TCONS_00000119 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000119
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4916

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000119 ID=TCONS_00000119|Name=|organism=Clytia hemisphaerica|type=transcript|length=4916bp
TTTTAGTGTACTGACAGAATAATaacaaataaaagcaaaatttccaattt
tggaaaatttagatTTGTTATGAAGAAAAGGAAGTCCACTTTGTAAACAT
TGGTGAGAGTCTGGgtgaataaaaaaagaatatatttggGATATTGTTAT
TCAAAATGACTGATTTCAAATACCTTGGATTTATATTGTTAACAATCTTT
ATACTATGGTTGCCTTTTGGTCAAGCAAGCAATGAAGTATATAATTACCG
TCAGCTACGGGAATCTGACTTCCAAGGAATAGCTGATAAAATTCATACAA
AAATCCGTGATTATGCTAAAAAGACTTTACAAGCTGAGAAAATTGAAGAA
CAATTGAAGAAATTGAATTACATTGTTAAAACTGTAGATGGTCAAACATT
AGAAACGGATTTCTCAGCTGGTCTTGAATCGGTTTTTAAcggaaaacaaa
aaatcttggaaaatATTAAACATAAGGCTGAAAAAGCTGAAATGGATTAT
AATTATGATCAAACATTTGACGAAGAGCATGCTTATTTTAATATGCGTGA
TATCAAAACACAATACAATGAAAATCAATCTCTGGTAATTGTACCCAAAT
TTTCAGATAATGTTCGTGTTAATTTCACGCATAGCTTTGTACAAGTACCG
ACGAACGTGTACGCGTACAAAAAGTCCGTTTTAGATCAGGTAACATGGGG
AGCTGAATTGGATGAAACATTTGAAGGCAATTTTAAGAACTCGAGTGGAT
CGCTGTTGTATCAATACTTTGGAGATGCTTCTACAGGTATCTTCCGCATC
TTTCCTGGAAACATTATGGGAGTGAAAGAAGATGAACATAAAACGGATTT
GTACGATTGTCGGCGACGTGTGTGGTATATCCAAGCAGCTGCTAGTGCAA
AAGATATCGTCATTGTCCTCGATCTTTCTGGTTCTATGATCGGAAATAAT
ATTGGTATTGCAAAGATTGCTATCTCATCTTTGATTGACACATTACAAGa
gaatgattattttaatgtcatCACCATCAACACTGAAGTCAAATACATTG
TCCCATGTATCAAATATTTGATCCAAGCCaccaaagaaaataaagaaatg
atgAAAAGGGTAGTACAAAATCTCACGGAGGCAGCCGAAATTGTGGATGT
CAACAAAGGCATGGACGAAGCATTTAAGATACTAAATATCGGTCCTTCAA
TCAATCGTACATCTGCTGGTTGCAACAAAGCCATCATGTTCGTTACTGAC
GGGATAGAAGGAACTTACGCCGGACAAGAATCATTCGAGAAAAACAACCC
AAATAAAGATGTACGGGTATTCTCATACCTTGTCGGCCGAATCAAAAACC
CGAACGAGAAAGCACTGAAAAAGATGTCGTGTGAAAATAATggttttttc
tataaaatcgaAACATTAGGAAATATATGGGATACCGTTCTGGATTATAT
TCGGGTTATGAGTCGCCCGTTAATCCCGAATTTAAAAGACAGTGGTCGGA
AAGAACTCAAGCCAACATATACACCAGCATACCTGGATAGTGCTGGTTTT
GGCATGGTTATGACAATCTCTTTAAgcgttttcaagaaaataagtTATAT
TCATAATGAAGACCCAAATGACGTCAGATATTTGTATGAAGGTTTCTTAG
GTGTAGCTGGTACAGACATATCTTTGAAGAATTTGAAGGACCAAGTTGAT
CAATCCAAACTTGGTGTTTTTAGTCGTGGTTTTGTTATCAATAAcaatgg
ttttgttttgattcatcCGAAATTCCGTGACCAGTCTGGCTATCTTCCTG
TTCCCCCAAATGTCCTTATCGATGAGTTAGAATCAGCTCAGGATCAAGAA
GATACGAGTGCACTAAAGAAGCAAATGTTGAAATTAACGGCTGATGACCT
TGAAGGTGGTCCTGTCGAATTCATTACCCGGTCAACTTATGATGATGGTC
GAAAAGTGTATTCAGGCAAAACAAAATATTGGTATAAATTGCTTCCTGAT
GCTGATTTGGTTTCCGCCCTTGCATTGGATGAGATTGATAATACTTACTT
AGCTGTTGATGAATCGACACTCGAATTAAAGGCGATCAAGGAAAAAGGAA
TCGAAGCCTTAAAGCCACCAGTCGATGACTTTGACTATGATTATTGGAAT
TTGACAAAAACCAACACGTCATTTGTTACAATTGCACCATGGAATTATTG
CAACTTACCCGAATCATTACATAATAAACCACTTGGTATGAAATTCTACC
CAACGGTTGGCGAGATCTACACATTCATGAGTAAAAATCCAACTGATTAT
GAAAAGCATTGTAAAGATAAAGAGTTGGTAACTCGGCTTTTAGCAATGGC
TGGTGTAACGAGTGAAACTGTGGATAAAATTTGGAGTCAATTCCAGTTTG
ATGAAGACCCTGATATGATTCAAGGAGCTTTCTTTGCAACCTCCAGTGga
tatcaaaaatatttgtctTACCATAATCACACAGATCCTTCACCGCCCTT
CAATCGTGATATTTTACGGACCAAAGTATTTGAGACTCCAATCACAAACC
CGGATATTAATCTCTTTTTATCATCGTCAGCGCGTGACAAGACTGTAGGA
CCAGTAAAGATCTCAATCATGCATCCTTTTTGGAAGCAAAAGAACATTGC
AGCAGtaaccGGTATTGAAATCAACAGTCAACTCATTTACAATTACTTAA
TGGaatcggcagaaataaaaatgaCTGAATTCAGTACATTAGCTATCTGT
AAAGATACTGAGAACGCTTTTTGTGGTGTCATTGACGAACATGGATACAT
CATCACTAGCAACCAAGGAGAGGCTTACACAGGACAATTTATCGGGGAAC
GCTTAGGAGAAATAGTCGATGCTCTACCGTTCTTTACCAAAATTGAGCTT
GAAGATGCACAAGCAGAGTGTCCGCTATCAGACGAAGTTTCCGCCGCAAA
TATTTTGCTGACGCCTGCAAAATTAATTTTCGGTTTTATTACCGGGCTTT
GTAAAACATGTTATTGGTTGGTTATTCAATTTggtattgttttgatttca
ttgtTTGAGCATGCGCAAAGAGTTTATGCGGAAGTACCAAAAACAATACG
GGTAAGTTGTACCAAAACAATGCCGTTTTACCAATTCGATATGAGTAAaa
tccagaatggaaaaatattcCAGGAAACGTATAAATGTGAAGATTGTTCG
GATAAAACAAAGGACTTTAAATTAATTCGAATCAATGATACTAATACAAT
GCTATTGATGGCTGAAGCAGACTCTAATTGTTGTTATAAGAAGCGAGTTA
GTATGAATCACGTTAAAAAAGACTCGACCATTGATTGGTGTAATCCGCCC
GAGCAACCGTACAGGCGGTCGCCCGCTGTTTGTTTGAACGATACGACTTC
AAAACCGGAGAATGCTAAATGTGGCTCTGGATTTGTtgaaaaaccatcaa
ttttGGTTTTAACGATAGCTTTTATGTTAGTGTGTTTCGTTTTTGGATAA
ACCAAAGTTAAGCATCCATGTGCATAGTTATTGAGAAAAATatggaatat
ttttataaatgtggAATTTCGCTGACTTCTGGCTTAGTCAGTAGTAACTC
AATCACTGCAAACGTTTTTGTTGAGAAAATGGCTTTAATTATAAGGAACT
TTTGAAATAATGATGAAGTATCTTAAAATTTGCGGAAAAATTTGCGTTAT
AAATGATATATTACATTTCCGTAAAAAATGTTTCCGTACGTTTCTAAAAG
ATGGCAAAATAATCTGAGTAAAATAACAGAGTTGTGGAGTTACACATTTC
AAAGCTTGGGCAAAAACACATCCATCGCATATCAAGAGGATTTTCTTGGt
tatttttgagttattttacCTTAAAAGACACTAGTTTCTAGCAATGAGGA
ATGAAATTTTGGGCAACTACAATTATAATTTCCTTAAAGcaatatccaaa
aattttcaaatttacaatATAAGAATGTACTCTATAAGAATAATCAAAAT
GAAATCAGATATATTTCAAATTTAGGTCCAATTTGGATCCTTATCTAAGT
AAGAATACCTGAAGAATATTTAAGGATAATTTTTCCCaaaagagttaaaa
atttcaataatgaAATGGAGAAAGAtcattcttatgaaaaagcgtgtatg
tgcAAAATGGAATAACTATAGCGAAGGTGCCTCATTGCatgaaacaaagg
aaaaataTCAACCTATTTGGACGTCCAAATAACGTCGTTTCTACGTTAca
