Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000184 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000184
Unique NameTCONS_00000184
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3066

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000184 ID=TCONS_00000184|Name=TCONS_00000184|organism=Clytia hemisphaerica|type=transcript|length=3066bp
TAAACATGAAAGGGACATGTGAGATATTGACACTAAAATAATTATCAACC
GTTTGATTGCAATTTAAAGATGTTATTTAAATTTGTTTATTATGCATTTA
CCATTGAATTTCAAGAATCGTTAAATCCATAGGGGAATATGAAATTTACA
GGGCGGAATATCGAAAGAAGCCTCAGTACAAAGTTTAGCTCGACCCAGTC
CCCGGCGAACACGATGTGTTGATTCAGCAAAACTGTGTCCATCTCTTTCC
ATTCAGTTGCAGTTCAGCTAACCTTGTGTTAAGTAGTTGTTTTTGGGTAT
CGTCGTGTCGACGCCTAAGCCTACTTTATTTAAATGTAttgttaaaaatt
tacaaaaaaaaattataaaattataaaaaaccataaaaaaatatatcata
taTACACGTGAAGGAAACCATCCTGAGTACACAGAGATTGCATTGCACGA
GATGAATCAACAAGGACAAGGTGCATCATCCGCAAACTACCCAATCGCTT
CCCTGTACGTTGGTGACTTGAGTCCAGATGTTACAGAAGCCATGCTTTTC
GAGAAGTTCAGTGCTACTGGTCCAGTGTTATCTATCCGAGTCTGTCGTGA
CTTGGTCACTAGACGGTCCCTTGGCTATGCTTATGTCAACTATCAACAAC
CTGCTGATgCTGAGCGAGCCATTGATACTTTGAACTATGACCCCATCAAA
GGACGTCCGTGCCGTATCATGTGGTCTCAACGTGACCCAACTCTACGAAG
ATCTGGTGTTGGAAACATTTTCATCAAGAACTTGGATAAGCATATCGATC
ACAAAGGTCTTTATGATACCTTCAGTGCTTTTGGAAACATTCTCTCATGT
AAAATTGCTGCTGACGACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCA
TTATGAAACTAAAGAAGCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCA
TGATGTTGAACGACAAGAAAGTCTTTGTGGGAGAATTCATGTGTAAGAAA
GAGCGTGTGGACCAGATTGGTGAccaacaaaagaaatttaagaacatctt
ttGCAAGAATTTTGGAAATGAATTTACAAATGACAAACTTTTGGGATTGT
TTCAAGAATTTGGAGAAATCACCAGTTGTGTTGTTATGACTGATGAGTCT
GGAACAAGCAGAGGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGATGC
TGAAAAGGCTTGTGATGAGTTGAACAATAAGGAGATTGATGGAAACAAAA
TCACTTGTTGCCGTGCTCAAAAAAAAGCTGAAAGATCCATGGAATTGAAA
AGCAAATTTGAACAACAAAAGAACGAGAGAATTAGCAGATATCAAGGTGT
TAACTTGTACATCAAGAATCTGGAAGATGGCATCGACGATGAACGTCTTC
GAACTGAATTCTCTCAATTTGGAACCATCACCAGCGCGAAAGTCATGAAA
GACGACAAAGTAAATTCCAAAGGATTTGGTTTCGTTTGTTTTTCGTCTCC
TGATGAAGCAACAAAAGCAGTCACAGAAATGAACGGACGCATCATTGTCA
CCAAACCCTTGTATGTTGCATTGGCTCAACGTAAGGAAGAACGTCGTGCA
CAATTGTCTACTCAGTTTATGCAGAGAGTTGGTCCTCTAAGATATCAACC
TGGAGCCGGAATGCCTCAGCAACAAGGTTATTCCTTCCAGCCAGGCCAAC
CAAGCTTCTATATCCCAACGATGCCACAAGGTCAACGTGCTGCCTTCATT
GCTCAACCAGTGAGCCAAATGACCAGACCTCGATGGCAATCAGCAAACGT
ACGTCAAATGCAAGGTGGATACCCCAACCCTGGAGGAAACGTTCGCGGAT
CACGACCAAGACACCCCAACTCGGTCCAACCCCGACGTGAAACACCTTAC
