Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000153 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000153
Unique NameTCONS_00000153
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1723

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000153 ID=TCONS_00000153|Name=TCONS_00000153|organism=Clytia hemisphaerica|type=transcript|length=1723bp
GTATTTTGATTACCTCTTTTCCTCCctgtaaaatattgaaattaatgAAT
TGATTGAATATCTCTGTAATTTTGTGTAAATAAGCTTTTCAgggattttc
aaaatatttttgcacaCGGATCATGAGAAAATTACACCAATGAGCTTTTG
TTTTGAACACGAGTGCAAAATCTTGACTATTCTCTTGTTCCTTCCTCATT
TACTGCAAGTCTAGGTCTTGTAAACAACATACATCGACACACCTCCAAGA
AGCAAAATGTCTGACACAACTGGAAAGGTTATTAAATGCAGAGCTACTGT
AGCATGGGGTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACC
CACCAAAAGCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGC
CATACAGATGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCC
AGTTGTACTTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAG
GAGTCACATCAGTAAAACCAGGGGACCATGTCATTCCATTATACATTCCG
CAATGTTACAATTGTAAATTCTGTTTCTCCAACAAGACAAACCTCTGCAG
TAAAGTAAGagCAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTA
GATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACA
TTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCTAAGGTCGATGA
GAAAGCACCATTAgataaagtttgtttactcggaTGTGGTATCACCACTG
GTTATGGCGCCGCTCTTAACACTGCTAAGGTTGAGAAAGGCTCCAATGTT
GCAGTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAA
AAAAGCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCcaacgaaag
aaaaaattgCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGAC
CATGACAGGCCAACTCAACAGGTTTTGGTGGAGATGACAGACGGTGGTTT
AGATTACACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTT
TGGAGGCTTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCT
GCATCAGGACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCG
TGTATGGAAAGGATCTGCTTTCGGAGGATACAAGAGTCGTGACAGCGTAC
CAAAACTCGTCCAAGATTACATGAACGGAGATATGAAGATTGACGAGTTC
ATCACACATCATTTCCCATTGAAAGAAGTCAACGATGCTTTCCATGCCAT
GCACGAAGGAAAAGCcattCGGGCCATtgttaatttgtaaaaatattgga
TGGATATCAGAGGTTGGTTGATAACTTGGTGGTTGTAAATGAAATGGTCA
TATTTGGCGATCTGACCATGtcagtgaaaatatttttaaattcggTTATg
attttgtaatgattttttttaaaccttaCCACATCTCGGTTGCCGTTTgc
ttgtttatgtttttttaagCTAATGTAGATTATGGGAGTATGGTTATTTG
CTCTggaaaatatatgattttgaaaaaatattgaaactctTTGGTTTTGT
ATGTGTATTTCAGAGGACCATAGTTCGCTTTCAGTTCACCTCgcttgatc
tcgcgctccgaaaacaattagaA
Run BLAST on NCBI

protein sequence of Alcool deshydrogenase

>TCONS_00000153-protein ID=TCONS_00000153-protein|Name=Alcool deshydrogenase|organism=Clytia hemisphaerica|type=polypeptide|length=377bp
MSDTTGKVIKCRATVAWGAKEPLKMETIEVDPPKAGEVRMKVLHTGVCHT
DAYTLSGADPEGAFPVVLGHEGGGIVESIGEGVTSVKPGDHVIPLYIPQC
YNCKFCFSNKTNLCSKVRATQGKGLMPDGTVRFHCNGKDLFHFMGCSTFT
EYTVVAEISIAKVDEKAPLDKVCLLGCGITTGYGAALNTAKVEKGSNVAV
WGMGAVGLAVLMGCKKAGAERIIAVDINPTKEKIAREFGATEFFNPKDHD
RPTQQVLVEMTDGGLDYTFECVGNIHTMRAALEACHKGWGESIIIGVAAS
GQEISTRPFQLVTGRVWKGSAFGGYKSRDSVPKLVQDYMNGDMKIDEFIT
HHFPLKEVNDAFHAMHEGKAIRAIVNL
Run BLAST on NCBI

transcript from alignment at sc0000001:346302..354514-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000153 ID=TCONS_00000153|Name=TCONS_00000153|organism=Clytia hemisphaerica|type=transcript|length=8213bp|location=Sequence derived from alignment at sc0000001:346302..354514- (Clytia hemisphaerica)
GTATTTTGATTACCTCTTTTCCTCCCTGTAAAATATTGAAATTAATGAAT TGATTGAATATCTCTGTAATTTTGTGTAAATAAGCTTTTCAGGGATTTTC AAAATATTTTTGCACACGGATCATGAGAAAATTACACCAATGAGCTTTTG TTTTGAACACGAGTGCAAAATCTTGACTATTCTCTTGTTCCTTCCTCATT TACTGCAAGTCTAGGTCTTGTAAACAACATACATCGACACACCTCCAAGA AGCAAAATGTCTGACACAACTGGAAAGGTAAAGTCTTTTTCATTTAATCT TCTTATTATGAATCTTTTTGTTCATTATACCTCCATCCTGTGTTATTCCT TCCACTACACTGTGAAGTTTTTGGACAAGTAATTTCATTTATAAAACAAG GTTACAAGTCTGAGAACTATTGATCCAAGCATTTAATTAGTATCGACTGG TAAAGATTAGGCTTCCATAGTATTCCAAAATGCAAAAAAATAGCACTATT CTAAAGGAATCAGAGTTAAGTTTGGAATACTTGACAAATTGGGATAAAAG