ttaaatttctaaaaagaaggataatttaaaaacaatgttGATCCCTTGAA
TGTGCTTTAAACAAATTACGGCTTATATTAATAGAAATAGTGTGATAAAC
CTGTAGTATTTAAGTTTTACCAAAGAAATAAGAACGAGGACAATTTTACT
CTCAGAAGTGCGACAAAAGAGCAGCTGagcctcatcaaaaatttactggt
tcttataaaaaagggtgtATAATACAAGGGCTTGCAAATGTCTGGTTTTC
CTGTATAATTACGCACTGCTGAGAAATCTTCATTCATACAATAGagcttt
atatatttttgtttacatacttactatataattattttatattattgtat
ttaatttttttttttttgaagctatAAAAATTGATATTTACCCTAAGAGG
TAGTTTCGATCCCAAGAATAGACCATTTTAACTTCTTCTAGGTGTGACAA
AAAGCTTACCTAACTAAAAATTAACAACACCAAATTTTAACCCAGTACAG
AGTTTTGAGTGAGGCCCGGGTAAAATGAAATTATATTCTTTATCCGGTCG
AAATTCGGAGATTGATTGTTTCTGCCCCGATCAATACAGCAATGGTATTA
CGCGTTTTTTTGTAAGagcatccaaaacttttgaagcccttagatgttct
taactttttggatttc
Run BLAST on NCBI

protein sequence of TCONS_00000119-protein

>TCONS_00000119-protein ID=TCONS_00000119-protein|Name=TCONS_00000119-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1114bp
MTDFKYLGFILLTIFILWLPFGQASNEVYNYRQLRESDFQGIADKIHTKI
RDYAKKTLQAEKIEEQLKKLNYIVKTVDGQTLETDFSAGLESVFNGKQKI
LENIKHKAEKAEMDYNYDQTFDEEHAYFNMRDIKTQYNENQSLVIVPKFS
DNVRVNFTHSFVQVPTNVYAYKKSVLDQVTWGAELDETFEGNFKNSSGSL
LYQYFGDASTGIFRIFPGNIMGVKEDEHKTDLYDCRRRVWYIQAAASAKD
IVIVLDLSGSMIGNNIGIAKIAISSLIDTLQENDYFNVITINTEVKYIVP
CIKYLIQATKENKEMMKRVVQNLTEAAEIVDVNKGMDEAFKILNIGPSIN
RTSAGCNKAIMFVTDGIEGTYAGQESFEKNNPNKDVRVFSYLVGRIKNPN
EKALKKMSCENNGFFYKIETLGNIWDTVLDYIRVMSRPLIPNLKDSGRKE
LKPTYTPAYLDSAGFGMVMTISLSVFKKISYIHNEDPNDVRYLYEGFLGV
AGTDISLKNLKDQVDQSKLGVFSRGFVINNNGFVLIHPKFRDQSGYLPVP
PNVLIDELESAQDQEDTSALKKQMLKLTADDLEGGPVEFITRSTYDDGRK
VYSGKTKYWYKLLPDADLVSALALDEIDNTYLAVDESTLELKAIKEKGIE
ALKPPVDDFDYDYWNLTKTNTSFVTIAPWNYCNLPESLHNKPLGMKFYPT
VGEIYTFMSKNPTDYEKHCKDKELVTRLLAMAGVTSETVDKIWSQFQFDE
DPDMIQGAFFATSSGYQKYLSYHNHTDPSPPFNRDILRTKVFETPITNPD
INLFLSSSARDKTVGPVKISIMHPFWKQKNIAAVTGIEINSQLIYNYLME
SAEIKMTEFSTLAICKDTENAFCGVIDEHGYIITSNQGEAYTGQFIGERL
GEIVDALPFFTKIELEDAQAECPLSDEVSAANILLTPAKLIFGFITGLCK
TCYWLVIQFGIVLISLFEHAQRVYAEVPKTIRVSCTKTMPFYQFDMSKIQ
NGKIFQETYKCEDCSDKTKDFKLIRINDTNTMLLMAEADSNCCYKKRVSM
NHVKKDSTIDWCNPPEQPYRRSPAVCLNDTTSKPENAKCGSGFVEKPSIL
VLTIAFMLVCFVFG
Run BLAST on NCBI

transcript from alignment at sc0000001:2303887..2314933+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000119 ID=TCONS_00000119|Name=TCONS_00000119|organism=Clytia hemisphaerica|type=transcript|length=11047bp|location=Sequence derived from alignment at sc0000001:2303887..2314933+ (Clytia hemisphaerica)
TTTTAGTGTACTGACAGAATAATaacaaataaaagcaaaatttccaattt tggaaaatttagatTTGTTATGAAGAAAAGGAAGTCCACTTTGTAAACAT TGGTGAGAGTCTGGgtgaataaaaaaagaatatatttggGATATTGTTAT TCAAAATGACTGATTTCAAATACCTTGGATTTATATTGTTAACAATCTTT ATACTATGGTTGCCTTTTGGTCAAGCAAGCAATGAAGTATATAATTACCG TCAGCTACGGGAATCTGACTTCCAAGGAATAGCTGATAAAATTCATACAA AAATCCGTGATTATGCTAAAAAGACTTTACAAGCTGAGAAAATTGAAGAA CAATTGAAGAAATTGAATTACATTGTTAAAACTGTAGATGGTCAAACATT AGAAACGGATTTCTCAGCTGGTCTTGAATCGGTTTTTAAcggaaaacaaa aaatcttggaaaatATTAAACATAAGGCTGAAAAAGCTGAAATGGATTAT AATTATGATCAAACATTTGACGAAGAGCATGCTTATTTTAATATGCGTGA TATCAAAACACAATACAATGAAAATCAATCTCTGGTAATTGTACCCAAAT TTTCAGATAATGTTCGTGTTAATTTCACGCATAGCTTTGTACAAGTACCG ACGAACGTGTACGCGTACAAAAAGTCCGTTTTAGATCAGGTAACATGGGG AGCTGAATTGGATGAAACATTTGAAGGCAATTTTAAGAACTCGAGTGGAT CGCTGTTGTATCAATACTTTGGAGATGCTTCTACAGGTATGGgagatttc actttttgatcaatttttatATATCGTGACTTTTTGGCATGTTTATACTC ACAAGATTTGAGTCGTTTAAGGGGATTCAGAACATTtagtcaaatttcga aaaacgtaCTTTTAGTGTCAAAACATTTTACCGACCTATAGGAGTATGCT CTGAagatttaaagtaaaaatatcaacttgaAGGCTAGATGCGAGCTTTT AANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNAAAGGCTGACAAGGTGCGGGAAAACCCCCTAAAACGTG TTTTGAGAAAACGGCGCAGAAAGTTAAAAATAgaggtttttctcaatttt tctgcgatacatagaccgatttacaaaatttttgctgtggttgaccaaaa tggattgacacatttacttttaatgttgaaaaggtactggaaatactaaa atagtccaagttttttgaaaaaaatggccttCCACGTGCTCCGGGAATCT CCAAGTATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTCTCAAATCTGTTTATATCATTTACAGTTGAATTTCAGTGTTGAT CTTAGGGAAACGTGTCTTCAGGTTGAACGTCAATCATGCATAGTTTTACT CAATTTCCCAGGATCGCCTCCTGGCGCCATGAAGTGCCACGATTCATCaa agactagatttccactggaTTTAAGACTCATAatggatacatcattgaat gtGTTTAGTTCCTTGTTTCAAACTTTATTCATACCATGGTTCANNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNAAATACCAGTTCTTcggttaccatctttaattacgt CATATTTAGAAATCCCGGGgaaaaaaggcggtattgactTAGACGCCCAA AAAGGGCGTAAAGAGAGCTTTCGTTTGGTATGTCATGATGCTATGTTTAG AGCAGCCATACGGAAATGAGGCCCTAGCAACGGATGCGATTTACCGTTGC TAAGGAGAAAATTGTATACCAGGGCTCATAAGAAACCCTATATATCGGCA GATATTTATGCTACGGCCTTGAAATTTTCAGGGTATGTTCAGGAAggata aaggatactaaaaagccttaaatcccgaaattgataaatttttcaccaat tttcaaaatctcatatgactacccccttaaaGTTTATGGGGTAAATTTTT AGTCTTTTAGCAACCGTCCTACAAATACTGTTGGGGAAGTCTAATGAGTG CATCACATGTTGAATTTTTTGAGAATAAAACTTGTGATTAAACTGCTTCA AACATGTTAGAAGCTCTTGTATTACCCATGACATCAAAATTActttatta acaagaaaactgGTACCATTGGAAAACCCTGCGTGACAGAGATGCACTTT