AATCAGAAATTTCAACAAGGAGGCAATATGCCAAACCAAGTGATGCGTGC
TGGTGGTCCAGTACCAAACCAAAGAGCTCAATACAAATTGAACCAAAATA
CACGCAATCAATACCCAGCTGGACCAGCACCTCCAGCTGTTGTCCCACAA
CAAGTTGCTGATCAACCAGCTCCAATGATGCCAGGAcaACAAGAGCCATT
GACTGCTTCCACTTTGGCTGGAGCCACTCCATCCGAGCAAAAGCAGATGA
TTGGTGAACGTCTTTTCCCCTTGGTCCAAGAACATCAACCCAAGATGGCC
GGCAAGATCACTGGAATGTTGTTGGAGATCGATAATGGTGAATTGTTGAA
CATGTTGGAAAGTCGTGATTTGTTGAAAGATAAAGTGGGAGAAGCTGTGG
CAGTACTTCAAGCTCATCAAGCTAAAGAGGCTCAAACCCAGGCTAAGACT
GGTGAACAAGCCTAATTCCCTTCACACCCTAGCGTTGAGCATGCTTTGAA
TGGactaaaagaaagttttaatgGAAGATTATTTCGGAAAGTTGTgtatg
ttttgatgttttttgaagctttgttgttttgaaaaatttctctgGAGAAC
GTTTTTCTGCTATTCCGGCGCTGAAGAaatttagtttaacttttattttt
tagtaAAGAAATactatatatggaaattttacAGTATATTGCATAACAGG
ATTGATTAGGACGGTATTTATCAGAggttttaaggatttttatcGTTAAT
GTGAAAGTTATATGAAAGGGTTAACAATGGTTTATGTGTTGATGGATCTT
AAAATTTCTCTGTGCCTCTTTTAAAATCTAGTTTGCAATCAATATGTTCT
TCTAATTTTCTATGtacactttattttttcattaaaatacataaaataaa
aacagacaaaaaacaaaaaggtcATGTCGACTGTAAACTTTGCATGTTTG
TATTTGGTATCGCTTGTGAACAgtactgaatcaatcttccattTATTGTA
ATNTGTTTGTATTTGGTATCGCTTGTGAACAgtactgaatcaatcttcca
ttTTTTgtaacattgtagtatggtaTTATGTCATGAAAGAAGAATATAGC
AGCATGCTTACACTTAACCAAACAATGcgttttctatatttttactTGCC
AACTTTATTTGCTATT
Run BLAST on NCBI

transcript from alignment at sc0000001:996620..1005215-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000184 ID=TCONS_00000184|Name=TCONS_00000184|organism=Clytia hemisphaerica|type=transcript|length=8596bp|location=Sequence derived from alignment at sc0000001:996620..1005215- (Clytia hemisphaerica)
TAAACATGAAAGGGACATGTGAGATATTGACACTAAAATAATTATCAACC GTTTGATTGCAATTTAAAGATGTTATTTAAATTTGTTTATTATGCATTTA CCATTGAATTTCAAGAATCGTTAAATCCATAGGGGAATATGAAATTTACA GGGCGGAATATCGAAAGAAGCCTCAGTACAAAGTTTAGCTCGACCCAGTC CCCGGCGAACACGATGTGTTGATTCAGCAAAACTGTGTCCATCTCTTTCC ATTCAGTTGCAGTTCAGCTAACCTTGTGTTAAGTAGTTGTTTTTGGGTAT CGTCGTGTCGACGCCTAAGCCTACTTTATTTAAATGTATTGTTAAAAATT TACAAAAAAAAATTATAAAATTATAAAAAACCATAAAAAAATATATCATA TATACACGTGAAGGAAACCATCCTGAGTACACAGAGATTGCATTGCACGA GGTTTGTTTACAACGACTAGCAGTGTAACACATTTTACCAGGCGTGACAA CAACATTCGCCTCTTTATTATTATTCAAGAAGAATTTATAATCAAACTCG AAGTTTTATTTACTTGAGAACTTTACACATACAAGATGAATCAACAAGGA CAAGGTGCATCATCCGCAAACTACCCAATCGCTTCCCTGTACGTTGGTGA CTTGAGTCCAGATGTTACAGAAGCCATGCTTTTCGAGAAGTTCAGTGCTA CTGGTCCAGTGTTATCTATCCGAGTCTGTCGTGACTTGGTCACTAGACGG TCCCTTGGCTATGCTTATGTCAACTATCAACAACCTGCTGATGGTAATAT TTATTTTTGTTGTTTAAAAAGACATCTTCCATGGTTTTGCATGAATTAGA