Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000130 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000130
Unique NameTCONS_00000130
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1124

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000130 ID=TCONS_00000130|Name=TCONS_00000130|organism=Clytia hemisphaerica|type=transcript|length=1124bp
AAAAACGATATATATTCAGGTAGTGCAGAAAAACAACACGATTCTCAAAA
ATCAAGATGGCGCATCTAACCAATGATCCAAGTCATCAACAACGTTGGAT
TTGCATCTATCCAGCTTACTTAAACAGCAGAAGAACACAAGTTGAAGGTA
GAAAGtgaaaataataacaatgagCTCTTACGCAAGAAGAATGGCAATGC
TCAGCGCAAAAATCTTTGGAAATCTACCAAGGCCTGTATCTGAAAGATCA
CAAAAGGTAATTGATCATTTCAAAGCAGCTCCACTTGGTCCAGTTCATGC
CAACTACTACCCACCACTGAAGCAATATAATTCTTTGCTTCGAAAGTTAC
GTTTCCTTGGAATCTATCATGATGAACATATGGATTTTGTTGAAGAAATG
GCACACAAGAGAAAGCTTCGTGGAAAAGGACCTCCACCCAAAGgtcAAGG
CAAAAGATCCAAAAAGAAGTAAAGCTGACATATGTATGTATTTGCGAATG
GTTTGTGTGTGATTTTTACTCCACTTGAAGATATCTTTATCCACTGATGC
ACTTAGATATGTTGAAAGTTTTGGCATCCGAACAACATCTTACAGTATTC
CTTTTCAGAACTATTGTTTTTAATAGACGAAAACCCCAAACTCAATACTT
ATTACTGGAACATATCCAAATAATGATTTGCGTGTGATCTTTGAGAGAGA
TGAACATTAGATATATTTTTAACGCGGGCGCACGGAAGTAGAAACAAATT
TCGGAACTTTTCCAACTGTTTAATTTTTATCTCCGTAATAGGAAATCACT
AAAATCACTACCGGTTCTTTCATATTCTCTGAAAGtcctttgtttgaaaa
aaaaaatgcgaatttaaatttatgcaataagTTCTAAGATTTATTCAAGT
TAACTTTGACTTCCCTTCTTTGAATTTATTGGCCACGATGCTGCTATATT
ATGTAGTATGTAAGCATCTGATTTatcaaaaaatgtataattgCGCAAGC
TAAACTCAATTAGACTAGAAGATTTTATTCTGTTGGTTGATAATGAATGA
ATGAtatatttttagtattttttataCGTGAAGCTGTAGATAGAGAAAAT
ATTATTCCAACTTCGACATTCAAG
Run BLAST on NCBI

protein sequence of TCONS_00000130-protein

>TCONS_00000130-protein ID=TCONS_00000130-protein|Name=TCONS_00000130-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bp
MSSYARRMAMLSAKIFGNLPRPVSERSQKVIDHFKAAPLGPVHANYYPPL
KQYNSLLRKLRFLGIYHDEHMDFVEEMAHKRKLRGKGPPPKGQGKRSKKK
Run BLAST on NCBI

transcript from alignment at sc0000001:2711891..2719356+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000130 ID=TCONS_00000130|Name=TCONS_00000130|organism=Clytia hemisphaerica|type=transcript|length=7466bp|location=Sequence derived from alignment at sc0000001:2711891..2719356+ (Clytia hemisphaerica)
AAAAACGATATATATTCAGGTAGTGCAGAAAAACAACACGATTCTCAAAA ATCAAGATGGCGCATCTAACCAATGATCCAAGTCATCAACAACGTTGGAT TTGCATCTATCCAGCTTACTTAAACAGCAGAAGAACACAAGTTGAAGGTA GAAAGGTATCTAAGTCTAAAGCTGTTGATAATCCTAAAGTTAATGAAATC AAAGATGTTTTAACCTACCACAAATTCAATTTTGTTGTTGAGGAAACAAA GCAATATCCTCGAGACAGTTTCAAAGATGCGTTTTGCAAGGGGCGAGTTC GAGTTCAATTGAAAAATAGTGATGGTACACCATTTAATAAAGAATTTACA AcaagaaaagaaatactttatATGCTGGGGGATATGATTCCAAAACTGAA AGGAAGGCAAACTAAAGGGGCAACAGCAGGTGATTCAAATCAATCGTCTG GTTCGAGCAGCAACAAGAAAGGAAAGAAGAAACGTTGATTATTTTACTTT GTACTTGCTATAGGAAATATAGTTTATGACAACTTTTAGATATGAAATTT