Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000130-protein ID=TCONS_00000130-protein|Name=TCONS_00000130-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00000130-protein vs. Swiss-Prot (Human)
Match: RT33 (28S ribosomal protein S33, mitochondrial OS=Homo sapiens GN=MRPS33 PE=1 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.766e-19 Identity = 38/86 (44.19%), Postives = 52/86 (60.47%), Query Frame = 0 Query: 1 MSSYARRMAMLSAKIFGNLPRPVSERSQKVIDHFKAAPLGPVHANY--YPPLKQYNSLLRKLRFLGIYHDEHMDFVEEMAHKRKLR 84 +S YA RM+ LSA++FG + RP + +S KV+ F PL Y YP Y L++ LRFLG+Y DEH DF++E +KLR Sbjct: 4 LSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLR 89 The following BLAST results are available for this feature:
BLAST of TCONS_00000130-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|