TGAAAATAATGCAGGAATTGATTAGCTATATGGTTAAAGAACGAAAAATG ATGCATGCGTGTTACAATGCAGGATTCTTTAGAGGATGATATAAATTCTG ATGCAAAAGATTTGTTATGAAATTGGAAGTAAAACAGATTTAGATTTCAT AAAATGTTATGCTGTAGTCAGTTATACTTAATTTGAGGGTGCTGACTCAG AATTGGGCTATTCCAAAAAAAAATTGTATAGGGGTATTGATAAACTTTTT TTCACTAACCCCCCTGGAAATTTTGGATAACAAACTATCCCCTGGAAATT AGGAGTCGACACCCCTGGAAAGTTAAATATTGTGAAAAAGTGCCTGGAAA GTGGCTATTGATGCCAGTGTAGGAGGAGAGAACCCCCTGGAAACCTTTAA TAACCCCCTTGGAAAATCTGAAAATGACCAAAAGCCCCTTGGAAAATCGA GGCTCAGTCCCCCCTGGAAAAGTTCGTCAATACCCCTGTATGGTTTAAAA ATAGAATAGCCCATTAGTGTTATCCAAGTTTAGGTTTAATTTTTTGTCTA TCATGTGTTCTTTTCTTTTACATTGGGCTATTCAAAAATAAAATTGTACA TGGGTATTAACAAACTTTTTACATTAACCCCTTGGAAATTGGGTCAACAC CCCTGGAAATTAAAATTTTATGAAAAAGGGGCTGGAAAATGACTAGTAAT GATGTCAGTTTAGGAAGAGAAAACCCCTTGTAGAATTAAGGCTCAAACAC CCCTGTACCGTAAGTTGGTCTAATATCAACATCCCCCGTTTAATTCCGAC ACGCTTCTTTACAGACAGGAATAATATGAAAGCTTGAATCACTGGTTTAA AAAAGGATTATTCCTCTCTGACCACTAAGCAAAGAAAAACAGTTTAAACC ATTCTATCAATTTCAGCTGATAAAAAGGGTGTCGGAATTAAGTTACGGTA TGGTTTAAAAATGGAATAGCCCATTCCAGGCTAAAATTTAAGGCCTAAAA AATTATGATTTTTGGTTTTTTTTGCCATTTGTAGATCAGAAGTTTTAGCC TTTGTTTAAAAACAAAGGAAATGGGGAATTTCCCTAAATTCTGCTTCTAA TATACGCATAATTAAAGACCTTTTTCACCACAAACATTAACAACTTTTGA TCTTAATGTCAGAAATTTTCACTGGCAGTTCAAGTTCCTTTGCTTTTATT AAAACATTGGATAAGGATAGTATTTGCTATTTTAAGCTCAAAAAAGAATT TAGTGAATTGAAGTACTTTAAATATTGTTCATGCAGCCCTGTGAATCGAG GTCGGCATTCGGCAATGCCGACTTGAAAGCCGACGTAACTTGAGCTGAAG TCGGCTTTTATTTGCTGACGTAATTTACACTCTAGGTCGGCGCGCCAACA AAAGAAATGTTTTGGTAATCTAATTGTGTTATCATTTGATAACACTTGTG CATGATAATCAAGCCTCATTCCATTCTCTTTATAAAACATAAAACTTAAT AACACAATTATAGAGCAGCTGAATTTGTTAGTTCGTTAATTTTCTTCCTA TTTTGTCTTTGCCGACCTGAACAAGCTACTTAGGACGGCTTTGCCGACCT AAAATGACCTCTAGGTCAGCAAAATTTTGCCGGCCTACGGCTCGTTTTGG TCGGCATTTAAGTGCCGATATTATTTTGTCTGAATTCACAGGGCTGTTCA TGGGAATTCAATTGCAAAAATATCTGACATTACACTTCACTTAGTAATTT CTTGTAGTACATCTTTTGCTCATTTTCAAGAGCTTTGTCATATGGTTGCA AAGTTCATTCTTGAGGCCATTGTACAGACTCATTTGGCTGTTTATCAATC CAAGTCTCTTGATTTAGTTTTTTGTTTTATTTAAAAGTAATGAAGTATGC TTTAAAGTCTGAAGTAATCTTGCAAATTTCTGATGTTTGGGCGAGACAGC ATAGCACTTTTTTTATTTAGGTAAGAACTGCATAAAATTGTAAAAAAGCA CAAAAGTTGCAATTTTTGGTCAATTTTAGACCAAAATGTGGCGAAAAGTG GAACTTGCGCATGAAATATCTCGAGTTAGGTAATGAAATCGGCCATACCC GTTTAAAAGTCTTCTGTATAGTTTTTTGAGAGCTTTCGAATGGTTTACCT GATATTGTCTGAAAATGAGTTTGAAATTTTCAAAACATTTCGCCCTTAGG GTTTTGCCTGGGGAAAAAAGAAATTGCCCAAAAAAGGGATGTTCCACCAG TGGGATTTTAGGGGATTTTTTCCTGAGGCATAAGCATCCTATAGAGAAAG