TAGACAGTTTTTTTCATTAAACAAGTCGTAACAAGTCTGCCTAGATAATA TATTGTGTTTAAAAAAAATTACCTTTTTTACACTGTACTTTATGTCTGTT ACCGGGAAGGGGTAGGTATCAAAATTTAGCAATCCAAGTCTACAAAAGTC CACTGCGTTATGCCACCTCAGACTTTTCTGTAGACCAATTCAACAATACA ATACTGAAATTGAATGATGCAAAATTTGAATTGCTACGTTATGGCTCAAA TACAGAAATCAAAAATGAATCTCACTATACCTCACCATCAGGAGATAAAA TTTAAGGAAAGGAATATGTTAAAGACCTGGCACTCATTTTCTACACTACT TCAAACTTCTTTGCTGCAGATTAAATTGAAACAGGCTTTACTATTGATAC TAGCTTATACTAGATGTCACCCGCGTTTTTTCTACGCAATTAAGGAATTA ACGTCTATTCCACTTTGTGACATTTTCGAATGTTTGCCCAGGTTTTTCAG GTTTTGGATTTTTTGAGGTCCCATCTAATTTTTGAAGCTCCTGCAGAAGT GAAAAAATTGAATTAACGTCAAAGCAAGCTTCTATTTTTCCAAAATCTTC AAAGTGGAACTCACTAAGAAACATAATGAAATATCCTGTTTTTTGGTGAG GTGCTCGCTATGTTGATACAGTTTCTATTTCTATTTGGTTGAGTCACAGG AGGCTTGGTCAATGACCAATACCACAGCGCCTCAGTTACGGTCAGTTGTC AAGAAAGTTCTCTGAAACAATCAAATAAAAATATTTATGCTGCGAATGAA AATATCCTTATTATTTGAGAGACGAACCAACCTGGCTGCCTAAAAAAATC GTAAAGTTATCTCGCGAACATAGCACCAGTTTGTGAGAAATTCATTTGAC TACATGTATCAGCATGTATTTTGATTTATTTTTGATTCAATACACTACCG TAGAATCGTCTAATATCGACACGCGTCTTCTAAAGTCGACACCGGATCTG TAAAATAATCAAAACAAACCTTGAATGAAATTCTTGGTATCATTCTTATC AAACAAGTTCATCCATCAAACTAGAAGAAGTCCAATAAACATTGCAATCC TTTCAATTAAAAAAACAGCCAAATTATAAGCAGTTTTACACAGCACACGA AGCGCATGCAAACTTCCTCGTAACTTTCTCGTGTCCATCATTAAAATTTT ACAACTTTATTACGCTTCAAGTCACGTGATAAAAATAATTTGCGCGCTTA GCCTGGTTTCCCCTTCCTTATTTATCAAAAACACACGCTTTAGGCGCTAA GAGGCTGCACGCCGTGATGGCCAGTATGGCGGTCACATTAAATTCAAAAG GAAACCAGGTTCTTTTTATTTTTTTCGGTTAACGGTAAAAAGGTCTACTA AAAAATTCCTTGCGTGCAAAATGTTGTTTTGATTTATTTGGATATCTTCG TTCCGTTGAATGACAATGAAAGCATGCTAATTACAAATTAGTTTTTAGTG ACTATATACATATCGTTAAAGTTCTTTTCGAAAAAAAACCACTTCACGTT TCTTACATTTCAACAATCTGTGACGTGATAGGGAGAGTACAATTTAGTGA TTGATTGATAACTTTGGTATGTATTTGTTTATGTTTGATTTTTTATTTCG AAGACCAGCCTATAGCTATGTCGAAATAACAAGACGCATGTCGATATTAA ACGACTCTACGGTATTGCATATGTTTTTTCTACATTTTTTTTACATTCTA GGTTATTAAATGCAGAGCTACTGTAGCATGGGGTGCAAAAGAACCTCTAA AGATGGAAACCATCGAAGTTGACCCACCAAAAGCTGGTGAAGTACGTATG AAAGTTTTACACACTGGTGTTTGCCATACAGATGCTTATACATTAAGCGG TGCTGATCCAGAAGGGGCTTTCCCAGTTGTACTTGGACATGAAGGAGGTG GTATTGTAGAAAGTATCGGAGAAGGAGTCACATCAGTAAAACCAGGTATG AATGATGTTATAAGATTTATGGGTGATATGCTGGGGTGATTGTGTTGGGA AAGTTTTTAAATCCTGTCTCAAATTTGTGTTCATTTTGAAGCTTTGAAGT TTGGTATTTTGAAGAAGAGTGAAAAATGAACTAAATCGATTCGTTATTAT TAAGAATCACCCTAGGAATATTGAATGAAATACTGTTTGGAAATCACTAG ATATATATTTGAAGATTTAAATAAAATTGCTATTGACTTGAACTCTTTAT ATATTGAAGGTTTGGTGTATTATATTTATTCTTGATAAATAGAATAGTCA AATTTCATCTGATTGTAAAACACTTCAGATTTTTTTATCAAAAGATCTGT GTGCAAAATTGAGTTCAAATTACACTCGACATTGTGCAATGAAACAACTT TGATAAACATTAAAATTGAATCATCATTTCTCATAATATGCCTCTAATTG TTGCTTAAATTAATCCTGTTAAGGTTCTTATCTAGCATTATCATTTGAAA TCAGGCATTTTTCATAGACAATTTAATTGTCTACATTAATTAAATATTAA AAACAAAATAATTTATGTCACTGTTAAAATTGAAAATTCTAATTTCCCCT TGCAACTGATAAGGCTAACATCTAGGTAATAGTCAAATTTATAAAGATTG AGGTTTCTTTAGATATGCAAAATGATAAGGCTCAGATAAAGAGTTTCTTT AAATACCATTATCAGCTAAATTTTTTAAACAAATATGCGCTCTGAAAAGT TTCCACTAATTAAATAATTTTTGTTTACCTTTTTCAGGGGACCATGTCAT TCCATTATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACA AGACAAACCTCTGCAGTAAAGTAAGGTGAGTGCCTTTACATGAACAATGT CTTTCTCAGGGGCCTGAGTTCTACTTTAAAAGAGCCTTGTATCGACCAAC ACCAAAATCAGCAGAAGAAATTGCCTTAAATTTTAGAGTACACAAAGCAG GCTCTTCAAGGTACCGGGTGTGCCACAAATAAGTTACCCTCTTTGAATTT ATATTGCAGGCAGTAGAAAAGAGATTTTTCAAATATTGTTTCGGAATCAT TCAGAGGAAAGCCTAACTTAAAATTTGGTTTATTACTTTTTAATTTTTCT TTTTCTTTCGCCTTTTTCTGTCATTTTTTAAAATTGATACTGAGGTTTTT GAACATAACCTTTGAACTAATGAAGCAAAATTAAAAGTAATACACCAAAT TTTAAGTTAGGCTTTCCTCTGAATGATTCCAAAACAATCTTTGAAAAATC TCTTTTCTACTGCCTCCACTATAAATCCAAAGAGGGTAACTTATTTGTGG TACACCGGTATGAAAGAAACTCGAAGCATTTACTTTTTCTTGGAAGCTTT AATAAAATACCAATTTTAAGTCATTAAAATGGCTTTTATATTATTGGGAA GGAAACTGATTTGCTGTTTACCTGAATTTGCTGAGTCGTCACTAAATGGT TTTGATATTTTTTAATTTAGAGCAACACAAGGAAAAGGCCTTATGCCAGA TGGTACAGTTAGATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGG GTTGCAGTACATTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCT AAGGTATATTGTGAATTTTATAGTAGTTCTTGGGTAATATGGGGACATAA