Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000147 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000147
Unique NameTCONS_00000147
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1858

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000147 ID=TCONS_00000147|Name=TCONS_00000147|organism=Clytia hemisphaerica|type=transcript|length=1858bp
TCCCGTAAAAAGTGTCGTCCCTGCTAAACAGAACGAGTGGAACAAGCAAA
TGAATAAGTTGTATACTCGATTCAGAGTTATTATATCGATAAAACCATTG
AGAAGTTTTACCATTGatttacTCAAATTATGTTCATACAATCCAATAAT
GTAACCTAGAACCACTACAATCTCCTTTTGAACCTGAAATACCGTAGCTA
AAGCGCCATTATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGATT
TGCCTAGCAACGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCC
ATTTATGTATCTGGTTTCATCtgcattctgattggtcgaaTCTTTTGGaa
agtcattaaaaaatggcaatTTAAATTACCGGAAGACGAAAAAGATTCAC
GGAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTC
GCTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGGTGGT
GACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCATATCTATTTATTT
CATACGAATTCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGA
ATTCACACGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGC
TTTCCATTTCCTTCTCAGGTTTATCATAGCGACAGACAAATTGGCGTTTT
GGGGGTTAAACATTTACACGTTAGTCGATATATTGACCATTCCAATCGTC
ATCATTCAAGCATTGCAACAAAAAGCATGGCTTGGATTGAGATTTCTACG
TGTAGTATACATACGAAAATTGCCAGATATTCTCATCTACTTAAATTTAT
TAGAAACGGgGAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATG
ACAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGTTGAGAATACAGG
TGATTTTTGGGCACCACACAATTATTCGAATAGTAATCCACtcaattatt
ttgaatgtcTGTACTTCATGATAgTGACATTTTCGACGGTGGGTTACGGT
GACTATTCATGTAAAACAATCATGGGACGCATCTTCTGCATGATTTTCAT
CATCTGTGGACTGGGTGTATTTGCATCTTCTATACCGGCCATATTTGGCT
TCATCTCATCGTACACAAAATATGACAGAAAATTCAAAAGTACACCTGGA
AAAAAGCATGTCATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTC
atttattcaagattttttacatCCTGACCGGCAATGTGAAAGCAATGTTA
CTGTTGTCTTCCTTGCACCGAACTATCCGAGTACACTAATTGAAGGAATC
ATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAA
TCTTAAAGATTGTCATCGAGTTAAAATGAGTGAAGCAGACGCTGTCATTG
TTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAAT
ATCACAAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCACATCCG
ATGTATCGTACAACTTATGCGTCGAGATAATAAGGCATTACTAGAAAATA
CGACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAG
CTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAAC
GCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAAAAAACAAAGGAA
AGAAATCAAACACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAA
ATTTACTCCACCACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAA
AGCTGCAG
Run BLAST on NCBI

protein sequence of TCONS_00000147-protein

>TCONS_00000147-protein ID=TCONS_00000147-protein|Name=TCONS_00000147-protein|organism=Clytia hemisphaerica|type=polypeptide|length=549bp
MDSTLANCSVTIDLPSNERSWYVYILASLAIYVSGFICILIGRIFWKVIK
KWQFKLPEDEKDSRKPMEEYKAWYLQLKEFAVNLDTGKSVLGKCLVVTSF
VLNMAAFISYLFISYEFPIEYCDKHDFAHGIHTQIWLLELCLYSFFAFHF
LLRFIIATDKLAFWGLNIYTLVDILTIPIVIIQALQQKAWLGLRFLRVVY
IRKLPDILIYLNLLETGKFIEIGTVVVNFMTVVLSSTGMIHLVENTGDFW
APHNYSNSNPLNYFECLYFMIVTFSTVGYGDYSCKTIMGRIFCMIFIICG
LGVFASSIPAIFGFISSYTKYDRKFKSTPGKKHVIVTGHITDESVSSFIQ
DFLHPDRQCESNVTVVFLAPNYPSTLIEGIIQKHPSSVFFFNGTVYNLKD
CHRVKMSEADAVIVLCDKKSHNPESEDAANITRVVSMKKYFSKYHIRCIV
QLMRRDNKALLENTTHWRKGEGDTIVCIDELKYGFMAQCCYSPGFSTLLA
NLFVMRSSEKNKGKKSNTWRNEYVHGVSCEIYSTTLSDYFENMSFPKAA
Run BLAST on NCBI

transcript from alignment at sc0000001:224278..250162-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000147 ID=TCONS_00000147|Name=TCONS_00000147|organism=Clytia hemisphaerica|type=transcript|length=25885bp|location=Sequence derived from alignment at sc0000001:224278..250162- (Clytia hemisphaerica)
TCCCGTAAAAAGTGTCGTCCCTGCTAAACAGAACGAGTGGAACAAGCAAA TGAATAAGTTGTATACTCGATTCAGAGTTATTATATCGATAAAACCATTG AGAAGTTTTACCATTGGTGGGTATTAGAGGCTACTTTTTCACACCTACAG ATTATAATTAAAGGAATTTTACTTTATTTGCCAATTTTCCAGCAGAGAGG GGGCCCGGTTGCGGGAGAAGAGAAAGGAGAATGAACTCCATGCCTACAAA CTTTTTTTTATCACATAATTCCTTATAAACCTACACAGCCACGAAATGAA ATTTCTTTGTTTTGAAACTTTTGCGGTTTTTCTTAATCTCCCTATTCATA GAGAATGTTGATATTCGGAAAAATTGGATTAAATGAAAATCCCATTCTCT TTTGTTCTGTGTCTAATCTTGTTCCAAAAAAAATATGTCTTAATCCATAT TTGTTTTTTTGCTCCCGTTTTTCTTACTTGCTAGGCTGTTTTTGGGAATA TTCTATCAAAGTATCAAACAGAGGATAATATTTGCTGTAGATAATTATTT TCTTGGACGTTTTCTTTTTTTAATATCAACAATTTCGACCGATGGTTTCT CTGAAAATTATGTAATAGGGTTATATGGTGTAGTTGCTGATCTGGGGTTT AGCCTTATTGTTTTGCCTTAACTTTCTTGAAAACCTCTGTACAGCGTTGA CTTTGGGGGATTCGGTAAGCGGCGTGAGAAAAATCAAAACAAAACAACCG AAAAGAACTGACTTTGGGAGAAACTGACTTCCCAGCTGGCACACAACGTT GTTTTAACGTTCAAATAACGTTATTTGGACGTTATGAATGTCACATGAAC GTTGTTTTGACGTTGTGTGCTGTCTGGGTTGGGATTCATGGGGAAAAACG CAACAAAATATTTTCAAATAAACTTTTTCTTTGGAGTTCTTCCATAAAAG ACACTAAAATCAAACTCATAAAATATTTCTTGAATTGCACTCGAAGTCAT GTGATAACTAGTACTTATTGCCGACCCAAAAAAATATCATTGTTTTGATT GGTCGGCAATAATTAATCTTAAAAAAGAGTAAAGACCAAATAAACTGGTT GTTTTCAGCCTTTATTTAGAGTTTGTTGGTAGTTTATAAGAAACAATCAC CATCCGCTCCGTTGTGTTGTGGGTAATTAACAGTGAAGTTAAAATATCGG TGTCTTGGTTACGTGGACTGTACAAGTCTGAGACAAGATTCTCTCTGAAA GTTAAACCAACAATTCTATTGTAGCAGCATAGAAATCTCTGGTAGCAGCA AGGCTTGTAAAACAGTACGCTGATGTTTATATACCCTGGAATAGAATTTT CTTCGTGTCTCTCACGGTAAACGGAGGGGTTTTCGTCTTCCGTTATTCAT CACTGACCTTAATATACCCTGGACCAAGCTTCTCAATCCCGGCCAAGTAA AACCTTTGATCGGAGTTTTTTGAAAAGTGGTACCCTAATGGCGGCACTAC TCAATAGCGGTGTAAATGCATGGAGAGCGATAGGTCCCCTCAAATACTTT TGACAATGTAGCGCCGTTTGACGTTAATTTTTGCCACCGGAATGGCTTCT TTACGGGTATCCCTTTAAAAATAAACTTCGATCAAAGATGGTGGATATAG CTTGGTCCAGGGATATATAAAGGTCAGTGATGAATAACGGAAGACGAAAA CCCCTACGTTTACCGTGAGAGACACGAAGAAAATTCTATTCAGCATTCAT CCAAGATCTTTGGTTACTCAAGGTACTGGTGCAATGGTGTCACGAGTAGT CAAACAGTACTTTAATTTCAACTGAAGTGCAAATTTTACATTGAATATCG AATGGGGTTGAAATTGTATGGTATTTTGTTTCCTGATGGGGACCAAATTT TTTGCAAAATTTTCTAGTTGGGCTGGGGTCCCCGGGTCTGTGACACAGGG CTGTACAAACAATCCAGCTATTTCAGGCATCGCGATTGAAACGATTAATT CCAATTTAATCTCTTGATCTTATTAAAGACTTAAAACTAAGTAACAAATT AAAAGGCAATTTAGCTTTTAAAAAGATTGAAATACCACAGATGATTGGCA ATGAATAGGTTTAATATTGAGGTTTACATACATGTCCATATATGACAGAT TCTTTGTCAAAAAATCCCTCCTTTCTGTTATTCTTTATGGATCTACTATC TATAGAAATGATACTATCTTGTTTCTTTTATTAAGGGTACAGTAATAGAC GACACCTCAATATTAAATTTTGTGGTTACATTTCGTGTTTCAGTCTCAAG TTTCAGACTTTGAATTACATTGGGTTTAAACTTCGTTGAAGTAACGTAGT AAAAACTATTGCTTTTCGTTGGATCTTAGATCTTAGAAGCCATTTAGATA GGTTTAGCCAAATCAAACATTGATTACTCTAAGGTCCCGAATAATAGGGG GGTCTGAACAAAAGGGGGGATCCGAAATTTTTGCAAAATATAATAAACGG GAGGGTCTGAATGAACGGGGAGGCCTGAAAATATTCCATACACTTTCCTT TAGAACTTTCCTTTATATTAACGTTCGAAATAGATTAAGCCTGATTTACA CTTCAACTCAAAAACAAAAAAACTGGAAGGTTAATAAACGGTAGGGGGGT CCTAATAAGAACGGGGGGGGGGGCCCAAAAATTTTCGAAAATTAATAAGC GGGGGGGGACGTCTATTCGGGACCTTAGAGTACTAACGAAAGGGCTCAAA AAGTCAGGTGGGGCTGTTGAGAGTAGATCTAACATTGAATCTACAATCAG TATCGAAATATATTGGCAATTTTGGGTATTTTAACGTTTCTCAGAATTTA AAGCTCGGGTGAGAATTGCAATTTCAAAACTTCCACTTTGTTTCAGGAGA TTCTTCGATTTGAAGGGGCTAAGTGGCTTCCAGGCTATGTTCTCAGCCAT ATTGGAAAATTAGCTTTTAAATCTTGTGATCTTGTGATCCCAGTACCGTT AAAACTCAGAGTTTTACTTTCTAACCGTACTTTAAAACACTTAATAATCA CTTGCAGTTTTAAAGTTTTGAGGGAATTTTTGTGCCAAATATTTCAGCGC CGATTGTAGTTAGTTAAATGTTAAAATGTTTATGATAGCAAAGTATTTTA TTTACTTCAATTGCCTTGGTGAACTTCTAAGAAATATTTTGGTGCTTCAA AGAATGAATAAAGCTTGAGTAGAGGCGATCAGTCTTGTCCAGTATCACGT AGCATTTTACCGAACAACTACCGGTATGGTCGGTGTACGTAATTCCATTT ACCGGTACTTGTCGGGAAGGTGAACCGTTATTTAAGGTTTACGTTTCCGG TATGCCGATATTTGACAAATGGATTATTAGGCTACTGACAACCATTGACG GATTCATGCTCCTTATAGTCTGAATCACAGACCTCTACAAAACCGCAGCA CGAATCTTTTAGCGGATACTAGCCCGGGGTCTACTTACAGCTTTTTTATA GACTGGATGGCGTGATTCGGTGGCCCAGTATCATATGGTGATATGCTTTT GCTTACAGTCTGCCAGATTTTAGGCGTTTTTAGAAGATAAAATTAGGATG AAGCAATGTTTTTATTTGAAAATAAGGGATTTGAAATCTGTTATTGATTT TTTTTTTCTCATTCAGAATTATATTTTTCAACTCCAAGTAGTTTTTTTGT TATTTTGATTTTTAACATTTTCTTTTAAAAATGGCGACTTCTTCAAGTAC TTCACTGGACTCGACGTCATCAAAAATTATCAAAAAGCAAAGTTCAGACA GAAGTAGACTCTAGTCTAAGTAGCATTGTCAACGATACCAAAAGGATTTA CGTTGTTTACGTCATGATTTTTTACAGATTTCAAACACAAACAAGCCATA AACATGCTACACGTTTTTTTTATAAGAGCATCCAAAATCTTTGAAGTGTT TGGATTTTCTAGACCTGTTGAGCTTTTTTAAGCTAAAAGTGTTCTCATCG TGTATTTTTAGTTTTCTGTCCATTCGCGTGTTTTAGAGTCCGAAAAGTCA CGAAATGTTCTTAACCCTTTGAGTGCCAGGGTCCTTTTTTCTAAGTTTTT TTTAAAAAATCGCTAGTTCAAACTTTAAGGACTTATATCTCCTGATCTAG AAGGAATTAGAAGCTCGTCTATAGCTCGTTGGATAGCTTAGAGTCTCTTC TTTCTTTTGGGTGCCTTCGGCGCCGCCCGATTTAGGAAGGGCGTGGTGGG CGGCGGCCAAGGGGGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTTTTTT GCTTGACCATAAAGGACAATCTAATTCCTACGAGTTCGACCAAAAATAAC GATTTCTAACTCAAACTGGGCATTACAGGAGGGCTTCGCCCTCCTTTATA GCCCATGTCGTATATATACGACATCGGCACTTAAAGGGTTAATGTGTTCT TCATATCAAGAAACTTAAATAAAACTTCCTTGTTTATATTTTGGCCATCG AAATCTTATGTTCTTATATAGTTTGTTCTTACATAAAAAAATGTGTAGCA GATATCGACGTAACAAAAATACTGTTAAAAGGTTAAAGAGAAGTGATGCT ATCTATGTCTAAATAACTGTTCATTAAGTGTGATTTAAAACGGTCCTTAA CCTTTACCATTTAGATACTTTAAGTTTTTCAGAAGTTTTTCTTAATATTA