TCTGGAGAAAGTTTCAGCTATATATTATTTTTTTCCTGTAAATTTATGCT AAACGACCCCACTATTAGCTTGATCTGGAAATAGTATTTGTTTTAATAAA AAACAAGAGATTATTTTGAAAATTAAAAACTTGACTTTGGAAGTAGCGAT TTTCTAGTTCCAGATTCTGGATTGAAACCTAAAGAGTGTTCAGTTAATGA AATTTTTAGAGTCATTGTACATGTCCATAATGTTTTTATTTCAATTTATT TCCAGCTGAGCGAGCCATTGATACTTTGAACTATGACCCCATCAAAGGAC GTCCGTGCCGTATCATGTGGTCTCAACGTGACCCAACTCTACGAAGATCT GGTGTTGGAAACATTTTCATCAAGAACTTGGATAAGCATATCGATCACAA AGGTCTTTATGATACCTTCAGTGCTTTTGGAAACATTCTCTCATGTAAAA TTGCTGCTGACGACAAAGGTCAATCCAAGGGCTATGGTTTTGTTCATTAT GAAACTAAAGAAGCTGCCCAAGAAGCTATCAGCAAAGTCAACGGCATGAT GTTGAACGACAAGAAAGTGTAAGTGAAACCTTTTCAGAAGCTTAACTTGG ATTAGTGAGTAGCAAGCTATTTCAAACAATTGATGACTTGTTTGGCTGTG TTTGTCTCATATCAAACATGATAATCTTGGAGTGTTCTTGGCTGACCCTT ACTATAATGGTAGTATGTGTATATATAGTATGTATGGGTTTTAATACGAT AATCAGGCTCAGGATTCAATTAAGAACTTTTTTATTGTTTTAGCATAAAA TAATGCAGTCAAAGCCAATAGAGTGCTCAATTGCAAGTAGAGTGATTTTG GTTTCCAAATGTCCTTATTATTCAAAGATATTTTGAATATATGTTTTTAC TATAAGTTTAAGTACTTCAGGTGTACAAACCTTCACAAGCAGAAACTTCC GCAAGATAGAAAAGCTGCAAAATGAATTATATACCCTTTCAAGAATTTTA AAAGACATTAACTTTTGCCAAAACGGCTAAAATCTGTCAAGATCAAGATT TTCTGCTCCCAAAAGTTTGTCACCTTAGCATATTTTTATTGGCCTGTTCA ACTCAAATTAAACTGCTTGACTTACATTCTACTTTAACTTCCGTCTGATT GTTGGCATGGTTTTATCTCTTATTTCACGGTTTCGCTCATCAACTATGAT TTTGATTGTTTACTCATTTCAGCTTTGTGGGAGAATTCATGTGTAAGAAA GAGCGTGTGGACCAGATTGGTGACCAACAAAAGAAATTTAAGAACATCTT TTGCAAGAATTTTGGAAATGAATTTACAAATGACAAACTTTTGGGATTGT TTCAAGAATTTGGAGAAATCACCAGTTGTGTTGTTATGACTGATGAGTCT GGAACAAGCAGAGGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGATGC TGAAAAGGTGAGTATCCATTAAGAGGTCAAGCTATATTCAATTTGAAAAG CTCTCCAATTTTTCTTGGTCCTTTTTCAAGTTTACAAACAAACACTAAAT GGAACTGAATGTTCATTAATTTTCTTTAATTTCCTCAGGGAAAATTTAAT AAATTTCTCAAATACCACCCTTTCGGTGTTTTAGTAGCAAGTTTTTTTGG TATACCACCACATCACTAACAACACGATAGTTTGAGTCACNTCTCATATC AAACATGATAATCTTGGAGTGTTCTTGGCTGACCCTTACTATAATGGTAG TATGTGTATATATAGTATGTATGGGTTTTAATAAGATAATGAATCAGGCT CAGGATTCAATTAAGAACTTTTTTATTGTTTTAGCATAAAATAATGCAGT CAAAGCCAATAGAGTGCTCAATTGCAAGTAGAGTGATTTTGGTTTCCAAA TGTCCTTATTATTCAAAGATATTTTGAATATATGTTTTTACTATAAGTTT AAGTACTTCAGGTGTACAAACCTTCACAAGCAGAAACTTCCGCAAGATAG AAAAGCTGCAAAATGAATTATATACCCTTTCAAGAATTTTAAAAGACATT AACTTTTGCCAAAACGGCTAAAATCTGTCAAGATCAAGATTTTCTGCTCC CAAAAGTTTGTCACCTTAGCATATTTTTATTGGCCTGTTCAACTCAAATT AAACTGCTTGACTTACATTCTACTTTAACTTCCGTCTGATTGTTGGCGTG GTTTTATCTCTTATTTCACGGTTTCGCTCATCAACTATGATTTTGATTGT TTACTCATTTCAGCTTTGTGGGAGAATTCATGTGTAAGAAAGAGCGTGTG