Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000130-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000130-protein
Unique NameTCONS_00000130-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length100

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000130-protein ID=TCONS_00000130-protein|Name=TCONS_00000130-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bp
MSSYARRMAMLSAKIFGNLPRPVSERSQKVIDHFKAAPLGPVHANYYPPL
KQYNSLLRKLRFLGIYHDEHMDFVEEMAHKRKLRGKGPPPKGQGKRSKKK
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000072XLOC_000072Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000130TCONS_00000130Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013219Ribosomal_S27/S33_mit
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013219Ribosomal protein S27/S33, mitochondrialPFAMPF08293MRP-S33coord: 3..91
e-value: 2.2E-20
score: 72.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..100

Blast
BLAST of TCONS_00000130-protein vs. Swiss-Prot (Human)
Match: RT33 (28S ribosomal protein S33, mitochondrial OS=Homo sapiens GN=MRPS33 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.766e-19
Identity = 38/86 (44.19%), Postives = 52/86 (60.47%), Query Frame = 0
Query:    1 MSSYARRMAMLSAKIFGNLPRPVSERSQKVIDHFKAAPLGPVHANY--YPPLKQYNSLLRKLRFLGIYHDEHMDFVEEMAHKRKLR 84
            +S YA RM+ LSA++FG + RP + +S KV+  F   PL      Y  YP    Y  L++ LRFLG+Y DEH DF++E    +KLR
Sbjct:    4 LSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLR 89          
The following BLAST results are available for this feature:
BLAST of TCONS_00000130-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RT331.766e-1944.1928S ribosomal protein S33, mitochondrial OS=Homo s... [more]
back to top