AAAACATGTTAGATTCTAAGGATGGCGATAAACCATCGTTGAGCAAAATT GCACTTCTAACATAACTTTTGTTACCACTTTTAAGCTTAATTCTGTACGC TAGTGGTTTTGCTCTTTGAAACAGCCTCTTATAGAGATGAGCAATCTCTT ACTAACATATTCATTACAAACAAAGCTTTTCATCTACTTTTGTAAATAAT TTTTCAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGTTTACTCGGAT GTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGCTAAGGTATTA TACTGAGATTTGTTGTGGATTGTAGCACCTATTGAACTTAATTCCATCAA CTTTTTAGGTTCCACGTTAATATTGTGTCTTTATTTACAAGTACTCACTG ACAAACCCGATCCTTTTTCATTTGACTGCGTGAAAAGGGTTAATAATTAA TGTACCGTTTTCGTAGGATATCACTTTAGGTTTTCAATCGCAGTGTGTGA AATTTTGAAGAATAAAGCAAAGTTACTCATTAAGAATATTGATCCTTGCA AAAGCAAAAACCGATATTTAGAAGTTCTATTTTCTGAGTGCACTAACACA GAAAAGTCTGCAAAAATACACATTCTTTCTTCAATAGAAGTACGTTACGA TATTCCAAATCATAATTCGGGGATCTTAATTTTGTGGATAAACTCGTAGA TTTGAAAAACCATTTTAACCAACCAAATTTTATTAAACATGAAATTTCGA GAAATCTGTTAACTGTACGCAGTTGTACGTAGTACATAAAACTTCTGCAA TTAGTAAAAATATATCATACTAAAGTTTGAAAAAATCAATTTTTAACTCA CTTAATCCAACTTACTTTAATACTACCATAGTCATTATAAAAAACCCCAG TCTGGCAATGTATTGTTTTAGCTTTTTGTTCAATTTAGTTGCTATTTGCA TAATTTGTGATCACGTTACCAAAATCTCCTATTGGGATTGGTCTATTTTC TAATCACATGATCAAAAAGTTTGCAAATAAATCGATTTTGTTCACGTAAG CACCATCTTTTAACAATGAAAAGAGACAAAAGCCTTCCAGACCAGTGCTT TTATAATGACTATAATTCTACCATAGGTTGAGAAAGGCTCCAATGTTGCA GTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAA AGCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAA AAATTGCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCAT GACAGGCCAACTCAACAGGTACACTTTCGATATTTACTTTTGAGGATAGG ATTATATTACCTGTGAAATAAGAATTTCTAACTTAATTCTCTCAGAAGAT TTGGGTGGTAGAGTAGCAGTTACATGTCTGGAAAGCTCTGAAAATTTCAC GTCAGATTTATAACAAAAAAAGATCTTTGATAAAAATTCGAAACGAAGGG TCTACATACCTTAAGGAATTTTCGAGTTATAAAGTAAAGTTTATAAGGGT TATATATACAACTAAAAGGACCATAAAACTTGTTCCAATCAACGAGACAT TCTTTCGAGTAATAGAGGTTCGAGTTAAAGAGACGCCATTTTATAAGATC TTACCGCAATAATAACATAAAAATTTACTTCCTCTTCTTCAGTGTCTTCT CCACTGTACAAGTTCTTACCACAACAAAAAGATAAAATTTCCCCGCCCTC CCCTTTCAGGTTTTGGTGGAGATGACAGACGGTGGTTTAGATTACACTTT CGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTTGGAGGCTTGCC ACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTGCATCAGGACAG GAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGTGTATGGAAAGG ATCTGCTTTCGGAGGTATGCGTCTTTTTTTCGTTTGCCTGGTTGGTGAAA ATAATGTTTTGTCGAGCTTATCTTGTGTTCTTTTAGGTAGAAAATTATTC TGTTACCAAAGAATTTTTCACCAAAGTACCAAAAACTTGCCTTTTTTAAT GAACCTGTCCCTTTTGTAAAAATTTTGGTGGAAATTCAATATTCAATTCC TCACAGGAAAAAATGTAAAGCGAATTACATTAACTTTTGGTGAATTCGCG AAAAGCTGAAGTATTTCAACACATTTCAGCTTTACACTGTAAATGCAGTC TGAAAATTACGATGTTTAAAATGCTTTTAATTTATTATCTTTCTGTGTTT ACTGATATATCTTTTAGGGAAGATCAGATGGTTTGGTCTTCAAACATGTA CATTCCTTCCATATTCCTGAGCAAAATTTCAAATCTTTTTTGTCTTTTCT AAAGTCGAGATAATATGGCAACTTGAAATCTCTGGAATTGGGCTTTGCCT CTCGGCTCTCACGTCAAATCTTATTGCTTTCTTGCTAAAACTCAAAAACT CGAAAGATTTACTCGACTTTGAAATAAGAGTCGAGAAGATTTGGAGGTTT CACTTAGAACCATTAAAATCTTATTTTTTTCATATTCACAGGATACAAGA GTCGTGACAGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATG AAGATTGACGAGTTCATCACACATCATTTCCCATTGGAAGAAGTCAACGA TGCTTTCCATGCCATGCACGAAGGAAAAGCGTGAGTNCACACATCATTTC CCATTGAAAGAAGTCAACGATGCTTTCCATGCCATGCACGAAGGAAAAGC GTGAGTTATTTTCTCATTTGCCAGTACTAAACTCTTCGTCGCTGGCGAAA AATATAGGGCTTGGCCTAAGACATTTTCTCATTTTCTCTGAATTTCCTTT TGAGGTGCTGGTTTTAGAGCTATTGGATATTTTTCATTTTCTTGAAATTC TGTTGTGGTCAAATCCAAAGGGTTTGGCGCAATGAAGTGTAAGCCCGAAG GACTAGAAGTCAATCTCCTTGGTAGGATTTGAAGCCAACAAATCCTACCA AAGTTGCGCGGCCTTGAGCGGTTCTTACACAAATGACAGATTGAAACTAA AATTTACCGCTAAATTTCGAAAAAAATATCAATCGTAAACAAAGGAATTG CTAGATTCAATCTGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNGGTTAGAGATTGAACTCTAGCCCTTCGGGCTTTAAA ATCAATGGTTTGGCGGGAAACATGCCATTTTCGACTAGACTTCAATCTTC AGAAAGCTGTGGCCAAAATCTTACTGAAAGTTTTTCCAAATTTTTGTTCT ACGACTAATTTATAGACGATTCGAAACGTAGCCAGAATCTATGACGGTTC GGTAAAAACCCGCTATTATACGCTGAAAATTAATTTGATGGTTTTTATTT TTTAGCATTCGGGCCATTGTTAATTTGTAAAAATATTGGATGGATATCAG AGGTTGGTTGATAACTTGGTGGTTGTAAATGAAATGGTCATATTTGGCGA TCTGACCATGTCAGTGAAAATATTTTTAAATTCGGTTATGATTTTGTAAT GATTTTTTTTAAACCTTACCACATCTCGGTTGCCGTTTGCTTGTTTATGT TTTTTTAAGCTAATGTAGATTATGGGAGTATGGTTATTTGCTCTGGAAAA TATATGATTTTGAAAAAATATTGAAACTCTTTGGTTTTGTATGTGTATTT CAGAGGACCATAGTTCGCTTTCAGTTCACCTCGCTTGATCTCGCGCTCCG AAAACAATTAGAA