GTttacatgacatgacatgaggCCCCCATGCGGTTTTCATGATGACGTGA TAGGAACTTTTTTGCAACGTGATTAAGTGATTGGAAATTATCTTTTcgtt attgggcttttccagaaaaaaaccgtacacccTCTGTTGAGGAGCTCCAA TCTTTTGTGAACCACCCCCTTTGAATTCCAgacaattttaggatcatacc cctctagaattctgaatttttacagattttcaatcattacccctatggaa aaccacttatttttggcggatttttgtctactgctatggaattccactgc atttcaaaccatacccccttggaatggaaatggacctcctcaacaggggg tgcacggttcttttctggaaaagcccattgcacAATGAGAGGTCAAAAca tgatcgtgatttgaaaggttCTTAAGCCGTGATACGTAATTTGAACTTTG TCAAAAGGAtacgtgatcagagttaccgctaGGGGGCCTCCTATAGTGAA TATTATGTTACCTTAGCTGTCTTTTAAGGGTATTATTACCTGAATAATAT GTTACTTTCGATATATTCCAGGTATCTTCCGCATCTTTCCTGGAAACATT ATGGGAGTGAAAGAAGATGAACATAAAACGGATTTGTACGATTGTCGGCG ACGTGTGTGGTATATCCAAGCAGCTGCTAGTGCAAAAGATATCGTCATTG TCCTCGATCTTTCTGGTTCTATGATCGGAAATAATATTGGTAAGTATAAC agacatttgaaaattgaagagGATGATATACTTTCtcttataccttatcg gggaaaacttcgtcagggaaaattttcgtcggggaaaaatattcgtcact tggccgaaatttcgtcacttttccccgacgaagttttccccgataccCTT Atcgcgtaatgggtaatcaggaccactgtgcgctaatgacgacttactat tggtccaaagttttgaaaaattttgaagatttttgcgtctagccaacggg aGGCCATTAAAGAGGTGCAATCAGTCCttattacccatgatccatttcga ctgtgaaatggcctataatACGGAGTGTTTCAAGTAAGTGAATTGCAATA AATATGAGTGGTTCGTAAAACTAATTAAAAGGGGTTTTAGCCAATTTCGT AGCCAGACCCACTcgcaccactttttgattttcctgtTGGACGTGATACA ATCATTTTACAAACCTTTTGTGAACGCTATCATAATCATCAAAAAAGCGA GCTAAGGGACTGCGACGAGTTTGGTTTTAAGCAAGTCTgcaaattttatt tatattctaATTCTCAAATTCTTCTTCCAAGTTATgaaggaacaaaacaa aatctgtttttctgtttttctgctTTTGGTTCGAGGAAAATGAGATTCTT TTTCACTTTTATAAAGAATGATGAAGGCGTTCTTTATATGAACGGGTAGA GGATCCGGTAAAATGTATAGTATAAATGCAGGCCCACGGGCTTTGATAAA GCTTAAAGCTTTAGGTTATCCTTCTTTATAGCCTGTAACAAACTCTTCTT TgctgactgaaaagataacgccaagtttttttaaatataaaaaacgcCCG TGGGCAGGGTGGTACAGGCAATCTTCTTCATTGATTTCACCTTTTGTGTT TCCAGGTATTGCAAAGATTGCTATCTCATCTTTGATTGACACATTACAAG agaatgattattttaatgtcatCACCATCAACACTGAAGTCAAATACATT GTCCCATGTATCAAATATTTGATCCAAGCCaccaaagaaaataaagaaat gatgAAAAGGTACAAACAATTTCTTTCTAACTTCAACCTTGCTCAACCCC ACTAGGTAAACTAAAACTTCGAAAAAATCCCCACTGGCATATACCTTATA TAATAATCGCATCACCATCTTTGAGGCCTGTATATATCTCCGGGGAGCCA CTCGAGGTAATAACCTACCGTACGTATTTTACTAAATAtcctctgcactg taagggtccgatttcaaaggcatATTTTTGGTtgcacgtacggtcgtttt taaATCAAGTGCCCCCGGGTGTATATCTAACACGATATTGAACACTGTTG TTGATCAAGGTCCATCCAATGTGATGAGGGCGTCATAAATGTCTGTGAGT TGACGTTGCTTTGATATTTCGCCGAAATTTTTACGGATGAATGAGGAGAT TTACACTATGTACTTTATTTGCCACTTCATTCCATTCTTCTCCACTCCAT TACTTTTCTCACATGTCTTGACTTAAAGGCGCTtaaaatcagaaatttga caCCCCCCgtccatttttcttttcttccaaCAGGGTAGTACAAAATCTCA CGGAGGCAGCCGAAATTGTGGATGTCAACAAAGGCATGGACGAAGCATTT AAGATACTAAATATCGGTGAGTTCTGGACTTATACTAGGGATTtcttttg cttatttttttacaGTATTCAAAATCTAATACAAGTTTTGGTAGCATATA ACAAATTATTAGATCTATTTTCCACTATAGGAGAGCcagattttttaaac aattaaaGTTAGCAGAGTAACAAtgaaattgatcatttttttaaacatta tttcCTTGACCTCCAAAaatattggttcttcttacaagaaaagtGTTATA TAATGTATATGCTGTGTgtatgaaatatataaataactaaCAACTCGAAC AGATACGGGAAGAAGGACTTCATCGGAAGGAGTAAGGAAAACTAAATGAC GCTCGGAATCAGAATACTGAGATATGTCGTACATTTTTCACATTGTAGGT CCTTCAATCAATCGTACATCTGCTGGTTGCAACAAAGCCATCATGTTCGT TACTGACGGGATAGAAGGAACTTACGCCGGACAAGAATCATTCGAGAAAA ACAACCCAAATAAAGATGTACGGGTATTCTCATACCTTGTCGGCCGAATC AAAAACCCGAACGAGAAAGCACTGAAAAAGATGTCGTGTGAAAATAATgg ttttttctataaaatcgaAACATTAGGAAATATATGGGATACCGTTCTGG ATTATATTCGGGTTATGAGTCGCCCGTTAATCCCGAATTTAAAAGACAGT GGTCGGAAAGAACTCAAGCCAACATATACACCAGCATACCTGGATAGTGC TGGTTTTGGCATGGTTATGACAATCTCTTTAAgcgttttcaagaaaataa gtTATATTCATAATGAAGACCCAAATGACGTCAGATATTTGTATGAAGGT TTCTTAGGTGTAGCTGGTACAGACATATCTTTGAAGAATTTGAAGGACCA AGTTGATCAATCCAAACTTGGTGTTTTTAGTCGTGGTTTTGTTATCAATA AcaatggttttgttttgattcatcCGAAATTCCGTGACCAGTCTGGCTAT CTTCCTGTTCCCCCAAATGTCCTTATCGATGAGTTAGAATCAGCTCAGGA TCAAGAAGATACGAGTGCACTAAAGAAGCAAATGTTGAAATTAACGGCTG ATGACCTTGAAGGTGGTCCTGTCGAATTCATTACCCGGTCAACTTATGAT GATGGTCGAAAAGTGTATTCAGGCAAAACAAAATATTGGTATAAATTGCT TCCTGATGCTGATTTGGTTTCCGCCCTTGCATTGGATGAGATTGATAATA CTTACTTAGCTGTTGATGAATCGACACTCGAATTAAAGGCGATCAAGGAA AAAGGTATCAAACATTTTAATCCATATCTGAGAGTGTGAGAACTCAATCT TGAAActataaattttttgaggcCATAATACCATCTGCTAACTTCTGTTA CAATTTGAcattaaaacttttttcacatgcacgtaaaatctTCCTTAAGA CCTTACGGAGAATCGTTCGTAAGACTGTCTTTTGGGAAATTCCCCGATAT TACGTagagtttttattgataaagAGGGTCTTACttgacttttccttccg ttcaaaacaATACGTAAGCTTGGGTAAATTTCCTATTCCTGAAGGTGTTA AGTAAAATAATAAAAGGTGATAAAAGGAAGAGATGCGGTAAATTCTCGCT CATTCCGATTTCTATCATTCtaatatttctataattcgaacttgtttcaa GTCAAGAAGAAGCTCTCTTAAAAAACTTTCTAtagttcgaatctctctgt tattcgaactgACACGATTCCCGCGTTTGAGTTTGACTTAACGAAATTCA ACAGAATACAAATTGCTTTTAATACCAAATTCTTTCTTTTCTACAGGAAT CGAAGCCTTAAAGCCACCAGTCGATGACTTTGACTATGATTATTGGAATT TGACAAAAACCAACACGTCATTTGTTACAATTGCACCATGGAATTATTGC AACTTACCCGAATCATTACATAATAAACCACTTGGTATGAAATTCTACCC AACGGTTGGCGAGATCTACACATTCATGAGTAAAAATCCAACTGATTATG AAAAGCATTGTAAAGATAAAGAGTTGGTAACTCGGCTTTTAGCAATGGCT