TGTCAACCGATTACTTTGAATCGATGACGAATCTTAACTTTGATTACGGC GCTAATTCATTTAAGAATCGAATATCTCTGCCCAGCTGGCACACAACGTC GTTTCAACGTTTATCTAACGTTCACAACGTCCATATAACGTTAGATGAAC GTTGAAACAATAACGTTATGTGCCAGCTGGGTGTAATTCGAACAAATTAT ATTTCCCGTTTGGGTTTGAATTGGCGAGAGTCACAGCAATTGAAACTTTA GTATGAGAACTTTGGTTTATGTTTTGGATATGAATTTTAGACTATCAGGA GGCCAGTCAACCTTGGGACGATATCACGCAGGAAAAGTGAGCGTAGTAGT TAGGTACGCGTAGAAGGAAAATTTTTACGACGGGTGGTAGGGGCTGAAGG TTTTGCTTTTATTTCCTCATGATCACTTTCTTTTATCGTTAATTCTTTAC AATAATCAAATTTTTTACTATGTTCTATCAAAAGTTTCATATCAAAGAAA ATTTATGAAAATTTCCGGATAGACATTTTCGTTTAGGATCGGTATTTCTC GTTACCTTGTTTAATTCCTAAGAAAAAAACGAGGTAATCTTAGCTAATGA AAAATCTGGTAAGTGTACGATATTAGTCCATTTCTATCTATTCTTTTCCG AATCTAGACTGACACGCCAGTNGATATATGTCCATTTCTATCTATTCTTT TCCGAATCTAGACTGGCACGCCAGTCGGGCTGGAGTAGTATGACGCGGGA AAAGTGAGCGTAGGAGTTAGGTAAGCATTTTTTATTTAGGTAAGAAGTTT TTTCGGCAGCAAGGGCTGAGAATTAATCAGCAGCCTTTCATTAATTCCTT ATCAGTGTGACTGTTGAGTGATGAGTAGCTTAAACCTAGCCTAGTGGGGA ATCCAAAAATGCGTTTTTGATGATAGTCGAAATACCCGAAAATAGTGATA AGATACCCTAAACATAAACAAGGGGAAACAATGAAAAGGAGACAAATGTA TAATTGTGAAATGAGATATCTTGACTATAAAATGAAACGTAAGAAAGTGT GTTGGTTTTGGCGTGACATTTGGGGATGCATCGAGAGATGAATCTTCTTA AAGCCTATAACCGCGGACGGTTGTGAAGACCGCAACGAGAGCCGGAGGCG TGACGTGGGTCTGAGCCTGATCTGATCTTATGTAATAGAGCTAGATGGGG TTTACGTAGTAACCCGCACCCCCCCCCTTTAAACTGTAAGTGCTAAAGGT TCTAGCCCTCAAACTGTAAGTACTAAAAAGTTCTAGCCCTCAAACTGTAA GTGCTAAAAAGTTCTAGCCCTTAAACTGTAAGTACTAAAAAGTTCTAGCC CTTAAATTGCAAGTACTAAAAAGTTCTAGCCCTTAAATTGCAAGTACTAA AAAGTTCTAGCCCTTAAATTGTAAGTACTAAAAGGTCCTAGCCTAGAAAT AAAAAACTTAAGCCTTACAACAAGAGCCGGAGCTGTGATATGTTGTTTAA CCCCAAAGAGTGCAACGAGAGCCGGAGGCCGTGACGCTGTTCTAAGAGGA GTAATCAAAGAAAAAAGATAAAAAAAATAGAAACCTTAGCCTATAACGAG AGCCGGAGCCTCCCGTGTGACGTTGCTGAAAGGAGTAAAAGAAAAAAAGA ACAAAAGCCTACAACAAGAGCCGGAGCTGTGATATGTTGTTTAACCCCAA AGAGTGCAACGAGAGCCGGAAGCCGTGACGCTGTTCTAAGAGGAGTAATC AAAGAAAAAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCGGTCTCGGCATTCC TGCTGAACCGCTCTTCCGATCTAAAATAGAAGAGAAAAAAAAAACAGCGA AAGGAAATAAGTACAAGTAAAAGGCGCATAGGAATAAATAAGGGTGTCAG GGAGGGTGGGAGGCAAAAATATTTGTGTTGAATGCATGAGATGATGAGGT GAACTGAATGACTGAACTCAAACGCTACAAGTCGGAGTCCATGGGACTGG GACGAGTAGGAGTGGGCGTGCAGTTTTAGCCCGCCATATGATGCCGGGCG TTTGACTTGCTGATTGCGGAATTAACATGAGCTAAAATTTAGCTCTAACC AAATTTTGCTCGTTCTCCTACGCAGCTCCTATTCTAGCAGACGCTCGCCA CCTTTATGTTCTCGCCCTCTGATATTATTAATTAACAAACTAGTTTGCTA ATTTATTGCGAATCTAAAGATTGACATTCTTATTTTATTTTTCAGATTTA CTCAAATTATGTTCATACAATCCAATAATGTAACCTAGAACCACTACAAT CTCCTTTTGAACCTGAAATACCGTAGCTAAAGCGCCATTATGGATTCAAC ACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTT GGTATGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATC TGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATT TAAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATA AAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGT AAAAGTGTACTTGGAAAATGTCTGGTAAGAATCCTTTCTTTTTAAAAGTT TTACTTTTACATAAGTGTCCCCGTTTCATATCAGACACATATTTCATATC AGGACAGTGTCTTGCTATTTTTATTTTATGCTGATATAAACAAAAAATCT TTTTCTTTTCCTCTTTCTGATCAATCTTGCTCCACATCCGTGCCAATCAA ACGTGAAAAAGCTTGTGCATTAAAATTGATGAGTATAAGCAAACGATATC ACTCTTATTTAAGAACAAAATCTTTAAATCCACACAATTTTTTTAATAAG AACATCCAAAATTTTGAAATCTTTGGATTATCTTTAAGTTTTTGAGTTTT AAGCCTAAAAAAATTCTTAACGCTGTTCTTCATTTTACAATTTTTAGAGT ATTTTTATGCGATTTTCTAAGAAATCTGGTGTTTTAGAGTTTGCGAAACC TTAAAGCTGTTCTTAAATTGTTCTCGATATTTTGGCCATGGAAGCCTTGT GTTCTTATATAATTTGTTCTTTTAAAGACGTGTTAGACCGTTTAAAACGT CGATACTAGAGTCCCCAAATCCTATTTTTCGTAGCCTTGTAACAGATCAT CCTCATATACTACCAGCGAGAAACTCTGCCCTAAAGATATGCGGTAAATG TAATGATCAGACCTGCTTCTTGACCAAATATATTCGAAAAACCGAATTTA CTTTTGACTGGATTAAAAAGTAACAGTTCCTCTAATAGATCTAATCGGAG TTTTTGATTTTTCTAGAAAAGCGATGTATTGTGGGATTATTTCGGGGGTA TTGCAATAGAAATCTATTAAGAATTCCTGGAGGGAATTCTATTGTAATAC CCCCGAAACAATCCCACAATGCATCGCTGTTTTAGAAAAATCAAAAACTC CGATAAGGTCTATTTTCATACGCTTGCTTTACCTCTACCAATAGACCTTT TCATGAATTACGTCACGAACATCACTTGCCTCGTTTTGAAATTATTGCCA TGGTGATTAACTCCCAGCAGATTCTATTACAACTACATTCTATTTTTAAA AATTTTTTTTAATCTCACAGGGGAAATTGTTTGAATACGAGGCAAAATAG TGATGTTTGTGACGTAATTTATGAAAAGGTCTATTAACGCGCTCAAAAGC TTTGGAGTTTGCGCAGTAGTCAGGATCAACTCAGAATCCTTACCTTTGTT TTGTTATAGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTCATTTC ATATCTATTTATTTCATACGAATTGTAAGTATCTTTTAATCCAGTGCCCG TGAGTCCCAGGCTTAATCTACTATAATAACGCATTCATTAACATTATTAA ACATCCAAAAACTCAAAAGTGCGGAAATCGCCATTCTCGCCCAAACTTTA CGTTTTGAAAAACGACGAAATAGTACTCAGAAATGCCAATAATAGACTAG GACGCTAGTCGCGCTGAGATGATACCACATAGAAAAGAGCGCATAGAAGC TAGGTAAGCGTGGGAGGAAAATTTCTCAGCAGAGAGGCTTGAAAGTACCT TCTCGCCAACTTTTCCTTGTTCTCCTAGGTACCTCCTATTTTAGCAAACG CCCTCTACCTTCATGTTACCGCCCACTAACATGATTAGTTAGTTTGCTAT AGTTTAGCCTTTGTCGTTGACCCTGATTGAAAAGTATTTCGTATTCTTTT TAGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGAATTCACA CGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCCAT TTCCTTCTCAGGGTAAGTCTCTATTATCAGGGTTGCTAGGTCTGCAAGAA ATGTCTGGAATTAGGTGAAAGTTGGGAAATGTCTGGAAAGTCTGTAAAAA ATCTGGAATAATTGACATACCTGTCTAGAAAAGTCTAGAATTGGCATACT TGTCTGGAAAAAGTATGGAATTTGAAGGAAACAGTCCTGAAAGAAGTCTG GTAGACTTTCTGGAAATAGGAAAATTTCATCTTGGCTTTTGGAATCACCA AAAATTTGTGCTTGCTTTACTCGCAACCAAACCTTTGAATCATGGTCATT CTGATATTTCTCATTCTTTTGTATTCATCAATTTGGCCTTTCAAATAACC ATTAAGGAATATCTGAAATCTTTCTACTCAAAATCATGTTCGAACTCGAT ACTTTTTTTCCGGACACTCTGTGTGTCATTGAATGAATACACGCTTTCTT TTTATAAGAATACACTTTATAAGAATGTCCATGATGAAAATGGCCAAAAA ATTAAGATTATGGTAAGAATATCACCATCATAGAATTTAGCAACTGAACC TAAGAATGCCTTTTTTAATGCATTTTAACCTGTAGATTGCCAATTTCGAT CTTAACCTAAGAATACTGTAAGAATATTTATGGATGATTTTTGCCAAAAC GTTAAGAATATCCATGATGAAATGAAAAAACACCATTCTTACAAAAAAAA AGCGCGTAGTTCAATTATATATTCTTCTTTCATAGTTTATCATAGCGACA GACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGATATATT GACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATGGCTTG GTAAGCATGTTAAAATTCTATCGGAGAAGGGAACTTAGTCGTGCAAAATT TTCGTCGAGACAAAATTTGGTCACTTTTTGACAGGAAAATTTTGTCATTT TTAATAACTATTCCCCACTAATATTTTGTCTTTGTTGTTAATATTTAGGA CACTCTTATTATATCATTACTTTTTACGAGCCCCCTCCCCCTCCCCCCAA CGGATTTAGTGATTACATGATTTAAGATTTTAAAGTGCGTGATTGCGTGA TCCAAGAGGAGCCAACGTGATCGTGATAGAAAGGAAATTTATATTGTGAT GTGTGATTTGAAAATTTTTTACTTTGCATGATTGCGTGATTTATATTTGG TCCTCTTTTACTATAAAGAAAATTAATCATGTGCGTGAAAGTTTGATTAA TTTGACGTCCGATATGATGCGGCATAACCAACATTCATTAATCTTTGATA AACTTAATGGTGGAATCTCCATAACTCGAACACGCACGAGGGAATACAAA AATTGTTCGAGTTAAGGAAATTTCGAGTTATAGAGTAAGGCTTATGAAGC GACAATAAATCTTGTTCGAGCAAGGAAATATAAGTTATAGAAGTTATAGA AAATTTTTAGGAGTTTGAGCTAAAGAGATTTCATTGTACTTTTTTTCGTT TTTTTATTCTGCACAGGATTGAGATTTCTACGTGTAGTATACATACGAAA ATTGCCAGATATTCTCATCTACTTAAATTTATTAGAAACGGGGTAAGTTT TTGTTTTTACCCTAAATTTGCTGGTTGAAGACGAAACATTGATATTTGCT TGATTAATTTATGTGTGATGCCTCATTTTAGAAGTATATGTAGCAAGAAT TGGGCACTATTTGTATTTCAAGGATACTTTTAGCATAACAAAGAAATGGT GATACACCTTTTCGACCGTAGCCACCAATTGCTGCGCGGGCATTTTTTGT CCTACTAAAACCATCCCAGTCCTTTTTTCGCACCAAAAGACAATAGAAAA ATGCGTCAAAAGAGGATTTAATGGGATGAAGCGGACTAAAAATGCCCACG CAATTACCGTCGAAAAGGTGTATAAAGATACCCTCTTGTTAACTAAAACC TAAACACATATAAGCAACATGCATTCCTGAAATATTTTTGCACTTAGTTC AACCTATTAAAAAGAGCGCCACTACAGCTTTGTATTAGATTTTCTCTGAT CGCCTACCTTATCGGCCCTTATCGGTGAAATTATATTGTTTCAGTTACAA TTAAATGGTCTGAAAAAAAATGAAATTAATTTTCAAGAAACCATTTTTTT GTCCTAAATTATTTATAAATTAGTTCAAATTTTCAAAATGAAAATTAGTA ACATTGATGAAAGCAGGGCATGATAGGGTGGATAAGAAATTATAGCCTCA AATATTCTTCCTTTGAATTTTCAGGAAATTTATAGAAATTGGGACGGTCG TTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGATACATTTG GTGAGTATAAAATATATGTACACTTTAATACACCTTTTCGACCGTAAGTC GCGTGGTCAGGTGCGTGTCACTTAATTATTCGATAATTACTCGATCCAAT CCTTTTTTAACACATTTTGGTATTATCTATAGGTGCGGACAAAACGCTAC TACCGATAAAGCGGATAAAAAAATGCCCGCGCGGCGATTGGCGCCTACGG TAGAAAAGGTGTATTCCATTCACTTTAAGCAATCTATTGTCGTACCATGT TAAAGCCGTTCCATAATAGAATTAATCTAATACGACATGGTTTCCACGCG AAAAAAAAACACCCTTCAAACGAATGGACTAAACTCGTAAACTTTTAAAA TTGCTTCATTCTGTTTGAAGGAGTGAGTAATTACTGAGTAATTACCCTCT AGATGACTGGTCTATAAAATCGGACCCTTGCAGTGTAGAGGAAATTTAGC CAAATTTGGGTAAATTTGGGCGAAAATTCAGTCCTTACGATTAGCTTTTT AAAATCCTAAAAATCCACCATTAAGAGCAGCACCTACAGTCGTTTGGTTG CTTGCCTCCCTCCTATGACGTCAGCACCAAAAAAAACTCACATTATCGGA CCTTTGCAGTGTAGGCAAAATTTAGTAAAATTTGGGCAAATTTGGGCGAA AATCAATCTTACAGTCAGCCTTTACAAAATTAAACCTGAAAAACTTCGTT GTTCCCACTTTTTACACCCTTACAGAGCACTTTCTCTTATTTCGACCCAT ACAGTGCATTTTGGGAAGCTTAAAAAACGCGCATCATTAAAGACAGCACC AATGGTCATTTGCTAGCCTCATCCCTCATATGACGTCAGCGTCAAAAAAA AACTCACATTATCGCCAAGACATTTCCATTATGGAAAGACAATATATTAC ATTTTAAAGAGTCGGTAATTTTTTATGCAAACCACTTGTTTACGTCTATA CCTAATGATATCCAAACGGTATGGTGGTATAACAATAATATTATGACTTT CCGTTTTAGGTTGAGAATACAGGTGATTTTTGGGCACCACACAATTATTC GAATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTCATGATAGTAA GTCACTTTTGCTTCCAAATTTCCAATACCCATCTATCCCCAAATTCTTTA GCTACACGTTTTTTTTTATAAGAACAAACTATATAAGAACATAAGGCTTC GAGGCCCAAAAATTTAAGAACATTCTAAGAACATACTAAGGCTTTGGAGA CTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAA AAACATGCAATTTCTTAAGAAATTACATCAAAATACTCAAAAAATGCTGA AAATAAGAACATTTTAAGAACATTTTTAGGCTTCAAATCAAAAAAACTAA GAATATCCGAAGGCTTCAAAAAATTTTGACGTTCTTATAACAAAAACGTG TAGTCATCATTGTTGCGCATACCGGTGGCATGAAACTTTGAGTACCAAAA TCTGTTTCATTCTTAACAACTAAAACTACTCTGAAATATCATCGAGCCCT TTGTTGACACTAAGAAAAAGTGAATTAGAATTGTGTTAGTCTAAATCGCA GACCTCTACCAAACCCCAGGTAGTATAGGGGCTATAAGGAGCAGGAATCT GCTAGTGGATGTCAGCAGCCTAGTATTGTGTTAGTCTAAATCGCAGACCT CTACCAAACCCCAGGTAGTATAGGGGCTATAAGGAGCAGGAATCTGCTAG TGGATATCAGCAGCCTAGTATTGTGTTAGTCTAAATTGCAGACCTCTACC AAACCCCAGGTGGTATAGGGGCTATAAGGAGCAGGAATCTGCTAGTGGAT GTCAGCAGCCTAGTATTGTGTTAGTCTAAATCGCAGACCTCTACCAAACC CCAGGTAGTATAGGGGCTATAAGGAGCAGGAATCTGCTAGTGGATATCAG CAGCCTAGTATTGTGTTAGTCTAAATCGCAGACCTCTACCAAACCCCAGG TAGTATAGGGGCTATAAGGAGCAGGAATCTGCTAGTGGATATCAGCAGCC TAGTATTGTGTTAGTCTAAATCGCAGACCTCTACCAAACCCCAGGTAGTA TAGGGGCTATAAGGAGCAGGAATCTGCTAGTGGATATTAGCAGCCTAGTA TTGTGTTAGTCTAAATCGCAGACCTCTACCAAACCCCAGGTAGTATAGGG GCTATAAGGAGCAGGAATCTGCTAGTGGATATTAGCAGCCTAGTATTGTG TTAGTCTAAATCGCAGACCTCTACCAAACCCCAGGTAGTATAGGGGCTAT AAGGAGCAGGAATCTGCTAGTGGATATCAGCAGCCTAGTATTGTGTTAGA CTAACCACCTTTTAATCATTTTTGTGTATTTTAGGTGACATTTTCGACGG TGGGTTACGGTGACTATTCATGTAAAACAATCATGGGACGCATCTTCTGC ATGATTTTCATCATCTGTGGACTGGTAAGGTTTCTTCATACACTTCCATG TACCTTGCTAGTAAAACGTCGTTCATTTTGAACGTCGGCTACCGGTTACC TATCCTTTATATAACCTCTAAATCGTTTTATTTTAAACCACACATCACTA TATTTCTCTTACCTTATCTGTGGCACCAACTCAATACCGTGTGGTTGCTT CATACCAGAAGAGATCACCACCCTCTGGATAACGGCCGTAAAAGCGGTCC CGATCAGCATCCGTCCAATACAAATTATCAGCTACCCAATCGATGGCCAA ACCATCTGGTGCTTGTAATCCTGTAGGAAAGAAATACAATACACGGGTTG CAAAATAAGTCTACACGGTTTTACATTCATTTTTAGGGTGTATTTGCATC TTCTATACCGGCCATATTTGGCTTCATCTCATCGTACACAAAATATGACA GAAAATTCAAAAGTACACCTGGAAAAAAGTAAGTATTAAAGGGGAGAATC TTGTTGACGGTGGCAATGACGATGGTAAAATATTATTTTGGCGAAAGACT CCTGCTCGATATTCTCAAATAAATATATCCCTTAGGGTTGACGGTTATTA GGGTTCATCTTTGTGAGGGCATGTAAAATTGACAAAAGTTGGAATATTTT GTCTGGGAAACCCTCCCTGTTGAATCCCGAAAGTGTATCTTTATTACAAA AAGATAACATCCTCAATTATAGTAATCTTTCTTTTCAAGAAAAACTCGAT CAAAAAGTGCATAACATAGGAAAAATATATCGGTGGTAATGGAAATGGAA TCATGAACATGATGGAATCAATGAGAAAATTTTCTGGGTGGGAATTCTCC GGGAATTTTGGAATATGGCCGTATCAGGATCTGATACAGTGGAGTCTCCA TAACTCGAAAACGCACGAGAAACACAAATTTGTTCGAGTTAAAGAAATTT TAATGGAGTACTATAAGGTTTATAAGGCATTGTTAGCTGAAAGGAACCAT ACAGGCTCCACTGTAGATTTACAAAATGATTTTAAAATGATTTTAATTCT CTTTTTTCACAGGCATGTCATTGTAACAGGTCATATAACAGACGAATCTG TCAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGC AATGTTACTGTTGTCTTCCTTGCACCGTAAGTATTCGAAAACTACCAGGG TCCACGTCATGATCTCTAAAGTAGAGGGAAAAATACACTGATTAAGTAGG CAGAAGAAAATTTCTATTTGACCCCCTAATATACTGTAAATTGAGCCAAT TTCAGACTGATATTTGAATAAGACAAGACGCTAATGAAAGTCGTAATATT TTGAAGAAAACTTTTTATGTTATATAGGGGGTCGTGGCATCCCTGTCCTC CCTCCCCCATCTCCTGATGATGTTGTTCCTAAAATAAATCTTTCATTAAA ATTGTGGCAGAAAGTATACAATGATATCATTCGTTAAAAGGGTAGTGAAC CTGAAAAATGATCACTTCAATGAGACAGGGTTTACAAAGGTGTAGACGGG AGCTGGATTCTTACCACATAGCTACATAGTAGGTAGCGATCGTAGTGTAG TGGTAGAGCACTCGGCTACGGTGCGCAAGGTTGTGGGGTCAATCCCCAGC CGGGTCATACCAAAGATTTCCAAAATGGAACTTGATGCCTCTGTGCTTGA TACTCAGCAATTAAGAAAAGGATTAAGGGTAAGTGGAGCAATCCAGGGGG AGGAGTGGCGCCCTCCCCTACCTTCGGGTAGATAGCTATCGAATGAGGAG CCTTCGCGTCGCCTCCGACTGCGGTCACAGACTTAATACTACTTACTTAG TAGGTGCAAATTGCTCTGTATACAGGCATATGATAGATTAAATATAAAAA CGTGTGCAAAATTGTAAGCTTGATAGCTCTTCCTTACTTTTTGATTGGCC AATTAGCTTTAAATCCACTCAATCTCGCACAAATTTGGTGTTCTTTGTAG GTAGATATTGAATTGGATCTAGACTAATAGAGTATTGTACTTTTTTTTCA GGAACTATCCGAGTACACTAATTGAAGGAATCATCCAAAAACATCCTTCT TCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTCATCG AGTTAAAGTAAGCAGACAATATCGTACCAAGATTTTACTGGTGGATGTTG GTACAATCGTCATAAAACAGCAAACTAAGGGACTGAGTTCGATTTTGAGC AGGAACTTAATCTGAAAGTACTTTCTTTTGAATCTCAGAAGAGATTACGA GTGATTCTACCTTCAGAGAAATTTGGATCTTAAAGGTTTTATTTTTACAT AAGTGTTTCCGATTCATATCAGACACATATTTCATATCAGGACAGTGTCT TACTACTGTTATATTATGCTGATGTAAGCAAAAAAGTGTTTTCTTCTCCT ATTTCTGATAAATCTTGCTCCACATCCGTGTCAATCCAATGTGAAAAAGC TTGTGAATTAAGCAAACAATATCACTCTTATTTAAAAACAAAACCTTTAA ATCCAGATCTTTTTGGATGCTAAATCTGATATCTTATCAAAACCTACCCC AAAAGAAGTAAAAATAACCAACAAAAGCAGACCCTGCCAGTAGATATACC TATCAAAATTTGGTTTATTACCGAGCTTGTCAGACATATTTTGATACCCT CAAAAAGGGACTTTAAACTATGTACGTCCTCCTTGTCTTTCGACGCCGCC AAGAATTTGCTACTGGGGGAGCTGCTCTCTCCCACCACCACAATACTATA CATAATTCAATCCTGCCTGAATGTCTTGTCCAGGACTTTTTCAATTTCGA ATAATTTAAAAAGAGAATGTTGTCGCTATTTCGTTTTAGATGAGTGAAGC AGACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCAG AGGATGCTGCTAATATCACAAGGTAAGATCTTTAGCATTTGATTGGTTTA TTATTAAACCCACGTGATTCACGTTAAGAAAATAAGCCAATCAGCGCCAA AATTTAGGGTCCAACGTTTTTTCAGCCGAATGGATTTTTCCGAAAGCTTT AAAAGTGCATTAGCAGAAGACTGATTTTCTCAAATTAGAGAAACTCAATA CAGAACATGAAATCTTTCAACGAATTTAAGTTTTTATCCATTTTGATTTT AAATTCTATTTTCATATTTTTGTACCCAGAGTTGTTTCAATGAAGAAATA TTTCAGTAAATATCACATCCGATGTATCGTACAACTTATGCGTCGAGATA ATAAGGTGAGATCTTAACTATACTATCAAAAATGGGCTATTCCGGAAAAG ATTTTATGTTGAGGAGATCTATTTTTAAAAAGGTGGCCCCTTGATTTTTT CCAATTTTTCAGGACCCCTTTGGATTTTTTATTTTCAAGACCACCCTGGA CATCACATCTCCTCAATATAGGGGGTACAGACTTTTTCTGGAATAGCCCA ATGGTGGACATTTCACCGACGGATTTTTCCCGATAAATATTTCTCCCCAA TCGAAAAATCTCCGAACAAAGTTTCCCCAATGGTCATTCTCTCCGGACGT TTCAATGAACAGACAATTGCCCGGCGTGCTTTTCCCCGACTGTATTGGGA GTTTCGCCGATCATGGATGTTTCCCTGACATTTAGGAAATATCCCTGAAT AAAAATCATCCTTAGGAAAAACTTCCCTCATAGAAAAATCCGTCGGGAAA AAGTACTCATTTAGTTTCAAGATCTTCTTCCTGCAGTTGGAAGCTTACAA ATTCCTATAATCCCGTCATAGTAAACCACAAAACATATTCAAGCTCTTGA TAGTCATTGGAAGATGAATTAGCTTGTGCAACACAGTAATTTTTCGAAGA TTTTCCTGGTGGTTAATCCTCAAAGAGACCTTAAGGGTCCTAGTTCAGGG CCCACGCCACTGGGGAGAGACAGGAGGCTAACTCAGGAGGCCGTGCCGGC CCCTCCCACTTTTTTACAGAGTAAAATTTCTTTGGCTGGGCCTCGTTAGA CTCTATATTCGTTGGTCCTCCCAATTTCATGGCGTGGGCTCTGTGGTAAA AAGATGTTTTCAATATTTACAGGCATTACTAGAAAATACGACGCATTGGC GAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGGTAAGGATGGTT TTTAATTATAACAAGAAGCCCAGAGGGCATGAAGGCCCAGCGAATAAAAG TATGAACTGAACAAGACTTGTGTAGCAGAGGGGATTTGAACCTGGAGTCG CTTATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNAGGCCAACTGTGTTCGGTATTCGAAAAAATCAAAACAAAAAAA AAGAGGCGGGAGAAAGAAACTGAGATTCCAAGAAATGATATCTTTCTTTT TGAATACCCCCTCCCTTTTATTCCTTTTATATTTTCTTACAACTACAATT ACTTTTCTTAGAATAACAAATTTTTATGAGCAGTCATTTCTTTAATAAGT TTGTAATTTCTTTGCAACAAGGATATCTATCTAAACTTTCACCTTACAAA TTTCTTAAAAAACATCATATCATGTAAAGTTTGTTTGTTTGTTGTTGTTG TTTTTTGCCTGAGGATTATATCCTTATACACTCATTTTGTTTTATAAGCA TACGGTAAATTTCGGCTGAAGCTCACTATGCTTAAGTAAAGCTCAATTTT GAGCCTCGACTATGCTTAACCCTATGCTTGGTAAAAAAATTATGAAGGGG TGGTAAAAATTTTCGCACATTTTCCCCTATCTTTAATCTTGAGAGAAATG AAGACATTCTATTGTTTTCGAATGTTTACCATATGATTTCTTCTGTAATT TTCTGAAGTTTTGGAAATTATGATTCTAAAATTTCTTTGGCTGAGCCTCA AGGTATGCTTAGCATATGCTTAATTTTTCTGGAAATTTGAGCTTCAGTAT GCTTATAAACGTTATGCTTATAAAACAAAATGAGTGTATTTACCCCTTTT ATATATTAAAGTCCATGTAAATAAAAAGCTATAGTATATTCTCCCCACCA CCATTTTGCTCAAAGACAGTTTTATAAATACTTGCAATTTCGAATTTGTG ACTTTCCTGTTTTGTTTGATAAAATTTTTTACAGTAGTGGATGAAAAATC TTATGATAACTTTTGCAGGGAAAAAGTAAAGAGTTCCAGCTTGTAAGCTT TGCAGTATGTTGATCTTGCTTTGATTTNATAAAAAAGTTCCAGCTTGTAA GCTTTGCAGTATGTTGATCTTGCTTTGATTTGAGTTTGAAATGTTTTCTA CCCAAAAAGAGACATTAAAAATGAGAATGAAATAGGAGAAAAGTTAGGAA ATCCCCAGAAATTAGCTTAAAATGGAAAAGTACCGATTAGTAAAAACCTT GAGGCAGATTTAAATGACATTAAATTTCTTATTTACAAAAACTGATAAAT AGGTAATTCAATCATGATAAACAACAAATGATTCTAAACTGTCTTCCGAC AATCCTGTATTACAGTCTTGACTAATTCCAGAAGGCTGATGTAAATTTTT CCAAGTCATAATCTCAAATTATCAAATTGCATATCATGATGACATATTTC AGTAACAGTCTCAATTTATACCAGGGCGTTGGTGAAATATTCCAAGTCAT AATCTCAAATTGTACGCAGGACGTCANNNNNNNNNNNGAAAAATTGCATA TCATGATGACATATTTCAGTAACAGTCTCAATTTATACCAGGGCGTTGGT GAAATATTCCAAGTCATAATCTCAAATTGTACGCAGGGCGTCAAGTGAAA TAAGTTATAATTTCAAATTAAACCAGGACGTCAAGTGAAATATTCCAAGT TATAATCCCAAATTAAACCACGACGTGAAGTGAAATATTCCAAGTTATAA TCCCAAATTAAACCAGGACGTCAAGTGAAATATTCCAAGTTATAATCCCA AATTAAACCACAACGTGAAGTGAAATATTCCGAGTTATAATCTCAATTTA AACCAGGACGTCAAGTGAAATATTCCAAGTTATAATCCCAAATTAAACCA CGACGTGAAGTGAAATATTCCAAGTTATAATCCCAAATTAAACCACGACG TGAAGTGAAATATTCCAAGTTATAATCTCAAATTGTACCAGGACGTCAAG TGAAATAAGTTATGTTTTCAAATTAAACCAGGACGTCAAGTGAAATATTG CAAGTTATAATCTCAAATTGTACCAGGACATCAAGTGAAATATTCCAACT TATAATCCCAAATTAAACCACGACGTGAAGTGAAATATTCCAAGTTATAA TCTCAAATTGTACCAGAACGTCAAGTGAAATAATTCCAACTTATAATCCC AAATTAAACCACGACGTGAAGTGAAATATTGCAATTTATAATCTCAATAA TAAACCAGGATGCTGTGCCAAATATTTCATTTCTGTATTGTGCTCTCTGC AAATTACTGCCATATTTTCCCATGCATCATATTTCTGAATTTCTGATTCT TACCTAGAAAATTTAGAATAATAATCTGATAATTTTTACAGGTACAACTA GGTAACTGAACTTCTAGACAATTCAAATCAAAATGAGAAAATGTGAAAGT TTTCGAACAAGAAGTATATTAAAAGCAGTCTTTTAAAGTCAACAATTGAC AATAAGTACTTTGTTTGACATTTTTCAAAGTTGTCAAAGAACTGCTAACA CCAGATGAAAATAACTTTTTAAGAGTGGAGATATGAGGGTATTCNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGACAATAATTTCACAGCTG TTTTAAAACGCATGCGTAAACATTTTGTTTTTTACTACAACGATTTTGAT AGTGAAATAAGTGTCCTGAATTGAAATTGCATGGCCGTAGTGACAAAAAC ACGATAAAGTAGGTTTTAAAGAGGTAAGGTTCACTCGACCATTTTACTCG ACTTTATAATATCGTCTAGCTGCACTAATCTTGCCATAATTTATCAGAGA