GACCAGATTGGTGACCAACAAAAGAAATTTAAGAACATCTTTTGCAAGAA TTTTGGAAATGAATTTACAAATGACAAACTTTTGGGATTGTTTCAAGAAT TTGGAGAAATCACCAGTTGTGTTGTTATGACTGACGAGTCTGGAACAAGC AGAGGCTTTGGTTTTATTGCCTTTGAAAATCATGAAGATGCTGAAAAGGT GAGTATCCATTAAGAGGTAAAGCTATATTCAATTTGAAAAGCTCTCCAAT TTTTCTTGGTCCTTTTTCAAGTTTACAAACAAACACTCAATGGAACTGAA TGTTCATTAATTTTCTTTAATTTCCTCAGGGAAAATTTAATAAATTTCTC AAATACCACCCTTTCGGTGTTTTAGTAGCAAGTTTTTTTGGTATACCACC ACATCACTAACAACACGATAGTTTGAGTCACATTTTAGTACTGTCCACCC CTGTTGAAAATAGGATGAAAATGAATAAACTGATTCTTTTTTCTCTAGGC TTGTGATGAGTTGAACAATAAGGAGATTGATGGAAACAAAATCACTTGTT GCCGTGCTCAAAAAAAAGCTGAAAGATCCATGGAATTGAAAAGCAAATTT GAACAACAAAAGAACGAGAGAATTAGCAGATATCAAGGTATCCAAGCTGA AATCTTTCGAGTGTTGTATCAAGCAGTGTTGAAATCTAGTTTTAAAGACA ACCTTTTAATTGTTATTTAATGAATTCCGCTTCGTAGGCATTTCTGCCTC TTCGAAAAGATCTTCTATAAAGTTGCTTAGAAAAAATTCGTTGTGTTAAC TTCAAAGTTCTCTTCTATCCCGTTTGGCTTCTGGAATCTTTGCATTCTTT CTCTAAGTTAGCCCTTAGATTTGATTTTTTTAAGAATGATTAATTTGTAA AACCGTGAAAGGGTAGTACTGAGATTTTGACAACAATTCATCTTCATCTG TTAATTTTCTTTCTAGGTGTTAACTTGTACATCAAGAATCTGGAAGATGG CATCGACGATGAACGTCTTCGAACTGAATTCTCTCAATTTGGAACCATCA CCAGCGCGAAAGTCATGAAAGACGACAAAGTAAATTCCAAAGGATTTGGT TTCGTTTGTTTTTCGTCTCCTGATGAAGCAACAAAAGCAGTCACAGAAAT GAACGGACGCATCATTGTCACCAAACCCTTGTATGTTGCATTGGCTCAAC GTAAGGAAGAACGTCGTGCACAATTGTCTACTCAGTTTATGCAGAGAGTT GGTCCTCTAAGATATCAACCTGGAGCCGTAAGTTGACTCTTTTCTCCTTT GGAAACTTTCTGCTTGAAACTGAATTGAATATTAATATCCACGAAACTCT TTATACATTATTTGATGTTATATATCAAAACTCATTTAGCATAGAAACAA AACTTAAAAAAAAAAATTTATGTAAAGTTCGCTTGTTTTTGCGTGTACTT TCAAGAATTTAAAATTTAAAATTTCGAGATACAATTAGGGTGCTACAAAG TTTTACGGGATGGTTTTACTAAGCCTCGTTAACGGCTTATCTCTTAAAAC TTATTTTGCCATTATTTTTCAGGGAATGCCTCAGCAACAAGGTTATTCCT TCCAGCCAGGCCAACCAAGCTTCTATATCCCAACGATGCCACAAGGTCAA CGTGCTGCCTTCATTGCTCAACCAGTGAGCCAAATGACCAGACCTCGATG GCAATCAGCAAACGTACGTCAAATGCAAGGTGGATACCCCAACCCTGGAG GAAACGTTCGCGGATCACGACCAAGACACCCCAACTCGGTCCAACCCCGA CGTGAAACACCTTACAATCAGAAATTTCAACAAGGAGGCAATATGCCAAA CCAAGTGATGCGTGCTGGTGGTCCAGTACCAAACCAAAGAGCTCAATACA AATTGAACCAAAATACACGCAATCAATACCCAGCTGGACCAGCACCTCCA GCTGTTGTCCCACAACAAGTTGCTGATCAACCAGCTCCAATGATGCCAGG AGTAAGCTAATATTGTTATTGTAGTTATCTGTTAGTGTTAAATTAGGAAG TGTAAGAACTATTGCGAATCTGACGTTTAGTCTAACCTAATGCGTTGTGC TACTTTGGAAAAATTTCCCTCGTAATTAAACTGCTAGTAACGTTGTGTTT TTGTTTTGTTTTTCAGCAACAAGAGCCATTGACTGCTTCCACTTTGGCTG GAGCCACTCCATCCGAGCAAAAGCAGATGATTGGTGAACGTCTTTTCCCC TTGGTCCAAGAACATCAACCCAAGATGGCCGGCAAGATCACTGGAATGTT GTTGGAGATCGATAATGGTGAATTGTTGAACATGTTGGAAAGTCGTGATT