GGTGTAACGAGTGAAACTGTGGATAAAATTTGGAGTCAATTCCAGTTTGA TGAAGACCCTGATATGATTCAAGGAGCTTTCTTTGCAACCTCCAGTGgat atcaaaaatatttgtctTACCATAATCACACAGATCCTTCACCGCCCTTC AATCGTGATATTTTACGGACCAAAGTATTTGAGACTCCAATCACAAACCC GGATATTAATCTCTTTTTATCATCGTCAGCGCGTGACAAGACTGTAGGAC CAGTAAAGATCTCAATCATGCATCCTTTTTGGAAGCAAAAGAACATTGCA GCAGGTaatattctttttttgattctttttcttcCACCAAAGATCAAAAC GcacagctggcacacaacattgtacCAACGTCAATCCAACGTTCATAAGA CATCCAGACGAGCCTGGATGAGCGTTGACTTAACGTTACGTTGGCATGAT ACCTcctctcacagacccggtggaaagAGTTGCTAAAATTCCGTCCAcag tgaaaaattatactctaatttttgtcccctcttagaataatcaaataaac aaatccccactgcaaaatattttgcgattttttcaTCCCCTTTGAATTTT CTAACCTAAAAACAATGGCTGTAAAAAGTCTACCGGGTCTGTAAGGGGGT GTAAAATGTATCGCCAATAGAAgataaatttagaaatttgttttcaTGGT AGAAAggaaggaagaaaatttggcacAGACCTTCAAACATAGGAAGCGGA GTTTGTAGTCGACTTTGTAGAGACTTTattcctaaaaataaaacatttct atgattttaaaattttttgcaatttttttattttagtaaccGGTATTGAA ATCAACAGTCAACTCATTTACAATTACTTAATGGaatcggcagaaataaa aatgaCTGAATTCAGTACATTAGCTATCTGTAAAGATACTGAGAACGCTT TTTGTGGTGTCATTGACGAACATGGATACATCATCACTAGCAACCAAGGA GAGGCTTACACAGGACAATTTATCGGGGAACGCTTAGGAGAAATAGTCGA TGCTCTACCGTTCTTTACCAAAATTGAGCTTGAAGATGCACAAGCAGAGT GTCCGCTATCAGACGAAGTTTCCGCCGCAAATATTTTGCTGACGCCTGCA AAATTAATTTTCGGTTTTATTACCGGGCTTTGTAAAACATGTTATTGGTT GGTTATTCAATTTggtattgttttgatttcattgtTTGAGCATGCGCAAA GAGTTTATGCGGAAGTACCAAAAACAATACGGGTAAGTTGTACCAAAACA ATGCCGTTTTACCAATTCGATATGAGTAAaatccagaatggaaaaatatt cCAGGAAACGTATAAATGTGAAGATTGTTCGGATAAAACAAAGGACTTTA AATTAATTCGAATCAATGATACTAATACAATGCTATTGATGGCTGAAGCA GACTCTAATTGTTGTTATAAGAAGCGAGTTAGTATGAATCACGTTAAAAA AGACTCGACCATTGATTGGTGTAATCCGCCCGAGCAACCGTACAGGCGGT CGCCCGCTGTTTGTTTGAACGATACGACTTCAAAACCGGAGAATGCTAAA TGTGGCTCTGGATTTGTtgaaaaaccatcaattttGGTTTTAACGATAGC TTTTATGTTAGTGTGTTTCGTTTTTGGATAAACCAAAGTTAAGCATCCAT GTGCATAGTTATTGAGAAAAATatggaatatttttataaatgtggAATTT CGCTGACTTCTGGCTTAGTCAGTAGTAACTCAATCACTGCAAACGTTTTT GTTGAGAAAATGGCTTTAATTATAAGGAACTTTTGAAATAATGATGAAGT ATCTTAAAATTTGCGGAAAAATTTGCGTTATAAATGATATATTACATTTC CGTAAAAAATGTTTCCGTACGTTTCTAAAAGATGGCAAAATAATCTGAGT AAAATAACAGAGTTGTGGAGTTACACATTTCAAAGCTTGGGCAAAAACAC ATCCATCGCATATCAAGAGGATTTTCTTGGttatttttgagttattttac CTTAAAAGACACTAGTTTCTAGCAATGAGGAATGAAATTTTGGGCAACTA CAATTATAATTTCCTTAAAGcaatatccaaaaattttcaaatttacaatA TAAGAATGTACTCTATAAGAATAATCAAAATGAAATCAGATATATTTCAA ATTTAGGTCCAATTTGGATCCTTATCTAAGTAAGAATACCTGAAGAATAT TTAAGGATAATTTTTCCCaaaagagttaaaaatttcaataatgaAATGGA GAAAGAtcattcttatgaaaaagcgtgtatgtgcAAAATGGAATAACTAT AGCGAAGGTGCCTCATTGCatgaaacaaaggaaaaataTCAACCTATTTG GACGTCCAAATAACGTCGTTTCTACGTTAcattaaatttctaaaaagaag gataatttaaaaacaatgttGATCCCTTGAATGTGCTTTAAACAAATTAC GGCTTATATTAATAGAAATAGTGTGATAAACCTGTAGTATTTAAGTTTTA CCAAAGAAATAAGAACGAGGACAATTTTACTCTCAGAAGTGCGACAAAAG AGCAGCTGagcctcatcaaaaatttactggttcttataaaaaagggtgtA TAATACAAGGGCTTGCAAATGTCTGGTTTTCCTGTATAATTACGCACTGC TGAGAAATCTTCATTCATACAATAGagctttatatatttttgtttacata cttactatataattattttatattattgtatttaatttttttttttttga agctatAAAAATTGATATTTACCCTAAGAGGTAGTTTCGATCCCAAGAAT AGACCATTTTAACTTCTTCTAGGTGTGACAAAAAGCTTACCTAACTAAAA ATTAACAACACCAAATTTTAACCCAGTACAGAGTTTTGAGTGAGGCCCGG GTAAAATGAAATTATATTCTTTATCCGGTCGAAATTCGGAGATTGATTGT TTCTGCCCCGATCAATACAGCAATGGTATTACGCGTTTTTTTGTAAGagc atccaaaacttttgaagcccttagatgttcttaactttttggatttc

Coding sequence (CDS) from alignment at sc0000001:2303887..2314933+

>TCONS_00000119 ID=TCONS_00000119|Name=|organism=Clytia hemisphaerica|type=CDS|length=23415bp|location=Sequence derived from alignment at sc0000001:2303887..2314933+ (Clytia hemisphaerica)
ATGACTGATTTCAAATACCTTGGATTTATATTGTTAACAATCTTTATACT
ATGGTTGCCTTTTGGTCAAGCAAGCAATGAAGTATATAATTACCGTCAGC
TACGGGAATCTGACTTCCAAGGAATAGCTGATAAAATTCATACAAAAATC
CGTGATTATGCTAAAAAGACTTTACAAGCTGAGAAAATTGAAGAACAATT
GAAGAAATTGAATTACATTGTTAAAACTGTAGATGGTCAAACATTAGAAA
CGGATTTCTCAGCTGGTCTTGAATCGGTTTTTAAcggaaaacaaaaaatc
ttggaaaatATTAAACATAAGGCTGAAAAAGCTGAAATGGATTATAATTA
TGATCAAACATTTGACGAAGAGCATGCTTATTTTAATATGCGTGATATCA
AAACACAATACAATGAAAATCAATCTCTGGTAATTGTACCCAAATTTTCA
GATAATGTTCGTGTTAATTTCACGCATAGCTTTGTACAAGTACCGACGAA
CGTGTACGCGTACAAAAAGTCCGTTTTAGATCAGGTAACATGGGGAGCTG
AATTGGATGAAACATTTGAAGGCAATTTTAAGAACTCGAGTGGATCGCTG
TTGTATCAATACTTTGGAGATGCTTCTACAGGTATCTTCCGCATCTTTCC
TGGAAACATTATGGGAGTGAAAGAAGATGAACATAAAACGGATTTGTACG
ATTGTCGGCGACGTGTGTGGTATATCCAAGCAGCTGCTAGTGCAAAAGAT
ATCGTCATTGTCCTCGATCTTTCTGGTTCTATGATCGGAAATAATATTGG
TATTGCAAAGATTGCTATCTCATCTTTGATTGACACATTACAAGagaatg
attattttaatgtcatCACCATCAACACTGAAGTCAAATACATTGTCCCA
TGTATCAAATATTTGATCCAAGCCaccaaagaaaataaagaaatgatgAA
AAGGGTAGTACAAAATCTCACGGAGGCAGCCGAAATTGTGGATGTCAACA
AAGGCATGGACGAAGCATTTAAGATACTAAATATCGGTCCTTCAATCAAT
CGTACATCTGCTGGTTGCAACAAAGCCATCATGTTCGTTACTGACGGGAT
AGAAGGAACTTACGCCGGACAAGAATCATTCGAGAAAAACAACCCAAATA