CAGATCCGCATCGCAGGGTGTAAAGTAATAAACCTTGCCTTCTACGACTA AACAAATAAATGGACAAAGTGAAAATTAATTTCTTAGTGAACACTACAGA AGGTTCTTTCTCCGATGATTTTGTTGGAAATAAGCGATCGCCAACAGTGT GTTTGAAACACGCTGACCTAGTCTTGTAGTCTCAATAAAACAAATGAACC AAGAAGAAAGAATCCATAATGAGCTGGATTTTCACAGAAAAACCATAGAT CCATCTTGTCCTTGTGTCTCTTCCCAGTGACCAGCGTGTTTTGATCGTTT GAACCGAGCTCGGCCTTTAAACTTAGGCGGTTTTTACCACGGAGCGACTA ACCAGTCTCACTGGTTAGTCCAAGCAAAACCGCAATTTTTTTTTTATGCC AAAGAGTTATCGTCCGTTTGTTACGGTTTGTTACATTGTTTTTCTTAAAA CACACTACATCTGTTATGTTCTTATAGTTATAGTTTTAATAGTTAATTGT ATTTTCTCCTTTTATGTTTTTAACCAATAAAGACGATTTCAATTGTTTTT TATTCTGTCAATCATGTTCTAACAGCCAATCAANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAT ATGAAAACGCGTATCGCCTAGTAAATTGTTACACACTGACACCGGGCAGA ATGCTAATGAAAGGCCCAGTACGCTAAAGCTAGCTGGGCCAAAAATAATT GTAATTGTAAATTTAATAAAACTTATTTAATGCATTCTTATTTTCTAAAA ATTTACAATAGCGTTTATAATGTTTATTAAGGTACGATTTACATTCGAGG GAAAGAAAGGGCGGAGCAGGGAAGAAAAGGGGTGTTTTGTTGCCACCGTG TCTTTTGAAATGTGAGGCCGTTAGGACTTACGATCCTTTCACTTTAGTTT AGGGGTTTTTAAAGTGTCTTATATTTAAAGTGACACTATTATGTACATGG TATTTGGTCTGTTACATGCACAGTACTAGTGACTGGAAAATGCTAAGCGC TTTTGAATATAAGGAGGTTTTACAAAAAGCAAGATCCATTTCTCAATTTA GAGAGCTCGTACCATCATTCTTTCTTCTTCTTTTTTTCACAGCTGAAGTA TGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTTG CAAATCTCTTTGTTATGAGATCAAGCGAAGTAAGTGCGATCAATTTGTAT TAAAACCAACGAGCTTTACAGTCAACTTTTTCATATTGAAATCCTCTATA ATTCGAATCTTTCAGTAATGCGAACTAGAACTTAAGCGCCTCAATCCCCT TGAATATTTTTCAATATTTTCTCAATGGATCAAAATTGAAATAAAAATGA GAGACTGTGACTCGGCAGCCAGAGTCCCATTTCAAGGATATCAAAATATT TGATATGGTCGTAAATTAACAGGATTTTCATAAGTTTATCTGACAGAATC CATTTTCGATTCAGAAAAACAAAGGAAAGAAATCAAACACATGGCGAAAT GAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTCGGA TTATTTTGAGAATATGTCGTTCCCAAAAGCTGCAG

Coding sequence (CDS) from alignment at sc0000001:224278..250162-

>TCONS_00000147 ID=TCONS_00000147|Name=TCONS_00000147|organism=Clytia hemisphaerica|type=CDS|length=26352bp|location=Sequence derived from alignment at sc0000001:224278..250162- (Clytia hemisphaerica)
AAAAACAAAGGAAAGAAATCAAACACATGGCGAAATGAATATGTTCATGG
AGTTTCGTGTGAAATTTACTCCACCACATTGTCGGATTATTTTGAGAATA
TGTCGTTCCCAAAAGCTGCACTGAAGTATGGCTTCATGGCGCAATGTTGT
TATTCACCTGGTTTTTCAACGCTACTTGCAAATCTCTTTGTTATGAGATC
AAGCGAAGCATTACTAGAAAATACGACGCATTGGCGAAAAGGCGAAGGTG
ACACCATCGTTTGCATCGATGAGAGTTGTTTCAATGAAGAAATATTTCAG
TAAATATCACATCCGATGTATCGTACAACTTATGCGTCGAGATAATAAGA
TGAGTGAAGCAGACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAAT
CCTGAGTCAGAGGATGCTGCTAATATCACAAGGAACTATCCGAGTACACT
AATTGAAGGAATCATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATG
GAACTGTATATAATCTTAAAGATTGTCATCGAGTTAAAGCATGTCATTGT
AACAGGTCATATAACAGACGAATCTGTCAGTTCATTTATTCAAGATTTTT
TACATCCTGACCGGCAATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCA
CCGGTGTATTTGCATCTTCTATACCGGCCATATTTGGCTTCATCTCATCG
TACACAAAATATGACAGAAAATTCAAAAGTACACCTGGAAAAAAGTGACA
TTTTCGACGGTGGGTTACGGTGACTATTCATGTAAAACAATCATGGGACG
CATCTTCTGCATGATTTTCATCATCTGTGGACTGGTTGAGAATACAGGTG
ATTTTTGGGCACCACACAATTATTCGAATAGTAATCCACTCAATTATTTT
GAATGTCTGTACTTCATGATAGAAATTTATAGAAATTGGGACGGTCGTTG
TGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGAT
TGAGATTTCTACGTGTAGTATACATACGAAAATTGCCAGATATTCTCATC
TACTTAAATTTATTAGAAACGGGTTTATCATAGCGACAGACAAATTGGCG
TTTTGGGGGTTAAACATTTACACGTTAGTCGATATATTGACCATTCCAAT
CGTCATCATTCAAGCATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTA
TTGCGACAAGCACGATTTCGCACACGGAATTCACACGCAGATCTGGCTAT
TGGAATTATGTCTATACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTG
GTGACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCATATCTATTTAT
TTCATACGAATTATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGA
TTTGCCTAGCAACGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAG
CCATTTATGTATCTGGTTTCATCTGCATTCTGATTGGTCGAATCTTTTGG
AAAGTCATTAAAAAATGGCAATTTAAATTACCGGAAGACGAAAAAGATTC
ACGGAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGT
TCGCTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAA
AACAAAGGAAAGAAATCAAACACATGGCGAAATGAATATGTTCATGGAGT
TTCGTGTGAAATTTACTCCACCACATTGTCGGATTATTTTGAGAATATGT
CGTTCCCAAAAGCTGCACTGAAGTATGGCTTCATGGCGCAATGTTGTTAT
TCACCTGGTTTTTCAACGCTACTTGCAAATCTCTTTGTTATGAGATCAAG
CGAAGCATTACTAGAAAATACGACGCATTGGCGAAAAGGCGAAGGTGACA
CCATCGTTTGCATCGATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAA
ATATCACATCCGATGTATCGTACAACTTATGCGTCGAGATAATAAGATGA
GTGAAGCAGACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCT
GAGTCAGAGGATGCTGCTAATATCACAAGGAACTATCCGAGTACACTAAT
TGAAGGAATCATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAA
CTGTATATAATCTTAAAGATTGTCATCGAGTTAAAGCATGTCATTGTAAC
AGGTCATATAACAGACGAATCTGTCAGTTCATTTATTCAAGATTTTTTAC
ATCCTGACCGGCAATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCG
GTGTATTTGCATCTTCTATACCGGCCATATTTGGCTTCATCTCATCGTAC
ACAAAATATGACAGAAAATTCAAAAGTACACCTGGAAAAAAGTGACATTT
TCGACGGTGGGTTACGGTGACTATTCATGTAAAACAATCATGGGACGCAT
CTTCTGCATGATTTTCATCATCTGTGGACTGGTTGAGAATACAGGTGATT
TTTGGGCACCACACAATTATTCGAATAGTAATCCACTCAATTATTTTGAA
TGTCTGTACTTCATGATAGAAATTTATAGAAATTGGGACGGTCGTTGTGA
ATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGATTGA
GATTTCTACGTGTAGTATACATACGAAAATTGCCAGATATTCTCATCTAC
TTAAATTTATTAGAAACGGGTTTATCATAGCGACAGACAAATTGGCGTTT
TGGGGGTTAAACATTTACACGTTAGTCGATATATTGACCATTCCAATCGT
CATCATTCAAGCATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTATTG
CGACAAGCACGATTTCGCACACGGAATTCACACGCAGATCTGGCTATTGG
AATTATGTCTATACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTG
ACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCATATCTATTTATTTC
ATACGAATTATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGATTT
GCCTAGCAACGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCCA
TTTATGTATCTGGTTTCATCTGCATTCTGATTGGTCGAATCTTTTGGAAA
GTCATTAAAAAATGGCAATTTAAATTACCGGAAGACGAAAAAGATTCACG
GAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTCG
CTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAAC
AAAGGAAAGAAATCAAACACATGGCGAAATGAATATGTTCATGGAGTTTC
GTGTGAAATTTACTCCACCACATTGTCGGATTATTTTGAGAATATGTCGT
TCCCAAAAGCTGCACTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCA
CCTGGTTTTTCAACGCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGA
AGCATTACTAGAAAATACGACGCATTGGCGAAAAGGCGAAGGTGACACCA
TCGTTTGCATCGATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATA
TCACATCCGATGTATCGTACAACTTATGCGTCGAGATAATAAGATGAGTG
AAGCAGACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAG
TCAGAGGATGCTGCTAATATCACAAGGAACTATCCGAGTACACTAATTGA
AGGAATCATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTG
TATATAATCTTAAAGATTGTCATCGAGTTAAAGCATGTCATTGTAACAGG
TCATATAACAGACGAATCTGTCAGTTCATTTATTCAAGATTTTTTACATC
CTGACCGGCAATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTG
TATTTGCATCTTCTATACCGGCCATATTTGGCTTCATCTCATCGTACACA
AAATATGACAGAAAATTCAAAAGTACACCTGGAAAAAAGTGACATTTTCG
ACGGTGGGTTACGGTGACTATTCATGTAAAACAATCATGGGACGCATCTT
CTGCATGATTTTCATCATCTGTGGACTGGTTGAGAATACAGGTGATTTTT
GGGCACCACACAATTATTCGAATAGTAATCCACTCAATTATTTTGAATGT
CTGTACTTCATGATAGAAATTTATAGAAATTGGGACGGTCGTTGTGAATT
TCATGACAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGATTGAGAT
TTCTACGTGTAGTATACATACGAAAATTGCCAGATATTCTCATCTACTTA
AATTTATTAGAAACGGGTTTATCATAGCGACAGACAAATTGGCGTTTTGG
GGGTTAAACATTTACACGTTAGTCGATATATTGACCATTCCAATCGTCAT
CATTCAAGCATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGA
CAAGCACGATTTCGCACACGGAATTCACACGCAGATCTGGCTATTGGAAT
TATGTCTATACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACG
TCATTTGTCTTGAACATGGCGGCGTTCATTTCATATCTATTTATTTCATA
CGAATTATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGATTTGCC
TAGCAACGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCCATTT
ATGTATCTGGTTTCATCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTC
ATTAAAAAATGGCAATTTAAATTACCGGAAGACGAAAAAGATTCACGGAA
GCCGATGGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTG
TCAATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAA
GGAAAGAAATCAAACACATGGCGAAATGAATATGTTCATGGAGTTTCGTG
TGAAATTTACTCCACCACATTGTCGGATTATTTTGAGAATATGTCGTTCC
CAAAAGCTGCACTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCT
GGTTTTTCAACGCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGC
ATTACTAGAAAATACGACGCATTGGCGAAAAGGCGAAGGTGACACCATCG
TTTGCATCGATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCA
CATCCGATGTATCGTACAACTTATGCGTCGAGATAATAAGATGAGTGAAG
CAGACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCA
GAGGATGCTGCTAATATCACAAGGAACTATCCGAGTACACTAATTGAAGG
AATCATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTAT
ATAATCTTAAAGATTGTCATCGAGTTAAAGCATGTCATTGTAACAGGTCA
TATAACAGACGAATCTGTCAGTTCATTTATTCAAGATTTTTTACATCCTG
ACCGGCAATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTGTAT
TTGCATCTTCTATACCGGCCATATTTGGCTTCATCTCATCGTACACAAAA