TGATGTTGCAAATATGAAATGAACCTTTTGCTATAATCAATATATTATGT catgtatataatatatatgTTGAATAAATTAAAGAAACACAAGCATCAAA AACAATgatcagaaaaaaattggtgCATACTTATGATAATTACCATAACT TTGTGTAATGCTGACACACCTTGAAGTCATGCATAGCCcacaaatgaatg acctggctggtcattaaaaaatacaaagttaaattaaaacaaaaatggta gagtagagctgcgagtagagctgcgtagttcatttgttttgaaattttgc tgctttgattggtctgtcatttgatggctatgaaagtttccctccactga ttcaagttacccaacttcacggtaccttgtctaattcagtcatagcaact atctggtctgcaaagtaAATGGAGTAATANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtgcgtagttcatttgtt ttgaaattttgctgctttgattggtctgtcatttgatggctatgaaagtt tccctccactgattcaagttacccaacttcacggtaccttgtctaattca gtcatagcaactatctggtctgcaaagtaAATGGAGTAATTCTTTAAAAA GCTTTCTCAGGTCAGAAGGTTCTGTTTATTTTCACAGTGTAAACAGGGTT ATTTTAAAAACCATGGTATCCCAATTGGTGAATGACTATGGTGGCATTAA ACCAAGATATATACAATATGCTTTACTTTGTCATTGTTTCAAAATACTGG AGTTTATGATTTATTTGACATGTaatcctgattagcaaaaggtctaGAGA ATGTCACCCTTCAAATgtctttaaacatttttaactGTTTAATGATGACC GGGTTGAGGACAGTTGAGGATAAAaagcttggaaaatatttttttttaac tggAAACATTCTCCTGTCTTTATTTAACATCCCCTGGCAGCAGCTATAAA GTTTAAAAGCTTATGATTACATGTGCTGTGGATTGATTGTTAAGTTCAAA TTTTTCATATATTAAATTTTCTTATagtgaaaataataacaatgagCTCT TACGCAAGAAGAATGGCAATGCTCAGCGCAAAAATCTTTGGAAATCTACC AAGGCCTGTATCTGAAAGGTAACAATTTTAAGATCTGAATTTTAGGCTGG ACCTGGAATTTGTCGGTCGCttaggaaaaaaagttattttgacgATTTAT GAAAGTTCTGTTTACAATTTCCCAAATGAAAACGAAAGAGCTAGAGCGAG ATTAACACGATTGAGGTTTTGATtcggaagaaaaaaattgtttatcgAGT TAGGATCGGTCAGATTACGAAGTAatccctgaatactaatgtatcaacta ctaacgaacaaaacttgatttacaagtgtgaatatctaaccaaacgacgt ttgataaacggtcaacttgattttctttatgatgaaccatataaGAGCAC GAGTCTGCTAATGTCAcccattttcggttttgtcaacttttcaactttaa ggatccagtgaaaaatctaggtgCATGCAATAATGATACCagctgatgtt ttttatcagtCTTGATACTGGTAAGcttaaacagtcatttttttcacttt acaaagtacacaattttttcagggcagcttttttcatcaaaatgtgaacg gaaaatgaggtttttagcAAATTGTCTAAGTTCATTATTTAATAATCTAG GCCAATCATGTCTGATcatacttaatttttctttttattaNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAATTATCc aggaataaaagtgaaattcaaaactttattttttccaaattttttcaccT ATTTGGGTGACATTACCAGACTCATGCTCATAAATGAACTCATAGTCTGC AGCTGggagaaattttcttttttttcccagccggtttccggaaacgctac attttttattttcgccttagaGTGAATTTATTGACATTGATGTTTTATTA TGTTCTTTGCATCAGATCACAAAAGGTAATTGATCATTTCAAAGCAGCTC CACTTGGTCCAGTTCATGCCAACTACTACCCACCACTGAAGCAATATAAT TCTTTGCTTCGAAAGTTACGTTTCCTTGGAATCTATCATGATGAACATAT GGTTAGTACTTACCCAGCTTGtccacaacgttgtttcaacgttcttctaa cgttatatggacgctgtgaacattagataaacgttgaaacaacgttctgt gccagctgggtatctgaaaaattttgtttcttaataatttacaaaaaatc acaaaacagttttttgatGTTAGAAAAGTAACTCTTCACTACTGCTACGC AtatcattttgaatttgttgCGACGTATATGTCTCCTTTTCGAAATAAGT ATTTCGACTCAAATTCtatcaatattttgattatttagGATTTTGTTGAA GAAATGGCACACAAGAGAAAGCTTCGTGGAAAAGGACCTCCACCCAAAGG TAACAATCATTGTACCAGACACTTTTTTAGATAGTTTTATCGTGCTTCTC CTAAGTTTATTCTTTTAAGTGGATTGATTTTCACTAGCACAgaaaatttt