AAGATGTACGGGTATTCTCATACCTTGTCGGCCGAATCAAAAACCCGAAC
GAGAAAGCACTGAAAAAGATGTCGTGTGAAAATAATggttttttctataa
aatcgaAACATTAGGAAATATATGGGATACCGTTCTGGATTATATTCGGG
TTATGAGTCGCCCGTTAATCCCGAATTTAAAAGACAGTGGTCGGAAAGAA
CTCAAGCCAACATATACACCAGCATACCTGGATAGTGCTGGTTTTGGCAT
GGTTATGACAATCTCTTTAAgcgttttcaagaaaataagtTATATTCATA
ATGAAGACCCAAATGACGTCAGATATTTGTATGAAGGTTTCTTAGGTGTA
GCTGGTACAGACATATCTTTGAAGAATTTGAAGGACCAAGTTGATCAATC
CAAACTTGGTGTTTTTAGTCGTGGTTTTGTTATCAATAAcaatggttttg
ttttgattcatcCGAAATTCCGTGACCAGTCTGGCTATCTTCCTGTTCCC
CCAAATGTCCTTATCGATGAGTTAGAATCAGCTCAGGATCAAGAAGATAC
GAGTGCACTAAAGAAGCAAATGTTGAAATTAACGGCTGATGACCTTGAAG
GTGGTCCTGTCGAATTCATTACCCGGTCAACTTATGATGATGGTCGAAAA
GTGTATTCAGGCAAAACAAAATATTGGTATAAATTGCTTCCTGATGCTGA
TTTGGTTTCCGCCCTTGCATTGGATGAGATTGATAATACTTACTTAGCTG
TTGATGAATCGACACTCGAATTAAAGGCGATCAAGGAAAAAGGAATCGAA
GCCTTAAAGCCACCAGTCGATGACTTTGACTATGATTATTGGAATTTGAC
AAAAACCAACACGTCATTTGTTACAATTGCACCATGGAATTATTGCAACT
TACCCGAATCATTACATAATAAACCACTTGGTATGAAATTCTACCCAACG
GTTGGCGAGATCTACACATTCATGAGTAAAAATCCAACTGATTATGAAAA
GCATTGTAAAGATAAAGAGTTGGTAACTCGGCTTTTAGCAATGGCTGGTG
TAACGAGTGAAACTGTGGATAAAATTTGGAGTCAATTCCAGTTTGATGAA
GACCCTGATATGATTCAAGGAGCTTTCTTTGCAACCTCCAGTGgatatca
aaaatatttgtctTACCATAATCACACAGATCCTTCACCGCCCTTCAATC
GTGATATTTTACGGACCAAAGTATTTGAGACTCCAATCACAAACCCGGAT
ATTAATCTCTTTTTATCATCGTCAGCGCGTGACAAGACTGTAGGACCAGT
AAAGATCTCAATCATGCATCCTTTTTGGAAGCAAAAGAACATTGCAGCAG
taaccGGTATTGAAATCAACAGTCAACTCATTTACAATTACTTAATGGaa
tcggcagaaataaaaatgaCTGAATTCAGTACATTAGCTATCTGTAAAGA
TACTGAGAACGCTTTTTGTGGTGTCATTGACGAACATGGATACATCATCA
CTAGCAACCAAGGAGAGGCTTACACAGGACAATTTATCGGGGAACGCTTA
GGAGAAATAGTCGATGCTCTACCGTTCTTTACCAAAATTGAGCTTGAAGA
TGCACAAGCAGAGTGTCCGCTATCAGACGAAGTTTCCGCCGCAAATATTT
TGCTGACGCCTGCAAAATTAATTTTCGGTTTTATTACCGGGCTTTGTAAA
ACATGTTATTGGTTGGTTATTCAATTTggtattgttttgatttcattgtT
TGAGCATGCGCAAAGAGTTTATGCGGAAGTACCAAAAACAATACGGGTAA
GTTGTACCAAAACAATGCCGTTTTACCAATTCGATATGAGTAAaatccag
aatggaaaaatattcCAGGAAACGTATAAATGTGAAGATTGTTCGGATAA
AACAAAGGACTTTAAATTAATTCGAATCAATGATACTAATACAATGCTAT
TGATGGCTGAAGCAGACTCTAATTGTTGTTATAAGAAGCGAGTTAGTATG
AATCACGTTAAAAAAGACTCGACCATTGATTGGTGTAATCCGCCCGAGCA
ACCGTACAGGCGGTCGCCCGCTGTTTGTTTGAACGATACGACTTCAAAAC
CGGAGAATGCTAAATGTGGCTCTGGATTTGTtgaaaaaccatcaattttG
GTTTTAACGATAGCTTTTATGTTAGTGTGTTTCGTTTTTGGATAAATGAC
TGATTTCAAATACCTTGGATTTATATTGTTAACAATCTTTATACTATGGT
TGCCTTTTGGTCAAGCAAGCAATGAAGTATATAATTACCGTCAGCTACGG
GAATCTGACTTCCAAGGAATAGCTGATAAAATTCATACAAAAATCCGTGA
TTATGCTAAAAAGACTTTACAAGCTGAGAAAATTGAAGAACAATTGAAGA
AATTGAATTACATTGTTAAAACTGTAGATGGTCAAACATTAGAAACGGAT
TTCTCAGCTGGTCTTGAATCGGTTTTTAAcggaaaacaaaaaatcttgga
aaatATTAAACATAAGGCTGAAAAAGCTGAAATGGATTATAATTATGATC
AAACATTTGACGAAGAGCATGCTTATTTTAATATGCGTGATATCAAAACA
CAATACAATGAAAATCAATCTCTGGTAATTGTACCCAAATTTTCAGATAA
TGTTCGTGTTAATTTCACGCATAGCTTTGTACAAGTACCGACGAACGTGT
ACGCGTACAAAAAGTCCGTTTTAGATCAGGTAACATGGGGAGCTGAATTG
GATGAAACATTTGAAGGCAATTTTAAGAACTCGAGTGGATCGCTGTTGTA
TCAATACTTTGGAGATGCTTCTACAGGTATCTTCCGCATCTTTCCTGGAA
ACATTATGGGAGTGAAAGAAGATGAACATAAAACGGATTTGTACGATTGT
CGGCGACGTGTGTGGTATATCCAAGCAGCTGCTAGTGCAAAAGATATCGT
CATTGTCCTCGATCTTTCTGGTTCTATGATCGGAAATAATATTGGTATTG
CAAAGATTGCTATCTCATCTTTGATTGACACATTACAAGagaatgattat
tttaatgtcatCACCATCAACACTGAAGTCAAATACATTGTCCCATGTAT
CAAATATTTGATCCAAGCCaccaaagaaaataaagaaatgatgAAAAGGG
TAGTACAAAATCTCACGGAGGCAGCCGAAATTGTGGATGTCAACAAAGGC
ATGGACGAAGCATTTAAGATACTAAATATCGGTCCTTCAATCAATCGTAC
ATCTGCTGGTTGCAACAAAGCCATCATGTTCGTTACTGACGGGATAGAAG
GAACTTACGCCGGACAAGAATCATTCGAGAAAAACAACCCAAATAAAGAT
GTACGGGTATTCTCATACCTTGTCGGCCGAATCAAAAACCCGAACGAGAA
AGCACTGAAAAAGATGTCGTGTGAAAATAATggttttttctataaaatcg
aAACATTAGGAAATATATGGGATACCGTTCTGGATTATATTCGGGTTATG
AGTCGCCCGTTAATCCCGAATTTAAAAGACAGTGGTCGGAAAGAACTCAA
GCCAACATATACACCAGCATACCTGGATAGTGCTGGTTTTGGCATGGTTA
TGACAATCTCTTTAAgcgttttcaagaaaataagtTATATTCATAATGAA
GACCCAAATGACGTCAGATATTTGTATGAAGGTTTCTTAGGTGTAGCTGG
TACAGACATATCTTTGAAGAATTTGAAGGACCAAGTTGATCAATCCAAAC
TTGGTGTTTTTAGTCGTGGTTTTGTTATCAATAAcaatggttttgttttg
attcatcCGAAATTCCGTGACCAGTCTGGCTATCTTCCTGTTCCCCCAAA
TGTCCTTATCGATGAGTTAGAATCAGCTCAGGATCAAGAAGATACGAGTG
CACTAAAGAAGCAAATGTTGAAATTAACGGCTGATGACCTTGAAGGTGGT
CCTGTCGAATTCATTACCCGGTCAACTTATGATGATGGTCGAAAAGTGTA
TTCAGGCAAAACAAAATATTGGTATAAATTGCTTCCTGATGCTGATTTGG
TTTCCGCCCTTGCATTGGATGAGATTGATAATACTTACTTAGCTGTTGAT
GAATCGACACTCGAATTAAAGGCGATCAAGGAAAAAGGAATCGAAGCCTT
AAAGCCACCAGTCGATGACTTTGACTATGATTATTGGAATTTGACAAAAA
CCAACACGTCATTTGTTACAATTGCACCATGGAATTATTGCAACTTACCC
GAATCATTACATAATAAACCACTTGGTATGAAATTCTACCCAACGGTTGG
CGAGATCTACACATTCATGAGTAAAAATCCAACTGATTATGAAAAGCATT
GTAAAGATAAAGAGTTGGTAACTCGGCTTTTAGCAATGGCTGGTGTAACG
AGTGAAACTGTGGATAAAATTTGGAGTCAATTCCAGTTTGATGAAGACCC
TGATATGATTCAAGGAGCTTTCTTTGCAACCTCCAGTGgatatcaaaaat
atttgtctTACCATAATCACACAGATCCTTCACCGCCCTTCAATCGTGAT