TGTTGAAAGATAAAGTGGGAGAAGCTGTGGCAGTACTTCAAGCTCATCAA GCTAAAGAGGCTCAAACCCAGGCTAAGACTGGTGAACAAGCCTAATTCCC TTCACACCCTAGCGTTGAGCATGCTTTGAATGGACTAAAAGAAAGTTTTA ATGGAAGATTATTTCGGAAAGTTGTGTATGTTTTGATGTTTTTTGAAGCT TTGTTGTTTTGAAAAATTTCTCTGGAGAACGTTTTTCTGCTATTCCGGCG CTGAAGAAATTTAGTTTAACTTTTATTTTTTAGTAAAGAAATACTATATA TGGAAATTTTACAGTATATTGCATAACAGGATTGATTAGGACGGTATTTA TCAGAGGTTTTAAGGATTTTTATCGTTAATGTGAAAGTTATATGAAAGGG TTAACAATGGTTTATGTGTTGATGGATCTTAAAATTTCTCTGTGCCTCTT TTAAAATCTAGTTTGCAATCAATATGTTCTTCTAATTTTCTATGTACACT TTATTTTTTCATTAAAATACATAAAATAAAAACAGACAAAAAACAAAAAG GTCATGTCGACTGTAAACTTTGCATGTTTGTATTTGGTATCGCTTGTGAA CAGTACTGAATCAATCTTCCATTTATTGTAATNTGTTTGTATTTGGTATC GCTTGTGAACAGTACTGAATCAATCTTCCATTTTTTGTAACATTGTAGTA TGGTATTATGTCATGAAAGAAGAATATAGCAGCATGCTTACACTTAACCA AACAATGCGTTTTCTATATTTTTACTTGCCAACTTTATTTGCTATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000108XLOC_000108Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000184-exon-sc0000001-1575043694:1004765..1005215TCONS_00000184-exon-sc0000001-1575043694:1004765..1005215Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:1004423..1004630TCONS_00000184-exon-sc0000001-1575043694:1004423..1004630Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:1001498..1001810TCONS_00000184-exon-sc0000001-1575043694:1001498..1001810Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:1000609..1000843TCONS_00000184-exon-sc0000001-1575043694:1000609..1000843Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:999129..999267TCONS_00000184-exon-sc0000001-1575043694:999129..999267Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:998489..998799TCONS_00000184-exon-sc0000001-1575043694:998489..998799Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:997765..998193TCONS_00000184-exon-sc0000001-1575043694:997765..998193Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1575043694:996620..997599TCONS_00000184-exon-sc0000001-1575043694:996620..997599Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:1004765..1005215TCONS_00000184-exon-sc0000001-1510915933:1004765..1005215Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:1004423..1004630TCONS_00000184-exon-sc0000001-1510915933:1004423..1004630Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:1001498..1001810TCONS_00000184-exon-sc0000001-1510915933:1001498..1001810Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:1000609..1000843