TATGACAGAAAATTCAAAAGTACACCTGGAAAAAAGTGACATTTTCGACG
GTGGGTTACGGTGACTATTCATGTAAAACAATCATGGGACGCATCTTCTG
CATGATTTTCATCATCTGTGGACTGGTTGAGAATACAGGTGATTTTTGGG
CACCACACAATTATTCGAATAGTAATCCACTCAATTATTTTGAATGTCTG
TACTTCATGATAGAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCA
TGACAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGATTGAGATTTC
TACGTGTAGTATACATACGAAAATTGCCAGATATTCTCATCTACTTAAAT
TTATTAGAAACGGGTTTATCATAGCGACAGACAAATTGGCGTTTTGGGGG
TTAAACATTTACACGTTAGTCGATATATTGACCATTCCAATCGTCATCAT
TCAAGCATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGACAA
GCACGATTTCGCACACGGAATTCACACGCAGATCTGGCTATTGGAATTAT
GTCTATACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCA
TTTGTCTTGAACATGGCGGCGTTCATTTCATATCTATTTATTTCATACGA
ATTATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAG
CAACGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCCATTTATG
TATCTGGTTTCATCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATT
AAAAAATGGCAATTTAAATTACCGGAAGACGAAAAAGATTCACGGAAGCC
GATGGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCA
ATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGA
AAGAAATCAAACACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGA
AATTTACTCCACCACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAA
AAGCTGCACTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGT
TTTTCAACGCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGCATT
ACTAGAAAATACGACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTT
GCATCGATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCACAT
CCGATGTATCGTACAACTTATGCGTCGAGATAATAAGATGAGTGAAGCAG
ACGCTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAG
GATGCTGCTAATATCACAAGGAACTATCCGAGTACACTAATTGAAGGAAT
CATCCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATA
ATCTTAAAGATTGTCATCGAGTTAAAGCATGTCATTGTAACAGGTCATAT
AACAGACGAATCTGTCAGTTCATTTATTCAAGATTTTTTACATCCTGACC
GGCAATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTG
CATCTTCTATACCGGCCATATTTGGCTTCATCTCATCGTACACAAAATAT
GACAGAAAATTCAAAAGTACACCTGGAAAAAAGTGACATTTTCGACGGTG
GGTTACGGTGACTATTCATGTAAAACAATCATGGGACGCATCTTCTGCAT
GATTTTCATCATCTGTGGACTGGTTGAGAATACAGGTGATTTTTGGGCAC
CACACAATTATTCGAATAGTAATCCACTCAATTATTTTGAATGTCTGTAC
TTCATGATAGAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATGA
CAGTAGTTCTTTCGTCGACCGGTATGATACATTTGGATTGAGATTTCTAC
GTGTAGTATACATACGAAAATTGCCAGATATTCTCATCTACTTAAATTTA
TTAGAAACGGGTTTATCATAGCGACAGACAAATTGGCGTTTTGGGGGTTA
AACATTTACACGTTAGTCGATATATTGACCATTCCAATCGTCATCATTCA
AGCATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGACAAGCA
CGATTTCGCACACGGAATTCACACGCAGATCTGGCTATTGGAATTATGTC
TATACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTT
GTCTTGAACATGGCGGCGTTCATTTCATATCTATTTATTTCATACGAATT
ATGGATTCAACACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAA
CGAACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCCATTTATGTAT
CTGGTTTCATCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAA
AAATGGCAATTTAAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGAT
GGAAGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATC
TCGATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAG
AAATCAAACACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAAAT
TTACTCCACCACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAAAG
CTGCACTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTT
TCAACGCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGCATTACT
AGAAAATACGACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCA
TCGATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCACATCCG
ATGTATCGTACAACTTATGCGTCGAGATAATAAGATGAGTGAAGCAGACG
CTGTCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGAT
GCTGCTAATATCACAAGGAACTATCCGAGTACACTAATTGAAGGAATCAT
CCAAAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAATC
TTAAAGATTGTCATCGAGTTAAAGCATGTCATTGTAACAGGTCATATAAC
AGACGAATCTGTCAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGC
AATGTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTGCAT
CTTCTATACCGGCCATATTTGGCTTCATCTCATCGTACACAAAATATGAC
AGAAAATTCAAAAGTACACCTGGAAAAAAGTGACATTTTCGACGGTGGGT
TACGGTGACTATTCATGTAAAACAATCATGGGACGCATCTTCTGCATGAT
TTTCATCATCTGTGGACTGGTTGAGAATACAGGTGATTTTTGGGCACCAC
ACAATTATTCGAATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTC
ATGATAGAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATGACAG
TAGTTCTTTCGTCGACCGGTATGATACATTTGGATTGAGATTTCTACGTG
TAGTATACATACGAAAATTGCCAGATATTCTCATCTACTTAAATTTATTA
GAAACGGGTTTATCATAGCGACAGACAAATTGGCGTTTTGGGGGTTAAAC
ATTTACACGTTAGTCGATATATTGACCATTCCAATCGTCATCATTCAAGC
ATTGCAACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGACAAGCACGA
TTTCGCACACGGAATTCACACGCAGATCTGGCTATTGGAATTATGTCTAT
ACAGTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTC
TTGAACATGGCGGCGTTCATTTCATATCTATTTATTTCATACGAATTATG
GATTCAACACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGA
ACGCTCTTGGTATGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTG
GTTTCATCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAA
TGGCAATTTAAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGA
AGAGTATAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCG
ATACCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAA
TCAAACACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAAATTTA
CTCCACCACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAAAGCTG
CACTGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCA
ACGCTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGCATTACTAGA
AAATACGACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCG
ATGAGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCACATCCGATG
TATCGTACAACTTATGCGTCGAGATAATAAGATGAGTGAAGCAGACGCTG
TCATTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCT
GCTAATATCACAAGGAACTATCCGAGTACACTAATTGAAGGAATCATCCA
AAAACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTA
AAGATTGTCATCGAGTTAAAGCATGTCATTGTAACAGGTCATATAACAGA
CGAATCTGTCAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGCAAT
GTGAAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTT
CTATACCGGCCATATTTGGCTTCATCTCATCGTACACAAAATATGACAGA
AAATTCAAAAGTACACCTGGAAAAAAGTGACATTTTCGACGGTGGGTTAC
GGTGACTATTCATGTAAAACAATCATGGGACGCATCTTCTGCATGATTTT
CATCATCTGTGGACTGGTTGAGAATACAGGTGATTTTTGGGCACCACACA
ATTATTCGAATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTCATG
ATAGAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATGACAGTAG
TTCTTTCGTCGACCGGTATGATACATTTGGATTGAGATTTCTACGTGTAG
TATACATACGAAAATTGCCAGATATTCTCATCTACTTAAATTTATTAGAA
ACGGGTTTATCATAGCGACAGACAAATTGGCGTTTTGGGGGTTAAACATT
TACACGTTAGTCGATATATTGACCATTCCAATCGTCATCATTCAAGCATT
GCAACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGACAAGCACGATTT
CGCACACGGAATTCACACGCAGATCTGGCTATTGGAATTATGTCTATACA
GTTTCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTG
AACATGGCGGCGTTCATTTCATATCTATTTATTTCATACGAATTATGGAT
TCAACACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACG
CTCTTGGTATGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTT
TCATCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGG
CAATTTAAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGA
GTATAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATA
CCGGTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCA
AACACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAAATTTACTC
CACCACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAAAGCTGCAC
TGAAGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACG
CTACTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGCATTACTAGAAAA
TACGACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATG
AGAGTTGTTTCAATGAAGAAATATTTCAGTAAATATCACATCCGATGTAT
CGTACAACTTATGCGTCGAGATAATAAGATGAGTGAAGCAGACGCTGTCA
TTGTTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCT
AATATCACAAGGAACTATCCGAGTACACTAATTGAAGGAATCATCCAAAA
ACATCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAG
ATTGTCATCGAGTTAAAGCATGTCATTGTAACAGGTCATATAACAGACGA
ATCTGTCAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTG
AAAGCAATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTA
TACCGGCCATATTTGGCTTCATCTCATCGTACACAAAATATGACAGAAAA
TTCAAAAGTACACCTGGAAAAAAGTGACATTTTCGACGGTGGGTTACGGT
GACTATTCATGTAAAACAATCATGGGACGCATCTTCTGCATGATTTTCAT
CATCTGTGGACTGGTTGAGAATACAGGTGATTTTTGGGCACCACACAATT
ATTCGAATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTCATGATA
GAAATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATGACAGTAGTTC
TTTCGTCGACCGGTATGATACATTTGGATTGAGATTTCTACGTGTAGTAT
ACATACGAAAATTGCCAGATATTCTCATCTACTTAAATTTATTAGAAACG
GGTTTATCATAGCGACAGACAAATTGGCGTTTTGGGGGTTAAACATTTAC
ACGTTAGTCGATATATTGACCATTCCAATCGTCATCATTCAAGCATTGCA
ACAAAAAGCATGGCTTGCCCTATAGAGTATTGCGACAAGCACGATTTCGC