ATTTTACGGACCAAAGTATTTGAGACTCCAATCACAAACCCGGATATTAA
TCTCTTTTTATCATCGTCAGCGCGTGACAAGACTGTAGGACCAGTAAAGA
TCTCAATCATGCATCCTTTTTGGAAGCAAAAGAACATTGCAGCAGtaacc
GGTATTGAAATCAACAGTCAACTCATTTACAATTACTTAATGGaatcggc
agaaataaaaatgaCTGAATTCAGTACATTAGCTATCTGTAAAGATACTG
AGAACGCTTTTTGTGGTGTCATTGACGAACATGGATACATCATCACTAGC
AACCAAGGAGAGGCTTACACAGGACAATTTATCGGGGAACGCTTAGGAGA
AATAGTCGATGCTCTACCGTTCTTTACCAAAATTGAGCTTGAAGATGCAC
AAGCAGAGTGTCCGCTATCAGACGAAGTTTCCGCCGCAAATATTTTGCTG
ACGCCTGCAAAATTAATTTTCGGTTTTATTACCGGGCTTTGTAAAACATG
TTATTGGTTGGTTATTCAATTTggtattgttttgatttcattgtTTGAGC
ATGCGCAAAGAGTTTATGCGGAAGTACCAAAAACAATACGGGTAAGTTGT
ACCAAAACAATGCCGTTTTACCAATTCGATATGAGTAAaatccagaatgg
aaaaatattcCAGGAAACGTATAAATGTGAAGATTGTTCGGATAAAACAA
AGGACTTTAAATTAATTCGAATCAATGATACTAATACAATGCTATTGATG
GCTGAAGCAGACTCTAATTGTTGTTATAAGAAGCGAGTTAGTATGAATCA
CGTTAAAAAAGACTCGACCATTGATTGGTGTAATCCGCCCGAGCAACCGT
ACAGGCGGTCGCCCGCTGTTTGTTTGAACGATACGACTTCAAAACCGGAG
AATGCTAAATGTGGCTCTGGATTTGTtgaaaaaccatcaattttGGTTTT
AACGATAGCTTTTATGTTAGTGTGTTTCGTTTTTGGATAAATGACTGATT
TCAAATACCTTGGATTTATATTGTTAACAATCTTTATACTATGGTTGCCT
TTTGGTCAAGCAAGCAATGAAGTATATAATTACCGTCAGCTACGGGAATC
TGACTTCCAAGGAATAGCTGATAAAATTCATACAAAAATCCGTGATTATG
CTAAAAAGACTTTACAAGCTGAGAAAATTGAAGAACAATTGAAGAAATTG
AATTACATTGTTAAAACTGTAGATGGTCAAACATTAGAAACGGATTTCTC
AGCTGGTCTTGAATCGGTTTTTAAcggaaaacaaaaaatcttggaaaatA
TTAAACATAAGGCTGAAAAAGCTGAAATGGATTATAATTATGATCAAACA
TTTGACGAAGAGCATGCTTATTTTAATATGCGTGATATCAAAACACAATA
CAATGAAAATCAATCTCTGGTAATTGTACCCAAATTTTCAGATAATGTTC
GTGTTAATTTCACGCATAGCTTTGTACAAGTACCGACGAACGTGTACGCG
TACAAAAAGTCCGTTTTAGATCAGGTAACATGGGGAGCTGAATTGGATGA
AACATTTGAAGGCAATTTTAAGAACTCGAGTGGATCGCTGTTGTATCAAT
ACTTTGGAGATGCTTCTACAGGTATCTTCCGCATCTTTCCTGGAAACATT
ATGGGAGTGAAAGAAGATGAACATAAAACGGATTTGTACGATTGTCGGCG
ACGTGTGTGGTATATCCAAGCAGCTGCTAGTGCAAAAGATATCGTCATTG
TCCTCGATCTTTCTGGTTCTATGATCGGAAATAATATTGGTATTGCAAAG
ATTGCTATCTCATCTTTGATTGACACATTACAAGagaatgattattttaa
tgtcatCACCATCAACACTGAAGTCAAATACATTGTCCCATGTATCAAAT
ATTTGATCCAAGCCaccaaagaaaataaagaaatgatgAAAAGGGTAGTA
CAAAATCTCACGGAGGCAGCCGAAATTGTGGATGTCAACAAAGGCATGGA
CGAAGCATTTAAGATACTAAATATCGGTCCTTCAATCAATCGTACATCTG
CTGGTTGCAACAAAGCCATCATGTTCGTTACTGACGGGATAGAAGGAACT
TACGCCGGACAAGAATCATTCGAGAAAAACAACCCAAATAAAGATGTACG
GGTATTCTCATACCTTGTCGGCCGAATCAAAAACCCGAACGAGAAAGCAC
TGAAAAAGATGTCGTGTGAAAATAATggttttttctataaaatcgaAACA
TTAGGAAATATATGGGATACCGTTCTGGATTATATTCGGGTTATGAGTCG
CCCGTTAATCCCGAATTTAAAAGACAGTGGTCGGAAAGAACTCAAGCCAA
CATATACACCAGCATACCTGGATAGTGCTGGTTTTGGCATGGTTATGACA
ATCTCTTTAAgcgttttcaagaaaataagtTATATTCATAATGAAGACCC
AAATGACGTCAGATATTTGTATGAAGGTTTCTTAGGTGTAGCTGGTACAG
ACATATCTTTGAAGAATTTGAAGGACCAAGTTGATCAATCCAAACTTGGT
GTTTTTAGTCGTGGTTTTGTTATCAATAAcaatggttttgttttgattca
tcCGAAATTCCGTGACCAGTCTGGCTATCTTCCTGTTCCCCCAAATGTCC
TTATCGATGAGTTAGAATCAGCTCAGGATCAAGAAGATACGAGTGCACTA
AAGAAGCAAATGTTGAAATTAACGGCTGATGACCTTGAAGGTGGTCCTGT
CGAATTCATTACCCGGTCAACTTATGATGATGGTCGAAAAGTGTATTCAG
GCAAAACAAAATATTGGTATAAATTGCTTCCTGATGCTGATTTGGTTTCC
GCCCTTGCATTGGATGAGATTGATAATACTTACTTAGCTGTTGATGAATC
GACACTCGAATTAAAGGCGATCAAGGAAAAAGGAATCGAAGCCTTAAAGC
CACCAGTCGATGACTTTGACTATGATTATTGGAATTTGACAAAAACCAAC
ACGTCATTTGTTACAATTGCACCATGGAATTATTGCAACTTACCCGAATC
ATTACATAATAAACCACTTGGTATGAAATTCTACCCAACGGTTGGCGAGA
TCTACACATTCATGAGTAAAAATCCAACTGATTATGAAAAGCATTGTAAA
GATAAAGAGTTGGTAACTCGGCTTTTAGCAATGGCTGGTGTAACGAGTGA
AACTGTGGATAAAATTTGGAGTCAATTCCAGTTTGATGAAGACCCTGATA
TGATTCAAGGAGCTTTCTTTGCAACCTCCAGTGgatatcaaaaatatttg
tctTACCATAATCACACAGATCCTTCACCGCCCTTCAATCGTGATATTTT
ACGGACCAAAGTATTTGAGACTCCAATCACAAACCCGGATATTAATCTCT
TTTTATCATCGTCAGCGCGTGACAAGACTGTAGGACCAGTAAAGATCTCA
ATCATGCATCCTTTTTGGAAGCAAAAGAACATTGCAGCAGtaaccGGTAT
TGAAATCAACAGTCAACTCATTTACAATTACTTAATGGaatcggcagaaa
taaaaatgaCTGAATTCAGTACATTAGCTATCTGTAAAGATACTGAGAAC
GCTTTTTGTGGTGTCATTGACGAACATGGATACATCATCACTAGCAACCA
AGGAGAGGCTTACACAGGACAATTTATCGGGGAACGCTTAGGAGAAATAG
TCGATGCTCTACCGTTCTTTACCAAAATTGAGCTTGAAGATGCACAAGCA
GAGTGTCCGCTATCAGACGAAGTTTCCGCCGCAAATATTTTGCTGACGCC
TGCAAAATTAATTTTCGGTTTTATTACCGGGCTTTGTAAAACATGTTATT
GGTTGGTTATTCAATTTggtattgttttgatttcattgtTTGAGCATGCG
CAAAGAGTTTATGCGGAAGTACCAAAAACAATACGGGTAAGTTGTACCAA
AACAATGCCGTTTTACCAATTCGATATGAGTAAaatccagaatggaaaaa
tattcCAGGAAACGTATAAATGTGAAGATTGTTCGGATAAAACAAAGGAC
TTTAAATTAATTCGAATCAATGATACTAATACAATGCTATTGATGGCTGA
AGCAGACTCTAATTGTTGTTATAAGAAGCGAGTTAGTATGAATCACGTTA
AAAAAGACTCGACCATTGATTGGTGTAATCCGCCCGAGCAACCGTACAGG
CGGTCGCCCGCTGTTTGTTTGAACGATACGACTTCAAAACCGGAGAATGC
TAAATGTGGCTCTGGATTTGTtgaaaaaccatcaattttGGTTTTAACGA
TAGCTTTTATGTTAGTGTGTTTCGTTTTTGGATAAATGACTGATTTCAAA
TACCTTGGATTTATATTGTTAACAATCTTTATACTATGGTTGCCTTTTGG
TCAAGCAAGCAATGAAGTATATAATTACCGTCAGCTACGGGAATCTGACT
TCCAAGGAATAGCTGATAAAATTCATACAAAAATCCGTGATTATGCTAAA