cgcgaatcagcctctTTTAGGTATTATTTCTTTCCTGACGGTTTTAGTAA AAGAATTTGCAATAATTTTATTTCGCGAGTTTcgtgaatttttaaaattt ttccgaaCATTAAATTCGTGAATTTTCGGAAAAACCCTCGAAACTGATTA CATTAAGAAAATAGAGTCGATGTTGTAGGAATATTTCGACGATCTttatg tcatcattttcaaccatATGAACATCGActctattttcttgttgtttttt atttaaaaatccaaggaaatgtttatttttgggttatgcttctttttata ctttttgaaattgtctggCACTGTTGGATTTTGATTACATTATGTAATTA TGATtaacttttgtttattttattattattattaggtcAAGGCAAAAGAT CCAAAAAGAAGTAAAGCTGACATATGTATGTATTTGCGAATGGTTTGTGT GTGATTTTTACTCCACTTGAAGATATCTTTATCCACTGATGCACTTAGAT ATGTTGAAAGTTTTGGCATCCGAACAACATCTTACAGTATTCCTTTTCAG AACTATTGTTTTTAATAGACGAAAACCCCAAACTCAATACTTATTACTGG AACATATCCAAATAATGATTTGCGTGTGATCTTTGAGAGAGATGAACATT AGATATATTTTTAACGCGGGCGCACGGAAGTAGAAACAAATTTCGGAACT TTTCCAACTGTTTAATTTTTATCTCCGTAATAGGAAATCACTAAAATCAC TACCGGTTCTTTCATATTCTCTGAAAGtcctttgtttgaaaaaaaaaatg cgaatttaaatttatgcaataagTTCTAAGATTTATTCAAGTTAACTTTG ACTTCCCTTCTTTGAATTTATTGGCCACGATGCTGCTATATTATGTAGTA TGTAAGCATCTGATTTatcaaaaaatgtataattgCGCAAGCTAAACTCA ATTAGACTAGAAGATTTTATTCTGTTGGTTGATAATGAATGAATGAtata tttttagtattttttataCGTGAAGCTGTAGATAGAGAAAATATTATTCC AACTTCGACATTCAAG

Coding sequence (CDS) from alignment at sc0000001:2711891..2719356+

>TCONS_00000130 ID=TCONS_00000130|Name=TCONS_00000130|organism=Clytia hemisphaerica|type=CDS|length=1212bp|location=Sequence derived from alignment at sc0000001:2711891..2719356+ (Clytia hemisphaerica)
atgagCTCTTACGCAAGAAGAATGGCAATGCTCAGCGCAAAAATCTTTGG
AAATCTACCAAGGCCTGTATCTGAAAGATCACAAAAGGTAATTGATCATT
TCAAAGCAGCTCCACTTGGTCCAGTTCATGCCAACTACTACCCACCACTG
AAGCAATATAATTCTTTGCTTCGAAAGTTACGTTTCCTTGGAATCTATCA
TGATGAACATATGGATTTTGTTGAAGAAATGGCACACAAGAGAAAGCTTC
GTGGAAAAGGACCTCCACCCAAAGgtcAAGGCAAAAGATCCAAAAAGAAG
TAAatgagCTCTTACGCAAGAAGAATGGCAATGCTCAGCGCAAAAATCTT
TGGAAATCTACCAAGGCCTGTATCTGAAAGATCACAAAAGGTAATTGATC
ATTTCAAAGCAGCTCCACTTGGTCCAGTTCATGCCAACTACTACCCACCA
CTGAAGCAATATAATTCTTTGCTTCGAAAGTTACGTTTCCTTGGAATCTA
TCATGATGAACATATGGATTTTGTTGAAGAAATGGCACACAAGAGAAAGC
TTCGTGGAAAAGGACCTCCACCCAAAGgtcAAGGCAAAAGATCCAAAAAG
AAGTAAatgagCTCTTACGCAAGAAGAATGGCAATGCTCAGCGCAAAAAT
CTTTGGAAATCTACCAAGGCCTGTATCTGAAAGATCACAAAAGGTAATTG
ATCATTTCAAAGCAGCTCCACTTGGTCCAGTTCATGCCAACTACTACCCA
CCACTGAAGCAATATAATTCTTTGCTTCGAAAGTTACGTTTCCTTGGAAT
CTATCATGATGAACATATGGATTTTGTTGAAGAAATGGCACACAAGAGAA
AGCTTCGTGGAAAAGGACCTCCACCCAAAGgtcAAGGCAAAAGATCCAAA
AAGAAGTAAatgagCTCTTACGCAAGAAGAATGGCAATGCTCAGCGCAAA
AATCTTTGGAAATCTACCAAGGCCTGTATCTGAAAGATCACAAAAGGTAA
TTGATCATTTCAAAGCAGCTCCACTTGGTCCAGTTCATGCCAACTACTAC
CCACCACTGAAGCAATATAATTCTTTGCTTCGAAAGTTACGTTTCCTTGG
AATCTATCATGATGAACATATGGATTTTGTTGAAGAAATGGCACACAAGA
GAAAGCTTCGTGGAAAAGGACCTCCACCCAAAGgtcAAGGCAAAAGATCC
AAAAAGAAGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000072XLOC_000072Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000130-exon-sc0000001-1491911889:2711891..2712045TCONS_00000130-exon-sc0000001-1491911889:2711891..2712045Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1510915933:2711891..2712045TCONS_00000130-exon-sc0000001-1510915933:2711891..2712045Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1575043694:2711891..2712045TCONS_00000130-exon-sc0000001-1575043694:2711891..2712045Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1491911889:2714968..2715058TCONS_00000130-exon-sc0000001-1491911889:2714968..2715058Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1510915933:2714968..2715058TCONS_00000130-exon-sc0000001-1510915933:2714968..2715058Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1575043694:2714968..2715058TCONS_00000130-exon-sc0000001-1575043694:2714968..2715058Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1491911889:2717706..2717841TCONS_00000130-exon-sc0000001-1491911889:2717706..2717841Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1510915933:2717706..2717841TCONS_00000130-exon-sc0000001-1510915933:2717706..2717841Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1575043694:2717706..2717841TCONS_00000130-exon-sc0000001-1575043694:2717706..2717841Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1491911889:2718129..2718189TCONS_00000130-exon-sc0000001-1491911889:2718129..2718189Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1510915933:2718129..2718189TCONS_00000130-exon-sc0000001-1510915933:2718129..2718189Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1575043694:2718129..2718189TCONS_00000130-exon-sc0000001-1575043694:2718129..2718189Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1491911889:2718676..2719356TCONS_00000130-exon-sc0000001-1491911889:2718676..2719356Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1510915933:2718676..2719356TCONS_00000130-exon-sc0000001-1510915933:2718676..2719356Clytia hemisphaericaexon
TCONS_00000130-exon-sc0000001-1575043694:2718676..2719356TCONS_00000130-exon-sc0000001-1575043694:2718676..2719356Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000130-proteinTCONS_00000130-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:2711891..2719356 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
41.709 40.0513 25.8857 24.3263 27.0592 18.2822 28.1973 28.1322 27.6054 24.3602 22.7785 20.3186 14.6182 12.0745 20.9564 19.563 37.8942 35.1396 6.88325 10.8258 30.5087 28.9884 42.7351 40.292 13.8611 19.7106 25.2786 18.7392 27.8405 25.9044
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013219Ribosomal_S27/S33_mit
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000130 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top