TCONS_00000184-exon-sc0000001-1510915933:1000609..1000843Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:999129..999267TCONS_00000184-exon-sc0000001-1510915933:999129..999267Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:998489..998799TCONS_00000184-exon-sc0000001-1510915933:998489..998799Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:997765..998193TCONS_00000184-exon-sc0000001-1510915933:997765..998193Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1510915933:996620..997599TCONS_00000184-exon-sc0000001-1510915933:996620..997599Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:1004765..1005215TCONS_00000184-exon-sc0000001-1491911889:1004765..1005215Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:1004423..1004630TCONS_00000184-exon-sc0000001-1491911889:1004423..1004630Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:1001498..1001810TCONS_00000184-exon-sc0000001-1491911889:1001498..1001810Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:1000609..1000843TCONS_00000184-exon-sc0000001-1491911889:1000609..1000843Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:999129..999267TCONS_00000184-exon-sc0000001-1491911889:999129..999267Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:998489..998799TCONS_00000184-exon-sc0000001-1491911889:998489..998799Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:997765..998193TCONS_00000184-exon-sc0000001-1491911889:997765..998193Clytia hemisphaericaexon
TCONS_00000184-exon-sc0000001-1491911889:996620..997599TCONS_00000184-exon-sc0000001-1491911889:996620..997599Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:996620..1005215 -
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00000184 vs. Swiss-Prot (Human)
Match: PABP1 (Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 384/646 (59.44%), Postives = 465/646 (71.98%), Query Frame = 2
Query:  476 SSANYPIASLYVGDLSPDVTEAMLFEKFSATGPVLSIRVCRDLVTRRSLGYAYVNYQQPADAERAIDTLNYDPIKGRPCRIMWSQRDPTLRRSGVGNIFIKNLDKHIDHKGLYDTFSAFGNILSCKIAADDKGQSKGYGFVHYETKEAAQEAISKVNGMMLNDKKVFVGEFMCKKERVDQIGDQQKKFKNIFCKNFGNEFTNDKLLGLFQEFGEITSCVVMTDESGTSRGFGFIAFENHEDAEKACDELNNKEIDGNKITCCRAQKKAERSMELKSKFEQQKNERISRYQGVNLYIKNLEDGIDDERLRTEFSQFGTITSAKVMKDDKVNSKGFGFVCFSSPDEATKAVTEMNGRIIVTKPLYVALAQRKEERRAQLSTQFMQRVGPLRYQPGAGMPQQQGYSFQPGQPS-FYIPTMPQGQ-RAAFIAQPVSQMTR----PRWQSANVRQMQGGYPNP----GGNVRGSRPRHP-NSVQP-RRETPYNQKFQQGGNMPNQVMRAGGPVPNQRA-----------QYKLNQNTRNQYXXXXXXXXXXXXXXXXXXXXMMPGQQEPLTASTLAGATPSEQKQMIGERLFPLVQEHQPKMAGKITGMLLEIDNGELLNMLESRDLLKDKVGEAVAVLQAHQAKEAQTQA 2344