ACACGGAATTCACACGCAGATCTGGCTATTGGAATTATGTCTATACAGTT
TCTTTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAAC
ATGGCGGCGTTCATTTCATATCTATTTATTTCATACGAATTATGGATTCA
ACACTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTC
TTGGTATGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCA
TCTGCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAA
TTTAAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTA
TAAAGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCG
GTAAAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCAAAC
ACATGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCAC
CACATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGA
AGTATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTA
CTTGCAAATCTCTTTGTTATGAGATCAAGCGAAGCATTACTAGAAAATAC
GACGCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGA
GTTGTTTCAATGAAGAAATATTTCAGTAAATATCACATCCGATGTATCGT
ACAACTTATGCGTCGAGATAATAAGATGAGTGAAGCAGACGCTGTCATTG
TTTTGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAAT
ATCACAAGGAACTATCCGAGTACACTAATTGAAGGAATCATCCAAAAACA
TCCTTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATT
GTCATCGAGTTAAAGCATGTCATTGTAACAGGTCATATAACAGACGAATC
TGTCAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAA
GCAATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTATAC
CGGCCATATTTGGCTTCATCTCATCGTACACAAAATATGACAGAAAATTC
AAAAGTACACCTGGAAAAAAGTGACATTTTCGACGGTGGGTTACGGTGAC
TATTCATGTAAAACAATCATGGGACGCATCTTCTGCATGATTTTCATCAT
CTGTGGACTGGTTGAGAATACAGGTGATTTTTGGGCACCACACAATTATT
CGAATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTCATGATAGAA
ATTTATAGAAATTGGGACGGTCGTTGTGAATTTCATGACAGTAGTTCTTT
CGTCGACCGGTATGATACATTTGGATTGAGATTTCTACGTGTAGTATACA
TACGAAAATTGCCAGATATTCTCATCTACTTAAATTTATTAGAAACGGGT
TTATCATAGCGACAGACAAATTGGCGTTTTGGGGGTTAAACATTTACACG
TTAGTCGATATATTGACCATTCCAATCGTCATCATTCAAGCATTGCAACA
AAAAGCATGGCTTGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACA
CGGAATTCACACGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCT
TTGCTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAACATG
GCGGCGTTCATTTCATATCTATTTATTTCATACGAATTATGGATTCAACA
CTTGCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTTG
GTATGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATCT
GCATTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATTT
AAATTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATAA
AGCATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTA
AAAGTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCAAACACA
TGGCGAAATGAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCAC
ATTGTCGGATTATTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGT
ATGGCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTT
GCAAATCTCTTTGTTATGAGATCAAGCGAAGCATTACTAGAAAATACGAC
GCATTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGAGTT
GTTTCAATGAAGAAATATTTCAGTAAATATCACATCCGATGTATCGTACA
ACTTATGCGTCGAGATAATAAGATGAGTGAAGCAGACGCTGTCATTGTTT
TGTGTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAATATC
ACAAGGAACTATCCGAGTACACTAATTGAAGGAATCATCCAAAAACATCC
TTCTTCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTC
ATCGAGTTAAAGCATGTCATTGTAACAGGTCATATAACAGACGAATCTGT
CAGTTCATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGCA
ATGTTACTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTATACCGG
CCATATTTGGCTTCATCTCATCGTACACAAAATATGACAGAAAATTCAAA
AGTACACCTGGAAAAAAGTGACATTTTCGACGGTGGGTTACGGTGACTAT
TCATGTAAAACAATCATGGGACGCATCTTCTGCATGATTTTCATCATCTG
TGGACTGGTTGAGAATACAGGTGATTTTTGGGCACCACACAATTATTCGA
ATAGTAATCCACTCAATTATTTTGAATGTCTGTACTTCATGATAGAAATT
TATAGAAATTGGGACGGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGT
CGACCGGTATGATACATTTGGATTGAGATTTCTACGTGTAGTATACATAC
GAAAATTGCCAGATATTCTCATCTACTTAAATTTATTAGAAACGGGTTTA
TCATAGCGACAGACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTA
GTCGATATATTGACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAA
AGCATGGCTTGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGG
AATTCACACGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTG
CTTTCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAACATGGCG
GCGTTCATTTCATATCTATTTATTTCATACGAATTATGGATTCAACACTT
GCTAACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTTGGTA
TGTTTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATCTGCA
TTCTGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAA
TTACCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATAAAGC
ATGGTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAA
GTGTACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCAAACACATGG
CGAAATGAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATT
GTCGGATTATTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGTATG
GCTTCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTTGCA
AATCTCTTTGTTATGAGATCAAGCGAAGCATTACTAGAAAATACGACGCA
TTGGCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGAGTTGTT
TCAATGAAGAAATATTTCAGTAAATATCACATCCGATGTATCGTACAACT
TATGCGTCGAGATAATAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGT
GTGATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAATATCACA
AGGAACTATCCGAGTACACTAATTGAAGGAATCATCCAAAAACATCCTTC
TTCAGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTCATC
GAGTTAAAGCATGTCATTGTAACAGGTCATATAACAGACGAATCTGTCAG
TTCATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGCAATG
TTACTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTATACCGGCCA
TATTTGGCTTCATCTCATCGTACACAAAATATGACAGAAAATTCAAAAGT
ACACCTGGAAAAAAGTGACATTTTCGACGGTGGGTTACGGTGACTATTCA
TGTAAAACAATCATGGGACGCATCTTCTGCATGATTTTCATCATCTGTGG
ACTGGTTGAGAATACAGGTGATTTTTGGGCACCACACAATTATTCGAATA
GTAATCCACTCAATTATTTTGAATGTCTGTACTTCATGATAGAAATTTAT
AGAAATTGGGACGGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGA
CCGGTATGATACATTTGGATTGAGATTTCTACGTGTAGTATACATACGAA
AATTGCCAGATATTCTCATCTACTTAAATTTATTAGAAACGGGTTTATCA
TAGCGACAGACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTC
GATATATTGACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGC
ATGGCTTGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGAAT
TCACACGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTT
TCCATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAACATGGCGGCG
TTCATTTCATATCTATTTATTTCATACGAATTATGGATTCAACACTTGCT
AACTGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTTGGTATGT
TTATATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATCTGCATTC
TGATTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAATTA
CCGGAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATAAAGCATG
GTATTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTG
TACTTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCAAACACATGGCGA
AATGAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTC
GGATTATTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGTATGGCT
TCATGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTTGCAAAT
CTCTTTGTTATGAGATCAAGCGAAGCATTACTAGAAAATACGACGCATTG
GCGAAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGAGTTGTTTCA
ATGAAGAAATATTTCAGTAAATATCACATCCGATGTATCGTACAACTTAT
GCGTCGAGATAATAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGTGTG
ATAAAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAATATCACAAGG
AACTATCCGAGTACACTAATTGAAGGAATCATCCAAAAACATCCTTCTTC
AGTTTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTCATCGAG
TTAAAGCATGTCATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTC
ATTTATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGCAATGTTA
CTGTTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTATACCGGCCATAT
TTGGCTTCATCTCATCGTACACAAAATATGACAGAAAATTCAAAAGTACA
CCTGGAAAAAAGTGACATTTTCGACGGTGGGTTACGGTGACTATTCATGT
AAAACAATCATGGGACGCATCTTCTGCATGATTTTCATCATCTGTGGACT
GGTTGAGAATACAGGTGATTTTTGGGCACCACACAATTATTCGAATAGTA
ATCCACTCAATTATTTTGAATGTCTGTACTTCATGATAGAAATTTATAGA
AATTGGGACGGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCG
GTATGATACATTTGGATTGAGATTTCTACGTGTAGTATACATACGAAAAT
TGCCAGATATTCTCATCTACTTAAATTTATTAGAAACGGGTTTATCATAG
CGACAGACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGAT
ATATTGACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATG
GCTTGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGAATTCA
CACGCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCC
ATTTCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTC
ATTTCATATCTATTTATTTCATACGAATTATGGATTCAACACTTGCTAAC
TGTTCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTTGGTATGTTTA
TATCTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATCTGCATTCTGA
TTGGTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAATTACCG
GAAGACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATAAAGCATGGTA
TTTGCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTGTAC
TTGGAAAATGTCTGAAAAACAAAGGAAAGAAATCAAACACATGGCGAAAT
GAATATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTCGGA
TTATTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGTATGGCTTCA
TGGCGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTTGCAAATCTC
TTTGTTATGAGATCAAGCGAAGCATTACTAGAAAATACGACGCATTGGCG
AAAAGGCGAAGGTGACACCATCGTTTGCATCGATGAGAGTTGTTTCAATG
AAGAAATATTTCAGTAAATATCACATCCGATGTATCGTACAACTTATGCG
TCGAGATAATAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGTGTGATA
AAAAATCACATAATCCTGAGTCAGAGGATGCTGCTAATATCACAAGGAAC
TATCCGAGTACACTAATTGAAGGAATCATCCAAAAACATCCTTCTTCAGT
TTTCTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTCATCGAGTTA
AAGCATGTCATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTCATT
TATTCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGCAATGTTACTG
TTGTCTTCCTTGCACCGGTGTATTTGCATCTTCTATACCGGCCATATTTG
GCTTCATCTCATCGTACACAAAATATGACAGAAAATTCAAAAGTACACCT
GGAAAAAAGTGACATTTTCGACGGTGGGTTACGGTGACTATTCATGTAAA
ACAATCATGGGACGCATCTTCTGCATGATTTTCATCATCTGTGGACTGGT
TGAGAATACAGGTGATTTTTGGGCACCACACAATTATTCGAATAGTAATC
CACTCAATTATTTTGAATGTCTGTACTTCATGATAGAAATTTATAGAAAT
TGGGACGGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTA
TGATACATTTGGATTGAGATTTCTACGTGTAGTATACATACGAAAATTGC
CAGATATTCTCATCTACTTAAATTTATTAGAAACGGGTTTATCATAGCGA
CAGACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGATATA
TTGACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATGGCT
TGCCCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGAATTCACAC
GCAGATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCCATT
TCCTTCTCAGGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTCATT
TCATATCTATTTATTTCATACGAATTATGGATTCAACACTTGCTAACTGT
TCTGTTACTATCGATTTGCCTAGCAACGAACGCTCTTGGTATGTTTATAT
CTTAGCTTCATTAGCCATTTATGTATCTGGTTTCATCTGCATTCTGATTG
GTCGAATCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAATTACCGGAA
GACGAAAAAGATTCACGGAAGCCGATGGAAGAGTATAAAGCATGGTATTT
GCAACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTGTACTTG
GAAAATGTCTGAAAAACAAAGGAAAGAAATCAAACACATGGCGAAATGAA
TATGTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTCGGATTA
TTTTGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGTATGGCTTCATGG
CGCAATGTTGTTATTCACCTGGTTTTTCAACGCTACTTGCAAATCTCTTT
GTTATGAGATCAAGCGAAGCATTACTAGAAAATACGACGCATTGGCGAAA
AGGCGAAGGTGACACCATCGTTTGCATCGATGAGAGTTGTTTCAATGAAG
AAATATTTCAGTAAATATCACATCCGATGTATCGTACAACTTATGCGTCG
AGATAATAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGTGTGATAAAA
AATCACATAATCCTGAGTCAGAGGATGCTGCTAATATCACAAGGAACTAT
CCGAGTACACTAATTGAAGGAATCATCCAAAAACATCCTTCTTCAGTTTT
CTTCTTCAATGGAACTGTATATAATCTTAAAGATTGTCATCGAGTTAAAG
CATGTCATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTCATTTAT
TCAAGATTTTTTACATCCTGACCGGCAATGTGAAAGCAATGTTACTGTTG
TCTTCCTTGCACCGGTGTATTTGCATCTTCTATACCGGCCATATTTGGCT
TCATCTCATCGTACACAAAATATGACAGAAAATTCAAAAGTACACCTGGA
AAAAAGTGACATTTTCGACGGTGGGTTACGGTGACTATTCATGTAAAACA
ATCATGGGACGCATCTTCTGCATGATTTTCATCATCTGTGGACTGGTTGA
GAATACAGGTGATTTTTGGGCACCACACAATTATTCGAATAGTAATCCAC
TCAATTATTTTGAATGTCTGTACTTCATGATAGAAATTTATAGAAATTGG
GACGGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGA
TACATTTGGATTGAGATTTCTACGTGTAGTATACATACGAAAATTGCCAG
ATATTCTCATCTACTTAAATTTATTAGAAACGGGTTTATCATAGCGACAG
ACAAATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGATATATTG
ACCATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATGGCTTGC
CCTATAGAGTATTGCGACAAGCACGATTTCGCACACGGAATTCACACGCA
GATCTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCCATTTCC
TTCTCAGGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCA
TATCTATTTATTTCATACGAATTATGGATTCAACACTTGCTAACTGTTCT
GTTACTATCGATTTGCCTAGCAACGAACGCTCTTGGTATGTTTATATCTT
AGCTTCATTAGCCATTTATGTATCTGGTTTCATCTGCATTCTGATTGGTC
GAATCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAATTACCGGAAGAC
GAAAAAGATTCACGGAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCA
ACTGAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAA
AATGTCTGAAAAACAAAGGAAAGAAATCAAACACATGGCGAAATGAATAT
GTTCATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTCGGATTATTT
TGAGAATATGTCGTTCCCAAAAGCTGCACTGAAGTATGGCTTCATGGCGC
AATGTTGTTATTCACCTGGTTTTTCAACGCTACTTGCAAATCTCTTTGTT
ATGAGATCAAGCGAAGCATTACTAGAAAATACGACGCATTGGCGAAAAGG
CGAAGGTGACACCATCGTTTGCATCGATGAGAGTTGTTTCAATGAAGAAA
TATTTCAGTAAATATCACATCCGATGTATCGTACAACTTATGCGTCGAGA
TAATAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGTGTGATAAAAAAT
CACATAATCCTGAGTCAGAGGATGCTGCTAATATCACAAGGAACTATCCG
AGTACACTAATTGAAGGAATCATCCAAAAACATCCTTCTTCAGTTTTCTT
CTTCAATGGAACTGTATATAATCTTAAAGATTGTCATCGAGTTAAAGCAT
GTCATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTCATTTATTCA
AGATTTTTTACATCCTGACCGGCAATGTGAAAGCAATGTTACTGTTGTCT
TCCTTGCACCGGTGTATTTGCATCTTCTATACCGGCCATATTTGGCTTCA
TCTCATCGTACACAAAATATGACAGAAAATTCAAAAGTACACCTGGAAAA
AAGTGACATTTTCGACGGTGGGTTACGGTGACTATTCATGTAAAACAATC
ATGGGACGCATCTTCTGCATGATTTTCATCATCTGTGGACTGGTTGAGAA
TACAGGTGATTTTTGGGCACCACACAATTATTCGAATAGTAATCCACTCA
ATTATTTTGAATGTCTGTACTTCATGATAGAAATTTATAGAAATTGGGAC
GGTCGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGATAC
ATTTGGATTGAGATTTCTACGTGTAGTATACATACGAAAATTGCCAGATA
TTCTCATCTACTTAAATTTATTAGAAACGGGTTTATCATAGCGACAGACA
AATTGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGATATATTGACC
ATTCCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATGGCTTGCCCT
ATAGAGTATTGCGACAAGCACGATTTCGCACACGGAATTCACACGCAGAT
CTGGCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCCATTTCCTTC
TCAGGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCATAT
CTATTTATTTCATACGAATTATGGATTCAACACTTGCTAACTGTTCTGTT
ACTATCGATTTGCCTAGCAACGAACGCTCTTGGTATGTTTATATCTTAGC
TTCATTAGCCATTTATGTATCTGGTTTCATCTGCATTCTGATTGGTCGAA
TCTTTTGGAAAGTCATTAAAAAATGGCAATTTAAATTACCGGAAGACGAA
AAAGATTCACGGAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCAACT
GAAAGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAAAAT
GTCTGAAAAACAAAGGAAAGAAATCAAACACATGGCGAAATGAATATGTT
CATGGAGTTTCGTGTGAAATTTACTCCACCACATTGTCGGATTATTTTGA
GAATATGTCGTTCCCAAAAGCTGCACTGAAGTATGGCTTCATGGCGCAAT
GTTGTTATTCACCTGGTTTTTCAACGCTACTTGCAAATCTCTTTGTTATG
AGATCAAGCGAAGCATTACTAGAAAATACGACGCATTGGCGAAAAGGCGA
AGGTGACACCATCGTTTGCATCGATGAGAGTTGTTTCAATGAAGAAATAT
TTCAGTAAATATCACATCCGATGTATCGTACAACTTATGCGTCGAGATAA
TAAGATGAGTGAAGCAGACGCTGTCATTGTTTTGTGTGATAAAAAATCAC
ATAATCCTGAGTCAGAGGATGCTGCTAATATCACAAGGAACTATCCGAGT
ACACTAATTGAAGGAATCATCCAAAAACATCCTTCTTCAGTTTTCTTCTT
CAATGGAACTGTATATAATCTTAAAGATTGTCATCGAGTTAAAGCATGTC
ATTGTAACAGGTCATATAACAGACGAATCTGTCAGTTCATTTATTCAAGA
TTTTTTACATCCTGACCGGCAATGTGAAAGCAATGTTACTGTTGTCTTCC
TTGCACCGGTGTATTTGCATCTTCTATACCGGCCATATTTGGCTTCATCT
CATCGTACACAAAATATGACAGAAAATTCAAAAGTACACCTGGAAAAAAG
TGACATTTTCGACGGTGGGTTACGGTGACTATTCATGTAAAACAATCATG
GGACGCATCTTCTGCATGATTTTCATCATCTGTGGACTGGTTGAGAATAC
AGGTGATTTTTGGGCACCACACAATTATTCGAATAGTAATCCACTCAATT
ATTTTGAATGTCTGTACTTCATGATAGAAATTTATAGAAATTGGGACGGT
CGTTGTGAATTTCATGACAGTAGTTCTTTCGTCGACCGGTATGATACATT
TGGATTGAGATTTCTACGTGTAGTATACATACGAAAATTGCCAGATATTC
TCATCTACTTAAATTTATTAGAAACGGGTTTATCATAGCGACAGACAAAT
TGGCGTTTTGGGGGTTAAACATTTACACGTTAGTCGATATATTGACCATT
CCAATCGTCATCATTCAAGCATTGCAACAAAAAGCATGGCTTGCCCTATA
GAGTATTGCGACAAGCACGATTTCGCACACGGAATTCACACGCAGATCTG
GCTATTGGAATTATGTCTATACAGTTTCTTTGCTTTCCATTTCCTTCTCA
GGGTGGTGACGTCATTTGTCTTGAACATGGCGGCGTTCATTTCATATCTA
TTTATTTCATACGAATTATGGATTCAACACTTGCTAACTGTTCTGTTACT
ATCGATTTGCCTAGCAACGAACGCTCTTGGTATGTTTATATCTTAGCTTC
ATTAGCCATTTATGTATCTGGTTTCATCTGCATTCTGATTGGTCGAATCT
TTTGGAAAGTCATTAAAAAATGGCAATTTAAATTACCGGAAGACGAAAAA
GATTCACGGAAGCCGATGGAAGAGTATAAAGCATGGTATTTGCAACTGAA
AGAGTTCGCTGTCAATCTCGATACCGGTAAAAGTGTACTTGGAAAATGTC