Coding sequence (CDS) from alignment at sc0000001:346302..354514-

>TCONS_00000153 ID=TCONS_00000153|Name=TCONS_00000153|organism=Clytia hemisphaerica|type=CDS|length=11340bp|location=Sequence derived from alignment at sc0000001:346302..354514- (Clytia hemisphaerica)
CATTCGGGCCATTGTTAATTTGTAAATCATTTCCCATTGAAAGAAGTCAA
CGATGCTTTCCATGCCATGCACGAAGGAAAAGCGATACAAGAGTCGTGAC
AGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATGAAGATTGA
CGAGTTCATCACACGTTTTGGTGGAGATGACAGACGGTGGTTTAGATTAC
ACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTTGGAGGC
TTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTGCATCAG
GACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGTGTATGG
AAAGGATCTGCTTTCGGAGGTTGAGAAAGGCTCCAATGTTGCAGTATGGG
GTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAAAGCTGGA
GCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAAAAATTGC
ACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCATGACAGGC
CAACTCAACAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGTTTACTC
GGATGTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGCTAAGAG
CAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTAGATTTCATTGT
AATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACATTTACAGAATA
CACAGTGGTAGCAGAAATTTCTATCGCTAAGGGGACCATGTCATTCCATT
ATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACAAGACAA
ACCTCTGCAGTAAAGTAAGGTTATTAAATGCAGAGCTACTGTAGCATGGG
GTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACCCACCAAAA
GCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGCCATACAGA
TGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCCAGTTGTAC
TTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAGGAGTCACA
TCAGTAAAACCAGATGTCTGACACAACTGGAAAGCATTCGGGCCATTGTT
AATTTGTAAATCATTTCCCATTGAAAGAAGTCAACGATGCTTTCCATGCC
ATGCACGAAGGAAAAGCGATACAAGAGTCGTGACAGCGTACCAAAACTCG
TCCAAGATTACATGAACGGAGATATGAAGATTGACGAGTTCATCACACGT
TTTGGTGGAGATGACAGACGGTGGTTTAGATTACACTTTCGAATGTGTCG
GTAACATTCACACCATGAGAGCAGCTTTGGAGGCTTGCCACAAAGGATGG
GGTGAATCCATCATCATCGGTGTGGCTGCATCAGGACAGGAGATTAGCAC
CAGACCATTCCAATTGGTCACTGGCCGTGTATGGAAAGGATCTGCTTTCG
GAGGTTGAGAAAGGCTCCAATGTTGCAGTATGGGGTATGGGAGCTGTTGG
ATTAGCTGTCCTAATGGGTTGTAAAAAAGCTGGAGCTGAACGTATCATTG
CTGTTGATATCAACCCAACGAAAGAAAAAATTGCACGAGAATTTGGTGCC
ACTGAATTTTTCAACCCTAAAGACCATGACAGGCCAACTCAACAGGTCGA
TGAGAAAGCACCATTAGATAAAGTTTGTTTACTCGGATGTGGTATCACCA
CTGGTTATGGCGCCGCTCTTAACACTGCTAAGAGCAACACAAGGAAAAGG
CCTTATGCCAGATGGTACAGTTAGATTTCATTGTAATGGCAAAGATTTAT
TCCATTTCATGGGTTGCAGTACATTTACAGAATACACAGTGGTAGCAGAA
ATTTCTATCGCTAAGGGGACCATGTCATTCCATTATACATTCCGCAATGT
TACAATTGTAAATTCTGTTTCTCCAACAAGACAAACCTCTGCAGTAAAGT
AAGGTTATTAAATGCAGAGCTACTGTAGCATGGGGTGCAAAAGAACCTCT
AAAGATGGAAACCATCGAAGTTGACCCACCAAAAGCTGGTGAAGTACGTA
TGAAAGTTTTACACACTGGTGTTTGCCATACAGATGCTTATACATTAAGC
GGTGCTGATCCAGAAGGGGCTTTCCCAGTTGTACTTGGACATGAAGGAGG
TGGTATTGTAGAAAGTATCGGAGAAGGAGTCACATCAGTAAAACCAGATG
TCTGACACAACTGGAAAGCATTCGGGCCATTGTTAATTTGTAAATCATTT
CCCATTGAAAGAAGTCAACGATGCTTTCCATGCCATGCACGAAGGAAAAG
CGATACAAGAGTCGTGACAGCGTACCAAAACTCGTCCAAGATTACATGAA
CGGAGATATGAAGATTGACGAGTTCATCACACGTTTTGGTGGAGATGACA
GACGGTGGTTTAGATTACACTTTCGAATGTGTCGGTAACATTCACACCAT
GAGAGCAGCTTTGGAGGCTTGCCACAAAGGATGGGGTGAATCCATCATCA
TCGGTGTGGCTGCATCAGGACAGGAGATTAGCACCAGACCATTCCAATTG
GTCACTGGCCGTGTATGGAAAGGATCTGCTTTCGGAGGTTGAGAAAGGCT
CCAATGTTGCAGTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATG
GGTTGTAAAAAAGCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCC
AACGAAAGAAAAAATTGCACGAGAATTTGGTGCCACTGAATTTTTCAACC
CTAAAGACCATGACAGGCCAACTCAACAGGTCGATGAGAAAGCACCATTA
GATAAAGTTTGTTTACTCGGATGTGGTATCACCACTGGTTATGGCGCCGC
TCTTAACACTGCTAAGAGCAACACAAGGAAAAGGCCTTATGCCAGATGGT
ACAGTTAGATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGGGTTG
CAGTACATTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCTAAGG
GGACCATGTCATTCCATTATACATTCCGCAATGTTACAATTGTAAATTCT
GTTTCTCCAACAAGACAAACCTCTGCAGTAAAGTAAGGTTATTAAATGCA
GAGCTACTGTAGCATGGGGTGCAAAAGAACCTCTAAAGATGGAAACCATC
GAAGTTGACCCACCAAAAGCTGGTGAAGTACGTATGAAAGTTTTACACAC
TGGTGTTTGCCATACAGATGCTTATACATTAAGCGGTGCTGATCCAGAAG
GGGCTTTCCCAGTTGTACTTGGACATGAAGGAGGTGGTATTGTAGAAAGT
ATCGGAGAAGGAGTCACATCAGTAAAACCAGATGTCTGACACAACTGGAA
AGCATTCGGGCCATTGTTAATTTGTAAATCATTTCCCATTGAAAGAAGTC
AACGATGCTTTCCATGCCATGCACGAAGGAAAAGCGATACAAGAGTCGTG
ACAGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATGAAGATT
GACGAGTTCATCACACGTTTTGGTGGAGATGACAGACGGTGGTTTAGATT
ACACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTTGGAG
GCTTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTGCATC
AGGACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGTGTAT
GGAAAGGATCTGCTTTCGGAGGTTGAGAAAGGCTCCAATGTTGCAGTATG
GGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAAAGCTG
GAGCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAAAAATT
GCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCATGACAG
GCCAACTCAACAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGTTTAC
TCGGATGTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGCTAAG
AGCAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTAGATTTCATT
GTAATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACATTTACAGAA
TACACAGTGGTAGCAGAAATTTCTATCGCTAAGGGGACCATGTCATTCCA
TTATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACAAGAC
AAACCTCTGCAGTAAAGTAAGGTTATTAAATGCAGAGCTACTGTAGCATG
GGGTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACCCACCAA
AAGCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGCCATACA
GATGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCCAGTTGT
ACTTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAGGAGTCA
CATCAGTAAAACCAGATGTCTGACACAACTGGAAAGCATTCGGGCCATTG
TTAATTTGTAAATCATTTCCCATTGAAAGAAGTCAACGATGCTTTCCATG
CCATGCACGAAGGAAAAGCGATACAAGAGTCGTGACAGCGTACCAAAACT
CGTCCAAGATTACATGAACGGAGATATGAAGATTGACGAGTTCATCACAC
GTTTTGGTGGAGATGACAGACGGTGGTTTAGATTACACTTTCGAATGTGT
CGGTAACATTCACACCATGAGAGCAGCTTTGGAGGCTTGCCACAAAGGAT
GGGGTGAATCCATCATCATCGGTGTGGCTGCATCAGGACAGGAGATTAGC
ACCAGACCATTCCAATTGGTCACTGGCCGTGTATGGAAAGGATCTGCTTT
CGGAGGTTGAGAAAGGCTCCAATGTTGCAGTATGGGGTATGGGAGCTGTT
GGATTAGCTGTCCTAATGGGTTGTAAAAAAGCTGGAGCTGAACGTATCAT
TGCTGTTGATATCAACCCAACGAAAGAAAAAATTGCACGAGAATTTGGTG
CCACTGAATTTTTCAACCCTAAAGACCATGACAGGCCAACTCAACAGGTC
GATGAGAAAGCACCATTAGATAAAGTTTGTTTACTCGGATGTGGTATCAC
CACTGGTTATGGCGCCGCTCTTAACACTGCTAAGAGCAACACAAGGAAAA
GGCCTTATGCCAGATGGTACAGTTAGATTTCATTGTAATGGCAAAGATTT
ATTCCATTTCATGGGTTGCAGTACATTTACAGAATACACAGTGGTAGCAG
AAATTTCTATCGCTAAGGGGACCATGTCATTCCATTATACATTCCGCAAT
GTTACAATTGTAAATTCTGTTTCTCCAACAAGACAAACCTCTGCAGTAAA
GTAAGGTTATTAAATGCAGAGCTACTGTAGCATGGGGTGCAAAAGAACCT
CTAAAGATGGAAACCATCGAAGTTGACCCACCAAAAGCTGGTGAAGTACG
TATGAAAGTTTTACACACTGGTGTTTGCCATACAGATGCTTATACATTAA
GCGGTGCTGATCCAGAAGGGGCTTTCCCAGTTGTACTTGGACATGAAGGA
GGTGGTATTGTAGAAAGTATCGGAGAAGGAGTCACATCAGTAAAACCAGA
TGTCTGACACAACTGGAAAGCATTCGGGCCATTGTTAATTTGTAAATCAT
TTCCCATTGAAAGAAGTCAACGATGCTTTCCATGCCATGCACGAAGGAAA
AGCGATACAAGAGTCGTGACAGCGTACCAAAACTCGTCCAAGATTACATG
AACGGAGATATGAAGATTGACGAGTTCATCACACGTTTTGGTGGAGATGA
CAGACGGTGGTTTAGATTACACTTTCGAATGTGTCGGTAACATTCACACC
ATGAGAGCAGCTTTGGAGGCTTGCCACAAAGGATGGGGTGAATCCATCAT
CATCGGTGTGGCTGCATCAGGACAGGAGATTAGCACCAGACCATTCCAAT
TGGTCACTGGCCGTGTATGGAAAGGATCTGCTTTCGGAGGTTGAGAAAGG
CTCCAATGTTGCAGTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAA
TGGGTTGTAAAAAAGCTGGAGCTGAACGTATCATTGCTGTTGATATCAAC
CCAACGAAAGAAAAAATTGCACGAGAATTTGGTGCCACTGAATTTTTCAA
CCCTAAAGACCATGACAGGCCAACTCAACAGGTCGATGAGAAAGCACCAT
TAGATAAAGTTTGTTTACTCGGATGTGGTATCACCACTGGTTATGGCGCC
GCTCTTAACACTGCTAAGAGCAACACAAGGAAAAGGCCTTATGCCAGATG
GTACAGTTAGATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGGGT
TGCAGTACATTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCTAA
GGGGACCATGTCATTCCATTATACATTCCGCAATGTTACAATTGTAAATT
CTGTTTCTCCAACAAGACAAACCTCTGCAGTAAAGTAAGGTTATTAAATG
CAGAGCTACTGTAGCATGGGGTGCAAAAGAACCTCTAAAGATGGAAACCA
TCGAAGTTGACCCACCAAAAGCTGGTGAAGTACGTATGAAAGTTTTACAC
ACTGGTGTTTGCCATACAGATGCTTATACATTAAGCGGTGCTGATCCAGA
AGGGGCTTTCCCAGTTGTACTTGGACATGAAGGAGGTGGTATTGTAGAAA
GTATCGGAGAAGGAGTCACATCAGTAAAACCAGATGTCTGACACAACTGG
AAAGCATTCGGGCCATTGTTAATTTGTAAATCATTTCCCATTGAAAGAAG
TCAACGATGCTTTCCATGCCATGCACGAAGGAAAAGCGATACAAGAGTCG
TGACAGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATGAAGA
TTGACGAGTTCATCACACGTTTTGGTGGAGATGACAGACGGTGGTTTAGA
TTACACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTTGG
AGGCTTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTGCA
TCAGGACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGTGT
ATGGAAAGGATCTGCTTTCGGAGGTTGAGAAAGGCTCCAATGTTGCAGTA
TGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAAAGC
TGGAGCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAAAAA
TTGCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCATGAC
AGGCCAACTCAACAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGTTT
ACTCGGATGTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGCTA
AGAGCAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTAGATTTCA
TTGTAATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACATTTACAG
AATACACAGTGGTAGCAGAAATTTCTATCGCTAAGGGGACCATGTCATTC
CATTATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACAAG
ACAAACCTCTGCAGTAAAGTAAGGTTATTAAATGCAGAGCTACTGTAGCA
TGGGGTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACCCACC
AAAAGCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGCCATA
CAGATGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCCAGTT
GTACTTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAGGAGT
CACATCAGTAAAACCAGATGTCTGACACAACTGGAAAGCATTCGGGCCAT
TGTTAATTTGTAAATCATTTCCCATTGAAAGAAGTCAACGATGCTTTCCA
TGCCATGCACGAAGGAAAAGCGATACAAGAGTCGTGACAGCGTACCAAAA
CTCGTCCAAGATTACATGAACGGAGATATGAAGATTGACGAGTTCATCAC
ACGTTTTGGTGGAGATGACAGACGGTGGTTTAGATTACACTTTCGAATGT
GTCGGTAACATTCACACCATGAGAGCAGCTTTGGAGGCTTGCCACAAAGG
ATGGGGTGAATCCATCATCATCGGTGTGGCTGCATCAGGACAGGAGATTA
GCACCAGACCATTCCAATTGGTCACTGGCCGTGTATGGAAAGGATCTGCT
TTCGGAGGTTGAGAAAGGCTCCAATGTTGCAGTATGGGGTATGGGAGCTG
TTGGATTAGCTGTCCTAATGGGTTGTAAAAAAGCTGGAGCTGAACGTATC
ATTGCTGTTGATATCAACCCAACGAAAGAAAAAATTGCACGAGAATTTGG
TGCCACTGAATTTTTCAACCCTAAAGACCATGACAGGCCAACTCAACAGG
TCGATGAGAAAGCACCATTAGATAAAGTTTGTTTACTCGGATGTGGTATC
ACCACTGGTTATGGCGCCGCTCTTAACACTGCTAAGAGCAACACAAGGAA
AAGGCCTTATGCCAGATGGTACAGTTAGATTTCATTGTAATGGCAAAGAT
TTATTCCATTTCATGGGTTGCAGTACATTTACAGAATACACAGTGGTAGC
AGAAATTTCTATCGCTAAGGGGACCATGTCATTCCATTATACATTCCGCA
ATGTTACAATTGTAAATTCTGTTTCTCCAACAAGACAAACCTCTGCAGTA
AAGTAAGGTTATTAAATGCAGAGCTACTGTAGCATGGGGTGCAAAAGAAC
CTCTAAAGATGGAAACCATCGAAGTTGACCCACCAAAAGCTGGTGAAGTA
CGTATGAAAGTTTTACACACTGGTGTTTGCCATACAGATGCTTATACATT
AAGCGGTGCTGATCCAGAAGGGGCTTTCCCAGTTGTACTTGGACATGAAG
GAGGTGGTATTGTAGAAAGTATCGGAGAAGGAGTCACATCAGTAAAACCA
GATGTCTGACACAACTGGAAAGCATTCGGGCCATTGTTAATTTGTAAATC
ATTTCCCATTGAAAGAAGTCAACGATGCTTTCCATGCCATGCACGAAGGA
AAAGCGATACAAGAGTCGTGACAGCGTACCAAAACTCGTCCAAGATTACA
TGAACGGAGATATGAAGATTGACGAGTTCATCACACGTTTTGGTGGAGAT
GACAGACGGTGGTTTAGATTACACTTTCGAATGTGTCGGTAACATTCACA
CCATGAGAGCAGCTTTGGAGGCTTGCCACAAAGGATGGGGTGAATCCATC
ATCATCGGTGTGGCTGCATCAGGACAGGAGATTAGCACCAGACCATTCCA
ATTGGTCACTGGCCGTGTATGGAAAGGATCTGCTTTCGGAGGTTGAGAAA
GGCTCCAATGTTGCAGTATGGGGTATGGGAGCTGTTGGATTAGCTGTCCT
AATGGGTTGTAAAAAAGCTGGAGCTGAACGTATCATTGCTGTTGATATCA
ACCCAACGAAAGAAAAAATTGCACGAGAATTTGGTGCCACTGAATTTTTC
AACCCTAAAGACCATGACAGGCCAACTCAACAGGTCGATGAGAAAGCACC
ATTAGATAAAGTTTGTTTACTCGGATGTGGTATCACCACTGGTTATGGCG
CCGCTCTTAACACTGCTAAGAGCAACACAAGGAAAAGGCCTTATGCCAGA
TGGTACAGTTAGATTTCATTGTAATGGCAAAGATTTATTCCATTTCATGG
GTTGCAGTACATTTACAGAATACACAGTGGTAGCAGAAATTTCTATCGCT