            S+ +YP+ASLYVGDL PDVTEAML+EKFS  GP+LSIRVCRD++TRRSLGYAYVN+QQPADAERA+DT+N+D IKG+P RIMWSQRDP+LR+SGVGNIFIKNLDK ID+K LYDTFSAFGNILSCK+  D+ G SKGYGFVH+ET+EAA+ AI K+NGM+LND+KVFVG F  +KER  ++G + K+F N++ KNFG +  +++L  LF +FG   S  VMTDESG S+GFGF++FE HEDA+KA DE+N KE++G +I   RAQKK ER  ELK KFEQ K +RI+RYQGVNLY+KNL+DGIDDERLR EFS FGTITSAKVM +    SKGFGFVCFSSP+EATKAVTEMNGRI+ TKPLYVALAQRKEER+A L+ Q+MQR+  +R      +P      +QP  PS +++  +PQ Q RAA+   P SQ+ +    PRW +      QG  P+P     G +R + PR P ++++P   + P     Q+  N   Q M   GP P   A           QYK     RN      A P V  QQ A          QEPLTAS LA A P EQKQM+GERLFPL+Q   P +AGKITGMLLEIDN ELL+MLES + L+ KV EAVAVLQAHQAKEA  +A
Sbjct:    4 SAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGG-RSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-----AVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSPRWTA------QGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM---GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQG-----QEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKA 626          

HSP 2 Score: 168.318 bits (425), Expect = 2.321e-43
Identity = 100/298 (33.56%), Postives = 160/298 (53.69%), Query Frame = 2
Query:  734 DPTLRRSGVGNIFIKNLDKHIDHKGLYDTFSAFGNILSCKIAAD-DKGQSKGYGFVHYETKEAAQEAISKVNGMMLNDKKVFVGEFMCKKERVDQIGDQQKKFKNIFCKNFGNEFTNDKLLGLFQEFGEITSCVVMTDESGTSRGFGFIAFENHEDAEKACDELNNKEIDGNKITCCRAQKKAERSMELKSKFEQQKNERISRYQGVNLYIKNLEDGIDDERLRTEFSQFGTITSAKVMKDDKVNSKGFGFVCFSSPDEATKAVTEMNGRIIVTKPLYVALAQRKEERRAQLSTQFMQ 1624
            +P+     + ++++ +L   +    LY+ FS  G ILS ++  D    +S GY +V+++    A+ A+  +N  ++  K V +       +R   +  ++    NIF KN      N  L   F  FG I SC V+ DE+G S+G+GF+ FE  E AE+A +++N   ++  K+   R + + ER  EL ++ +          +  N+YIKN  + +DDERL+  F +FG   S KVM D+   SKGFGFV F   ++A KAV EMNG+ +  K +YV  AQ+K ER+ +L  +F Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRI----MWSQRDPSL--RKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAK----------EFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
The following BLAST results are available for this feature:
BLAST of TCONS_00000184 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PABP12.321e-4359.44Polyadenylate-binding protein 1 OS=Homo sapiens GN... [more]
back to top