTGATATAGGTACTGCAATCGCCGG
AGGTTCTTTTTCAAGTACCGTATCTAACGATAAAACTGGATTTAAAGATT
ATGGAAACCCTTTGAAAAGACTTATGGAGGAAGAGGAAGATATCAAAGGA
GTTTTCCAAGCTTCTTCTGTCAATTTACAGATGTTTAATAAGACTGAAAC
GAATGATACCTCTTCAAGTGGGTCGCATGTAACACCAATGGATATAAATA
CTGATTTTGGTGAAATTAAGTCACCAACCGAGGACGAACCCAAGGTCGAT
TTTGCAATCACCATGTCGACGAACAGTTATTCTGGAGCGTATTCGGACGT
CAAACTGTCTGACGAGGAATTAGAAGAAATTTTAAACGGGTGAATATCCA
GCTGCGTTGTTTGTGTACTGCAGTACAGGGGTAGGTTGTCGAAAATACTG
GAATTGGTTCAACTTCACATCGCCGGCTGGAGACAATTATATTGTGACGC
AAATTGTCCAATACTCTAGAAAGAAGCACCACTTCATTTTGTGGAGTTAC
TCTTACAAAGGTTCAAGAAAACCATACTGACTCTCCCAGAAGGATATCCA
GATTTGAATTTCGTAGAGAATTTATACTACAAAAGGAATTGTTACAAATG
CAATGCACCAGAGCAAAAGAACGTTTTCTATATTGAGAAAGACCACCAAC
TCCAGACTCACTAGTAGCAAGTATTTCATCAAACAAACAAAGTGACATGT
TACAACAAACACAATATGCAGTAAGTACTACTTCATCAAGTGGAAGTCGA
AAACGTAAACATTCAGATGGTGGCTCATCAAGCAGATCAACCAAAACAAA
TAGTTTTCGCAGTGTCAGCAATTCAAACATTACAGATCCAATATCGTCAG
ATTCTTCGAGCTTGATGGCTAACAAAAAGTATCCTTCAGTACCTCTATGG
GAAAATGAAGAACTGCTGTGCTGGCTGGATTCAATGCTTGCACTCATAGT
CTTGAACCAAACTTTACAGAATTATCCTGAAGAGTCCAAAGGTACCCTAA
ATAAATTACTCAGCGAATACAAACATAATACTGATATTTACAATGTGACA
AAAGACTATGAAACAATAAGAGCAAGCATGCACACTTTACGGAAATCGAC
ACTCAACTTCATTCAACCAAAGATGTTATCCAGCTTCACCGAGGAGGATT
CTCCTCTCTTGTCTCTACAGCTTTTAATGAAAACCAATGCTGAGCTTTAT
GAAGATTGCGAAGTGGAATACTCGAGTAAATTCACTTGTAACCAATGTCA
ATTCGAAAAAACTGATGGTGTACATTTCCCTTATCTTCTCCATCCATGCA
GTTATACATGGAAGAAGATTTGACCACTGAACGTGTTTTGCTGTTGACAG
GAAACAAAAGTAAACAATTAGAGATGGTTGTGATGGCGGTGAACAATCGG
TATTGTAGTGACTGTTTAGAATCAGGGGAATTTCTACCCCTGAGACTTGT
CATGATGAATTTGGATAGCGGTCTTTGGATGTGTCCCAAAGATGAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000139XLOC_000139Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000255-proteinTCONS_00000255-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000255-exon-sc0000001-1575043694:2452278..2452430TCONS_00000255-exon-sc0000001-1575043694:2452278..2452430Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1575043694:2451878..2451982TCONS_00000255-exon-sc0000001-1575043694:2451878..2451982Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1575043694:2450980..2451608TCONS_00000255-exon-sc0000001-1575043694:2450980..2451608Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1575043694:2450697..2450825TCONS_00000255-exon-sc0000001-1575043694:2450697..2450825Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1575043694:2449811..2449977TCONS_00000255-exon-sc0000001-1575043694:2449811..2449977Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1575043694:2445250..2447285TCONS_00000255-exon-sc0000001-1575043694:2445250..2447285Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2452278..2452430TCONS_00000255-exon-sc0000001-1510915933:2452278..2452430Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2451878..2451982TCONS_00000255-exon-sc0000001-1510915933:2451878..2451982Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2450980..2451608TCONS_00000255-exon-sc0000001-1510915933:2450980..2451608Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2450697..2450825TCONS_00000255-exon-sc0000001-1510915933:2450697..2450825Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2449811..2449977TCONS_00000255-exon-sc0000