AAGACTTTACAAGCTGAGAAAATTGAAGAACAATTGAAGAAATTGAATTA
CATTGTTAAAACTGTAGATGGTCAAACATTAGAAACGGATTTCTCAGCTG
GTCTTGAATCGGTTTTTAAcggaaaacaaaaaatcttggaaaatATTAAA
CATAAGGCTGAAAAAGCTGAAATGGATTATAATTATGATCAAACATTTGA
CGAAGAGCATGCTTATTTTAATATGCGTGATATCAAAACACAATACAATG
AAAATCAATCTCTGGTAATTGTACCCAAATTTTCAGATAATGTTCGTGTT
AATTTCACGCATAGCTTTGTACAAGTACCGACGAACGTGTACGCGTACAA
AAAGTCCGTTTTAGATCAGGTAACATGGGGAGCTGAATTGGATGAAACAT
TTGAAGGCAATTTTAAGAACTCGAGTGGATCGCTGTTGTATCAATACTTT
GGAGATGCTTCTACAGGTATCTTCCGCATCTTTCCTGGAAACATTATGGG
AGTGAAAGAAGATGAACATAAAACGGATTTGTACGATTGTCGGCGACGTG
TGTGGTATATCCAAGCAGCTGCTAGTGCAAAAGATATCGTCATTGTCCTC
GATCTTTCTGGTTCTATGATCGGAAATAATATTGGTATTGCAAAGATTGC
TATCTCATCTTTGATTGACACATTACAAGagaatgattattttaatgtca
tCACCATCAACACTGAAGTCAAATACATTGTCCCATGTATCAAATATTTG
ATCCAAGCCaccaaagaaaataaagaaatgatgAAAAGGGTAGTACAAAA
TCTCACGGAGGCAGCCGAAATTGTGGATGTCAACAAAGGCATGGACGAAG
CATTTAAGATACTAAATATCGGTCCTTCAATCAATCGTACATCTGCTGGT
TGCAACAAAGCCATCATGTTCGTTACTGACGGGATAGAAGGAACTTACGC
CGGACAAGAATCATTCGAGAAAAACAACCCAAATAAAGATGTACGGGTAT
TCTCATACCTTGTCGGCCGAATCAAAAACCCGAACGAGAAAGCACTGAAA
AAGATGTCGTGTGAAAATAATggttttttctataaaatcgaAACATTAGG
AAATATATGGGATACCGTTCTGGATTATATTCGGGTTATGAGTCGCCCGT
TAATCCCGAATTTAAAAGACAGTGGTCGGAAAGAACTCAAGCCAACATAT
ACACCAGCATACCTGGATAGTGCTGGTTTTGGCATGGTTATGACAATCTC
TTTAAgcgttttcaagaaaataagtTATATTCATAATGAAGACCCAAATG
ACGTCAGATATTTGTATGAAGGTTTCTTAGGTGTAGCTGGTACAGACATA
TCTTTGAAGAATTTGAAGGACCAAGTTGATCAATCCAAACTTGGTGTTTT
TAGTCGTGGTTTTGTTATCAATAAcaatggttttgttttgattcatcCGA
AATTCCGTGACCAGTCTGGCTATCTTCCTGTTCCCCCAAATGTCCTTATC
GATGAGTTAGAATCAGCTCAGGATCAAGAAGATACGAGTGCACTAAAGAA
GCAAATGTTGAAATTAACGGCTGATGACCTTGAAGGTGGTCCTGTCGAAT
TCATTACCCGGTCAACTTATGATGATGGTCGAAAAGTGTATTCAGGCAAA
ACAAAATATTGGTATAAATTGCTTCCTGATGCTGATTTGGTTTCCGCCCT
TGCATTGGATGAGATTGATAATACTTACTTAGCTGTTGATGAATCGACAC
TCGAATTAAAGGCGATCAAGGAAAAAGGAATCGAAGCCTTAAAGCCACCA
GTCGATGACTTTGACTATGATTATTGGAATTTGACAAAAACCAACACGTC
ATTTGTTACAATTGCACCATGGAATTATTGCAACTTACCCGAATCATTAC
ATAATAAACCACTTGGTATGAAATTCTACCCAACGGTTGGCGAGATCTAC
ACATTCATGAGTAAAAATCCAACTGATTATGAAAAGCATTGTAAAGATAA
AGAGTTGGTAACTCGGCTTTTAGCAATGGCTGGTGTAACGAGTGAAACTG
TGGATAAAATTTGGAGTCAATTCCAGTTTGATGAAGACCCTGATATGATT
CAAGGAGCTTTCTTTGCAACCTCCAGTGgatatcaaaaatatttgtctTA
CCATAATCACACAGATCCTTCACCGCCCTTCAATCGTGATATTTTACGGA
CCAAAGTATTTGAGACTCCAATCACAAACCCGGATATTAATCTCTTTTTA
TCATCGTCAGCGCGTGACAAGACTGTAGGACCAGTAAAGATCTCAATCAT
GCATCCTTTTTGGAAGCAAAAGAACATTGCAGCAGtaaccGGTATTGAAA
TCAACAGTCAACTCATTTACAATTACTTAATGGaatcggcagaaataaaa
atgaCTGAATTCAGTACATTAGCTATCTGTAAAGATACTGAGAACGCTTT
TTGTGGTGTCATTGACGAACATGGATACATCATCACTAGCAACCAAGGAG
AGGCTTACACAGGACAATTTATCGGGGAACGCTTAGGAGAAATAGTCGAT
GCTCTACCGTTCTTTACCAAAATTGAGCTTGAAGATGCACAAGCAGAGTG
TCCGCTATCAGACGAAGTTTCCGCCGCAAATATTTTGCTGACGCCTGCAA
AATTAATTTTCGGTTTTATTACCGGGCTTTGTAAAACATGTTATTGGTTG
GTTATTCAATTTggtattgttttgatttcattgtTTGAGCATGCGCAAAG
AGTTTATGCGGAAGTACCAAAAACAATACGGGTAAGTTGTACCAAAACAA
TGCCGTTTTACCAATTCGATATGAGTAAaatccagaatggaaaaatattc
CAGGAAACGTATAAATGTGAAGATTGTTCGGATAAAACAAAGGACTTTAA
ATTAATTCGAATCAATGATACTAATACAATGCTATTGATGGCTGAAGCAG
ACTCTAATTGTTGTTATAAGAAGCGAGTTAGTATGAATCACGTTAAAAAA
GACTCGACCATTGATTGGTGTAATCCGCCCGAGCAACCGTACAGGCGGTC
GCCCGCTGTTTGTTTGAACGATACGACTTCAAAACCGGAGAATGCTAAAT
GTGGCTCTGGATTTGTtgaaaaaccatcaattttGGTTTTAACGATAGCT
TTTATGTTAGTGTGTTTCGTTTTTGGATAAATGACTGATTTCAAATACCT
TGGATTTATATTGTTAACAATCTTTATACTATGGTTGCCTTTTGGTCAAG
CAAGCAATGAAGTATATAATTACCGTCAGCTACGGGAATCTGACTTCCAA
GGAATAGCTGATAAAATTCATACAAAAATCCGTGATTATGCTAAAAAGAC
TTTACAAGCTGAGAAAATTGAAGAACAATTGAAGAAATTGAATTACATTG
TTAAAACTGTAGATGGTCAAACATTAGAAACGGATTTCTCAGCTGGTCTT
GAATCGGTTTTTAAcggaaaacaaaaaatcttggaaaatATTAAACATAA
GGCTGAAAAAGCTGAAATGGATTATAATTATGATCAAACATTTGACGAAG
AGCATGCTTATTTTAATATGCGTGATATCAAAACACAATACAATGAAAAT
CAATCTCTGGTAATTGTACCCAAATTTTCAGATAATGTTCGTGTTAATTT
CACGCATAGCTTTGTACAAGTACCGACGAACGTGTACGCGTACAAAAAGT
CCGTTTTAGATCAGGTAACATGGGGAGCTGAATTGGATGAAACATTTGAA
GGCAATTTTAAGAACTCGAGTGGATCGCTGTTGTATCAATACTTTGGAGA
TGCTTCTACAGGTATCTTCCGCATCTTTCCTGGAAACATTATGGGAGTGA
AAGAAGATGAACATAAAACGGATTTGTACGATTGTCGGCGACGTGTGTGG
TATATCCAAGCAGCTGCTAGTGCAAAAGATATCGTCATTGTCCTCGATCT
TTCTGGTTCTATGATCGGAAATAATATTGGTATTGCAAAGATTGCTATCT
CATCTTTGATTGACACATTACAAGagaatgattattttaatgtcatCACC
ATCAACACTGAAGTCAAATACATTGTCCCATGTATCAAATATTTGATCCA
AGCCaccaaagaaaataaagaaatgatgAAAAGGGTAGTACAAAATCTCA
CGGAGGCAGCCGAAATTGTGGATGTCAACAAAGGCATGGACGAAGCATTT
AAGATACTAAATATCGGTCCTTCAATCAATCGTACATCTGCTGGTTGCAA
CAAAGCCATCATGTTCGTTACTGACGGGATAGAAGGAACTTACGCCGGAC
AAGAATCATTCGAGAAAAACAACCCAAATAAAGATGTACGGGTATTCTCA
TACCTTGTCGGCCGAATCAAAAACCCGAACGAGAAAGCACTGAAAAAGAT
GTCGTGTGAAAATAATggttttttctataaaatcgaAACATTAGGAAATA
TATGGGATACCGTTCTGGATTATATTCGGGTTATGAGTCGCCCGTTAATC