AAGGGGACCATGTCATTCCATTATACATTCCGCAATGTTACAATTGTAAA
TTCTGTTTCTCCAACAAGACAAACCTCTGCAGTAAAGTAAGGTTATTAAA
TGCAGAGCTACTGTAGCATGGGGTGCAAAAGAACCTCTAAAGATGGAAAC
CATCGAAGTTGACCCACCAAAAGCTGGTGAAGTACGTATGAAAGTTTTAC
ACACTGGTGTTTGCCATACAGATGCTTATACATTAAGCGGTGCTGATCCA
GAAGGGGCTTTCCCAGTTGTACTTGGACATGAAGGAGGTGGTATTGTAGA
AAGTATCGGAGAAGGAGTCACATCAGTAAAACCAGATGTCTGACACAACT
GGAAAGCATTCGGGCCATTGTTAATTTGTAAATCATTTCCCATTGAAAGA
AGTCAACGATGCTTTCCATGCCATGCACGAAGGAAAAGCGATACAAGAGT
CGTGACAGCGTACCAAAACTCGTCCAAGATTACATGAACGGAGATATGAA
GATTGACGAGTTCATCACACGTTTTGGTGGAGATGACAGACGGTGGTTTA
GATTACACTTTCGAATGTGTCGGTAACATTCACACCATGAGAGCAGCTTT
GGAGGCTTGCCACAAAGGATGGGGTGAATCCATCATCATCGGTGTGGCTG
CATCAGGACAGGAGATTAGCACCAGACCATTCCAATTGGTCACTGGCCGT
GTATGGAAAGGATCTGCTTTCGGAGGTTGAGAAAGGCTCCAATGTTGCAG
TATGGGGTATGGGAGCTGTTGGATTAGCTGTCCTAATGGGTTGTAAAAAA
GCTGGAGCTGAACGTATCATTGCTGTTGATATCAACCCAACGAAAGAAAA
AATTGCACGAGAATTTGGTGCCACTGAATTTTTCAACCCTAAAGACCATG
ACAGGCCAACTCAACAGGTCGATGAGAAAGCACCATTAGATAAAGTTTGT
TTACTCGGATGTGGTATCACCACTGGTTATGGCGCCGCTCTTAACACTGC
TAAGAGCAACACAAGGAAAAGGCCTTATGCCAGATGGTACAGTTAGATTT
CATTGTAATGGCAAAGATTTATTCCATTTCATGGGTTGCAGTACATTTAC
AGAATACACAGTGGTAGCAGAAATTTCTATCGCTAAGGGGACCATGTCAT
TCCATTATACATTCCGCAATGTTACAATTGTAAATTCTGTTTCTCCAACA
AGACAAACCTCTGCAGTAAAGTAAGGTTATTAAATGCAGAGCTACTGTAG
CATGGGGTGCAAAAGAACCTCTAAAGATGGAAACCATCGAAGTTGACCCA
CCAAAAGCTGGTGAAGTACGTATGAAAGTTTTACACACTGGTGTTTGCCA
TACAGATGCTTATACATTAAGCGGTGCTGATCCAGAAGGGGCTTTCCCAG
TTGTACTTGGACATGAAGGAGGTGGTATTGTAGAAAGTATCGGAGAAGGA
GTCACATCAGTAAAACCAGATGTCTGACACAACTGGAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000088XLOC_000088Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Alcool deshydrogenaseTCONS_00000153-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000153-exon-sc0000001-1575043694:354238..354514TCONS_00000153-exon-sc0000001-1575043694:354238..354514Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:351970..352213TCONS_00000153-exon-sc0000001-1575043694:351970..352213Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:351090..351177TCONS_00000153-exon-sc0000001-1575043694:351090..351177Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:350312..350444TCONS_00000153-exon-sc0000001-1575043694:350312..350444Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:349971..350057TCONS_00000153-exon-sc0000001-1575043694:349971..350057Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:348947..349138TCONS_00000153-exon-sc0000001-1575043694:348947..349138Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:348301..348505TCONS_00000153-exon-sc0000001-1575043694:348301..348505Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:347593..347673TCONS_00000153-exon-sc0000001-1575043694:347593..347673Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:347465..347522TCONS_00000153-exon-sc0000001-1575043694:347465..347522Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1575043694:346302..346659TCONS_00000153-exon-sc0000001-1575043694:346302..346659Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:354238..354514TCONS_00000153-exon-sc0000001-1510915933:354238..354514Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:351970..352213TCONS_00000153-exon-sc0000001-1510915933:351970..352213Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:351090..351177TCONS_00000153-exon-sc0000001-1510915933:351090..351177Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:350312..350444TCONS_00000153-exon-sc0000001-1510915933:350312..350444Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:349971..350057TCONS_00000153-exon-sc0000001-1510915933:349971..350057Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:348947..349138TCONS_00000153-exon-sc0000001-1510915933:348947..349138Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:348301..348505TCONS_00000153-exon-sc0000001-1