TG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000084XLOC_000084Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000147-exon-sc0000001-1575043694:250047..250162TCONS_00000147-exon-sc0000001-1575043694:250047..250162Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:240389..240767TCONS_00000147-exon-sc0000001-1575043694:240389..240767Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:239139..239203TCONS_00000147-exon-sc0000001-1575043694:239139..239203Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:238601..238709TCONS_00000147-exon-sc0000001-1575043694:238601..238709Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:237763..237877TCONS_00000147-exon-sc0000001-1575043694:237763..237877Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:237021..237096TCONS_00000147-exon-sc0000001-1575043694:237021..237096Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:236263..236338TCONS_00000147-exon-sc0000001-1575043694:236263..236338Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:235167..235253TCONS_00000147-exon-sc0000001-1575043694:235167..235253Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:233689..233778TCONS_00000147-exon-sc0000001-1575043694:233689..233778Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:233235..233326TCONS_00000147-exon-sc0000001-1575043694:233235..233326Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:232537..232650TCONS_00000147-exon-sc0000001-1575043694:232537..232650Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:231556..231661TCONS_00000147-exon-sc0000001-1575043694:231556..231661Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:230741..230823TCONS_00000147-exon-sc0000001-1575043694:230741..230823Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:230408..230483TCONS_00000147-exon-sc0000001-1575043694:230408..230483Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:229525..229590TCONS_00000147-exon-sc0000001-1575043694:229525..229590Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:224684..224770TCONS_00000147-exon-sc0000001-1575043694:224684..224770Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1575043694:224278..224398TCONS_00000147-exon-sc0000001-1575043694:224278..224398Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:250047..250162TCONS_00000147-exon-sc0000001-1510915933:250047..250162Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:240389..240767TCONS_00000147-exon-sc0000001-1510915933:240389..240767Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:239139..239203TCONS_00000147-exon-sc0000001-1510915933:239139..239203Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:238601..238709TCONS_00000147-exon-sc0000001-1510915933:238601..238709Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:237763..237877TCONS_00000147-exon-sc0000001-1510915933:237763..237877Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:237021..237096TCONS_00000147-exon-sc0000001-1510915933:237021..237096Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:236263..236338TCONS_00000147-exon-sc0000001-1510915933:236263..236338Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:235167..235253TCONS_00000147-exon-sc0000001-1510915933:235167..235253Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:233689..233778TCONS_00000147-exon-sc0000001-1510915933:233689..233778Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:233235..233326TCONS_00000147-exon-sc0000001-1510915933:233235..233326Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:232537..232650TCONS_00000147-exon-sc0000001-1510915933:232537..232650Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:231556..231661TCONS_00000147-exon-sc0000001-1510915933:231556..231661Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:230741..230823TCONS_00000147-exon-sc0000001-1510915933:230741..230823Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:230408..230483TCONS_00000147-exon-sc0000001-1510915933:230408..230483Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:229525..229590TCONS_00000147-exon-sc0000001-1510915933:229525..229590Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:224684..224770TCONS_00000147-exon-sc0000001-1510915933:224684..224770Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1510915933:224278..224398TCONS_00000147-exon-sc0000001-1510915933:224278..224398Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:250047..250162TCONS_00000147-exon-sc0000001-1491911889:250047..250162Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:240389..240767TCONS_00000147-exon-sc0000001-1491911889:240389..240767Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:239139..239203TCONS_00000147-exon-sc0000001-1491911889:239139..239203Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:238601..238709TCONS_00000147-exon-sc0000001-1491911889:238601..238709Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:237763..237877TCONS_00000147-exon-sc0000001-1491911889:237763..237877Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:237021..237096TCONS_00000147-exon-sc0000001-1491911889:237021..237096Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:236263..236338TCONS_00000147-exon-sc0000001-1491911889:236263..236338Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:235167..235253TCONS_00000147-exon-sc0000001-1491911889:235167..235253Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:233689..233778TCONS_00000147-exon-sc0000001-1491911889:233689..233778Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:233235..233326TCONS_00000147-exon-sc0000001-1491911889:233235..233326Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:232537..232650TCONS_00000147-exon-sc0000001-1491911889:232537..232650Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:231556..231661TCONS_00000147-exon-sc0000001-1491911889:231556..231661Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:230741..230823TCONS_00000147-exon-sc0000001-1491911889:230741..230823Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:230408..230483TCONS_00000147-exon-sc0000001-1491911889:230408..230483Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:229525..229590TCONS_00000147-exon-sc0000001-1491911889:229525..229590Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:224684..224770TCONS_00000147-exon-sc0000001-1491911889:224684..224770Clytia hemisphaericaexon
TCONS_00000147-exon-sc0000001-1491911889:224278..224398TCONS_00000147-exon-sc0000001-1491911889:224278..224398Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000147-proteinTCONS_00000147-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:224278..250162 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 3.43218 3.50132 4.56038 3.28701 3.6298 3.17948 1.82266 2.12607 3.19441 2.60896 0.885337 1.06242 0.677121 0.876782 3.40857 2.59873 1.91863 0.532409 1.99914e-06 0.968073 7.23314e-05 0.0017016 0 0.330136 1.11048 1.12733e-05
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR013099K_chnl_dom
IPR003929K_chnl_BK_asu
Vocabulary: Biological Process
TermDefinition
GO:0006813potassium ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0005249voltage-gated potassium channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006813 potassium ion transport
cellular_component GO:0016020 membrane
cellular_component GO:0008076 voltage-gated potassium channel complex
molecular_function GO:0005249 voltage-gated potassium channel activity
Blast
BLAST of TCONS_00000147 vs. Swiss-Prot (Human)
Match: KCMA1 (Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 381.333 bits (978), Expect = 1.805e-117
Identity = 218/559 (39.00%), Postives = 330/559 (59.03%), Query Frame = 1
Query:  238 VTIDLPSN---ERSWYVYILASLAIYVSGFICILIGRIF---WKVIKKWQFKLPEDEK---------DSRKPMEEYK-------AWYLQLKEFAVNLDTGKSVLGKCLVVTSFVLNMAAFISYLFISYEFPIEYCDKHDFAHGIHTQIWLLELCLYSFFAFHFLLRFIIATDKLAFWGLNIYTLVDILTIPIVIIQALQQKAWLGLRFLRVVYIRKLPDILIYLNLLETGKFIEIGTVVVNFMTVVLSSTGMIHLVENTGDFWAPHNYSNSNPLNYFECLYFMIVTFSTVGYGDYSCKTIMGRIFCMIFIICGLGVFASSIPAIFGFISSYTKYDRKFKSTPGKKHVIVTGHITDESVSSFIQDFLHPDRQCESNVTVVFLAPNYPSTLIEGIIQKHPSSVFFFNGTVYNLKDCHRVKMSEADAVIVLCDKKSHNPESEDAANITRVVSMKKYFSKYHIRCIVQLMRRDNKALLENTTHWRKGEGDTIVCIDELKYGFMAQCCYSPGFSTLLANLFVMRSSEKNKGKKSNTWRNEYVHGVSCEIYSTTLSDYFENMSFP 1848
            VT+++P +   +R W+ ++ +S+  +  G   IL+ R     W V      K  E +K          + KP++E +        W   +K++A  + + +++ G+ LVV  F L++ A + Y FI    PIE C   +F      QI   ++    FF  +F LRFI A DKL FW L + ++VD  T+P V +     ++WLGLRFLR + + +  +IL +LN+L+T   I++  ++  F++  L++ G IHLVEN+GD W   N+ N+  L Y+EC+Y ++VT STVGYGD   KT +GR+F + FI+ GL +FAS +P I   I +  KY   + +  G+KH++V GHIT ESVS+F++DFLH DR  + NV +VFL    P+  +E + ++H + V F+ G+V N  D  RVK+  ADA ++L +K   +P++EDA+NI RV+S+K Y  K  IR I Q+++  NKA L N   W   EGD  +C+ ELK GF+AQ C + G ST+LANLF MRS  K    + +TW+  Y+ GVS E+Y+  LS  F  +SFP
Sbjct:   73 VTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIY-FIDSSNPIESC--QNFYKDFTLQI---DMAFNVFFLLYFGLRFIAANDKLWFW-LEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPW--ENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRD-DVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPK--IRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIK---IEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFP 616          
The following BLAST results are available for this feature:
BLAST of TCONS_00000147 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCMA11.805e-11739.00Calcium-activated potassium channel subunit alpha-... [more]
back to top