001-1510915933:2449811..2449977Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1510915933:2445250..2447285TCONS_00000255-exon-sc0000001-1510915933:2445250..2447285Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2452278..2452430TCONS_00000255-exon-sc0000001-1491911889:2452278..2452430Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2451878..2451982TCONS_00000255-exon-sc0000001-1491911889:2451878..2451982Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2450980..2451608TCONS_00000255-exon-sc0000001-1491911889:2450980..2451608Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2450697..2450825TCONS_00000255-exon-sc0000001-1491911889:2450697..2450825Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2449811..2449977TCONS_00000255-exon-sc0000001-1491911889:2449811..2449977Clytia hemisphaericaexon
TCONS_00000255-exon-sc0000001-1491911889:2445250..2447285TCONS_00000255-exon-sc0000001-1491911889:2445250..2447285Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2445250..2452430 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.70362 2.86004 1.5936 0.866515 8.80411 6.91374 8.56783 6.54418 3.36798 3.5692 2.86021 4.18578 5.44466 1.91242 2.13983 1.6812 0 0.0102201 0.647803 5.2768 5.78411 5.67774 2.61112 3.81106 7.59228 9.71447 7.32733 5.14344 3.9486 4.20823
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028890Peptidase_C98
Vocabulary: Molecular Function
TermDefinition
GO:0070140SUMO-specific isopeptidase activity
GO:0032183SUMO binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0032183 SUMO binding
molecular_function GO:0070140 SUMO-specific isopeptidase activity
Blast
BLAST of TCONS_00000255 vs. Swiss-Prot (Human)
Match: USPL1 (SUMO-specific isopeptidase USPL1 OS=Homo sapiens GN=USPL1 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 8.972e-19
Identity = 74/306 (24.18%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  517 WENEELLCWLDSMLALIVLNQTLQN----YPEESKGTLNKLLSEYKH-NTDIYN--------------VTKDYETIRASMHTLRKSTLNFIQPKMLSSFTEEDSPLLSLQLLMKTNAELYEDCEVEYSSKFTCNQCQFEKTDGFKKTILTLPEGYPDLNFVENLYYKRNCYKCNAPEQKNVFYIEKYPAALFVYCSTGVGCRKYWNW-FNFTSPAGDNYIVTQIVQYSRKKHHFILWSYSYKDKLWIEADDLKHPVVQYQHERPTCRSHEVHFMVLEK----VSTLEEAI----KKNEQKNLSSEQ 1350
            W+N   LCWLD +L+ +V ++ L+N       + +    +LL++Y   NT +Y                ++ +  I   ++ +R      +QP++  +  + +SP+ +  LL+K    + +     +S  F C+QC  +  +   K+++T     P+ + +   ++   C  CN+  Q     +EK      ++   G+      ++ F+F    G  Y +T ++QY R  +HFI W     D  W+E DDLK P  + +H++    + E+H ++ E+    V+  E A     K N+Q  LS+E+
Sbjct:  229 WKNAYALCWLDCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQANTLLYTSQLSGVKDGDCKKLTSEIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVFAFPLLLKLETHIEKLFLYSFSWDFECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFGP-CNNCNSKSQIRKMVLEKVSPIFMLHFVEGLPQNDLQHYAFHF---EGCLYQITSVIQY-RANNHFITWILD-ADGSWLECDDLKGPCSE-RHKKFEVPASEIHIVIWERKISQVTDKEAACLPLKKTNDQHALSNEK 527          
The following BLAST results are available for this feature:
BLAST of TCONS_00000255 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
USPL18.972e-1924.18SUMO-specific isopeptidase USPL1 OS=Homo sapiens G... [more]
back to top