510915933:348301..348505Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:347593..347673TCONS_00000153-exon-sc0000001-1510915933:347593..347673Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:347465..347522TCONS_00000153-exon-sc0000001-1510915933:347465..347522Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1510915933:346302..346659TCONS_00000153-exon-sc0000001-1510915933:346302..346659Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:354238..354514TCONS_00000153-exon-sc0000001-1491911889:354238..354514Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:351970..352213TCONS_00000153-exon-sc0000001-1491911889:351970..352213Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:351090..351177TCONS_00000153-exon-sc0000001-1491911889:351090..351177Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:350312..350444TCONS_00000153-exon-sc0000001-1491911889:350312..350444Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:349971..350057TCONS_00000153-exon-sc0000001-1491911889:349971..350057Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:348947..349138TCONS_00000153-exon-sc0000001-1491911889:348947..349138Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:348301..348505TCONS_00000153-exon-sc0000001-1491911889:348301..348505Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:347593..347673TCONS_00000153-exon-sc0000001-1491911889:347593..347673Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:347465..347522TCONS_00000153-exon-sc0000001-1491911889:347465..347522Clytia hemisphaericaexon
TCONS_00000153-exon-sc0000001-1491911889:346302..346659TCONS_00000153-exon-sc0000001-1491911889:346302..346659Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:346302..354514 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
613.866 594.743 1056.65 1136.18 68.8899 54.9372 219.699 226.51 313.423 286.907 282.422 358.466 559.959 642.439 334.951 256.97 111.192 203.776 300.435 240.503 128.833 236.829 373.382 385.663 275.291 263.362 286.163 469.797 233.17 258.153
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013149ADH_C
IPR014183ADH_3
IPR013154ADH_N
IPR002328ADH_Zn_CS
IPR011032GroES-like
IPR016040NAD(P)-bd_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006069ethanol oxidation
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0051903S-(hydroxymethyl)glutathione dehydrogenase activity
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006069 ethanol oxidation
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0051903 S-(hydroxymethyl)glutathione dehydrogenase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00000153 vs. Swiss-Prot (Human)
Match: ADHX (Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4)

HSP 1 Score: 502.671 bits (1293), Expect = 2.702e-174
Identity = 257/371 (69.27%), Postives = 308/371 (83.02%), Query Frame = 2
Query:  275 KVIKCRATVAWGAKEPLKMETIEVDPPKAGEVRMKVLHTGVCHTDAYTLSGADPEGAFPVVLXXXXXXXXXXXXXXXTSVKPGDHVIPLYIPQCYNCKFCFSNKTNLCSKVRATQGKGLMPDGTVRFHCNGKDLFHFMGCSTFTEYTVVAEISIAKVDEKAPLDKVCLLGCGITTGYGAALNTAKVEKGSNVAVWGMGAVGLAVLMGCKKAGAERIIAVDINPTKEKIAREFGATEFFNPKDHDRPTQQVLVEMTDGGLDYTFECVGNIHTMRAALEACHKGWGESIIIGVAASGQEISTRPFQLVTGRVWKGSAFGGYKSRDSVPKLVQDYMNGDMKIDEFITHHFPLKEVNDAFHAMHEGKAIRAIVNL 1387
            +VIKC+A VAW A +PL +E IEV PPKA EVR+K++ T VCHTDAYTLSGADPEG FPV+LGHEG GIVES+GEGVT +K GD VIPLYIPQC  CKFC + KTNLC K+R TQGKGLMPDGT RF C GK + H+MG STF+EYTVVA+IS+AK+D  APLDKVCLLGCGI+TGYGAA+NTAK+E GS  AV+G+G VGLAV+MGCK AGA RII VDIN  K   A+EFGATE  NP+D  +P Q+VL+EMTDGG+DY+FEC+GN+  MRAALEACHKGWG S+++GVAASG+EI+TRPFQLVTGR WKG+AFGG+KS +SVPKLV +YM+  +K+DEF+TH+    E+N AF  MH GK+IR +V +
Sbjct:    4 EVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000153 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ADHX2.702e-17469.27Alcohol dehydrogenase class-3 OS=Homo sapiens GN=A... [more]
back to top