CCGAATTTAAAAGACAGTGGTCGGAAAGAACTCAAGCCAACATATACACC
AGCATACCTGGATAGTGCTGGTTTTGGCATGGTTATGACAATCTCTTTAA
gcgttttcaagaaaataagtTATATTCATAATGAAGACCCAAATGACGTC
AGATATTTGTATGAAGGTTTCTTAGGTGTAGCTGGTACAGACATATCTTT
GAAGAATTTGAAGGACCAAGTTGATCAATCCAAACTTGGTGTTTTTAGTC
GTGGTTTTGTTATCAATAAcaatggttttgttttgattcatcCGAAATTC
CGTGACCAGTCTGGCTATCTTCCTGTTCCCCCAAATGTCCTTATCGATGA
GTTAGAATCAGCTCAGGATCAAGAAGATACGAGTGCACTAAAGAAGCAAA
TGTTGAAATTAACGGCTGATGACCTTGAAGGTGGTCCTGTCGAATTCATT
ACCCGGTCAACTTATGATGATGGTCGAAAAGTGTATTCAGGCAAAACAAA
ATATTGGTATAAATTGCTTCCTGATGCTGATTTGGTTTCCGCCCTTGCAT
TGGATGAGATTGATAATACTTACTTAGCTGTTGATGAATCGACACTCGAA
TTAAAGGCGATCAAGGAAAAAGGAATCGAAGCCTTAAAGCCACCAGTCGA
TGACTTTGACTATGATTATTGGAATTTGACAAAAACCAACACGTCATTTG
TTACAATTGCACCATGGAATTATTGCAACTTACCCGAATCATTACATAAT
AAACCACTTGGTATGAAATTCTACCCAACGGTTGGCGAGATCTACACATT
CATGAGTAAAAATCCAACTGATTATGAAAAGCATTGTAAAGATAAAGAGT
TGGTAACTCGGCTTTTAGCAATGGCTGGTGTAACGAGTGAAACTGTGGAT
AAAATTTGGAGTCAATTCCAGTTTGATGAAGACCCTGATATGATTCAAGG
AGCTTTCTTTGCAACCTCCAGTGgatatcaaaaatatttgtctTACCATA
ATCACACAGATCCTTCACCGCCCTTCAATCGTGATATTTTACGGACCAAA
GTATTTGAGACTCCAATCACAAACCCGGATATTAATCTCTTTTTATCATC
GTCAGCGCGTGACAAGACTGTAGGACCAGTAAAGATCTCAATCATGCATC
CTTTTTGGAAGCAAAAGAACATTGCAGCAGtaaccGGTATTGAAATCAAC
AGTCAACTCATTTACAATTACTTAATGGaatcggcagaaataaaaatgaC
TGAATTCAGTACATTAGCTATCTGTAAAGATACTGAGAACGCTTTTTGTG
GTGTCATTGACGAACATGGATACATCATCACTAGCAACCAAGGAGAGGCT
TACACAGGACAATTTATCGGGGAACGCTTAGGAGAAATAGTCGATGCTCT
ACCGTTCTTTACCAAAATTGAGCTTGAAGATGCACAAGCAGAGTGTCCGC
TATCAGACGAAGTTTCCGCCGCAAATATTTTGCTGACGCCTGCAAAATTA
ATTTTCGGTTTTATTACCGGGCTTTGTAAAACATGTTATTGGTTGGTTAT
TCAATTTggtattgttttgatttcattgtTTGAGCATGCGCAAAGAGTTT
ATGCGGAAGTACCAAAAACAATACGGGTAAGTTGTACCAAAACAATGCCG
TTTTACCAATTCGATATGAGTAAaatccagaatggaaaaatattcCAGGA
AACGTATAAATGTGAAGATTGTTCGGATAAAACAAAGGACTTTAAATTAA
TTCGAATCAATGATACTAATACAATGCTATTGATGGCTGAAGCAGACTCT
AATTGTTGTTATAAGAAGCGAGTTAGTATGAATCACGTTAAAAAAGACTC
GACCATTGATTGGTGTAATCCGCCCGAGCAACCGTACAGGCGGTCGCCCG
CTGTTTGTTTGAACGATACGACTTCAAAACCGGAGAATGCTAAATGTGGC
TCTGGATTTGTtgaaaaaccatcaattttGGTTTTAACGATAGCTTTTAT
GTTAGTGTGTTTCGTTTTTGGATAAATGACTGATTTCAAATACCTTGGAT
TTATATTGTTAACAATCTTTATACTATGGTTGCCTTTTGGTCAAGCAAGC
AATGAAGTATATAATTACCGTCAGCTACGGGAATCTGACTTCCAAGGAAT
AGCTGATAAAATTCATACAAAAATCCGTGATTATGCTAAAAAGACTTTAC
AAGCTGAGAAAATTGAAGAACAATTGAAGAAATTGAATTACATTGTTAAA
ACTGTAGATGGTCAAACATTAGAAACGGATTTCTCAGCTGGTCTTGAATC
GGTTTTTAAcggaaaacaaaaaatcttggaaaatATTAAACATAAGGCTG
AAAAAGCTGAAATGGATTATAATTATGATCAAACATTTGACGAAGAGCAT
GCTTATTTTAATATGCGTGATATCAAAACACAATACAATGAAAATCAATC
TCTGGTAATTGTACCCAAATTTTCAGATAATGTTCGTGTTAATTTCACGC
ATAGCTTTGTACAAGTACCGACGAACGTGTACGCGTACAAAAAGTCCGTT
TTAGATCAGGTAACATGGGGAGCTGAATTGGATGAAACATTTGAAGGCAA
TTTTAAGAACTCGAGTGGATCGCTGTTGTATCAATACTTTGGAGATGCTT
CTACAGGTATCTTCCGCATCTTTCCTGGAAACATTATGGGAGTGAAAGAA
GATGAACATAAAACGGATTTGTACGATTGTCGGCGACGTGTGTGGTATAT
CCAAGCAGCTGCTAGTGCAAAAGATATCGTCATTGTCCTCGATCTTTCTG
GTTCTATGATCGGAAATAATATTGGTATTGCAAAGATTGCTATCTCATCT
TTGATTGACACATTACAAGagaatgattattttaatgtcatCACCATCAA
CACTGAAGTCAAATACATTGTCCCATGTATCAAATATTTGATCCAAGCCa
ccaaagaaaataaagaaatgatgAAAAGGGTAGTACAAAATCTCACGGAG
GCAGCCGAAATTGTGGATGTCAACAAAGGCATGGACGAAGCATTTAAGAT
ACTAAATATCGGTCCTTCAATCAATCGTACATCTGCTGGTTGCAACAAAG
CCATCATGTTCGTTACTGACGGGATAGAAGGAACTTACGCCGGACAAGAA
TCATTCGAGAAAAACAACCCAAATAAAGATGTACGGGTATTCTCATACCT
TGTCGGCCGAATCAAAAACCCGAACGAGAAAGCACTGAAAAAGATGTCGT
GTGAAAATAATggttttttctataaaatcgaAACATTAGGAAATATATGG
GATACCGTTCTGGATTATATTCGGGTTATGAGTCGCCCGTTAATCCCGAA
TTTAAAAGACAGTGGTCGGAAAGAACTCAAGCCAACATATACACCAGCAT
ACCTGGATAGTGCTGGTTTTGGCATGGTTATGACAATCTCTTTAAgcgtt
ttcaagaaaataagtTATATTCATAATGAAGACCCAAATGACGTCAGATA
TTTGTATGAAGGTTTCTTAGGTGTAGCTGGTACAGACATATCTTTGAAGA
ATTTGAAGGACCAAGTTGATCAATCCAAACTTGGTGTTTTTAGTCGTGGT
TTTGTTATCAATAAcaatggttttgttttgattcatcCGAAATTCCGTGA
CCAGTCTGGCTATCTTCCTGTTCCCCCAAATGTCCTTATCGATGAGTTAG
AATCAGCTCAGGATCAAGAAGATACGAGTGCACTAAAGAAGCAAATGTTG
AAATTAACGGCTGATGACCTTGAAGGTGGTCCTGTCGAATTCATTACCCG
GTCAACTTATGATGATGGTCGAAAAGTGTATTCAGGCAAAACAAAATATT
GGTATAAATTGCTTCCTGATGCTGATTTGGTTTCCGCCCTTGCATTGGAT
GAGATTGATAATACTTACTTAGCTGTTGATGAATCGACACTCGAATTAAA
GGCGATCAAGGAAAAAGGAATCGAAGCCTTAAAGCCACCAGTCGATGACT
TTGACTATGATTATTGGAATTTGACAAAAACCAACACGTCATTTGTTACA
ATTGCACCATGGAATTATTGCAACTTACCCGAATCATTACATAATAAACC
ACTTGGTATGAAATTCTACCCAACGGTTGGCGAGATCTACACATTCATGA
GTAAAAATCCAACTGATTATGAAAAGCATTGTAAAGATAAAGAGTTGGTA
ACTCGGCTTTTAGCAATGGCTGGTGTAACGAGTGAAACTGTGGATAAAAT
TTGGAGTCAATTCCAGTTTGATGAAGACCCTGATATGATTCAAGGAGCTT
TCTTTGCAACCTCCAGTGgatatcaaaaatatttgtctTACCATAATCAC
ACAGATCCTTCACCGCCCTTCAATCGTGATATTTTACGGACCAAAGTATT
TGAGACTCCAATCACAAACCCGGATATTAATCTCTTTTTATCATCGTCAG
CGCGTGACAAGACTGTAGGACCAGTAAAGATCTCAATCATGCATCCTTTT
TGGAAGCAAAAGAACATTGCAGCAGtaaccGGTATTGAAATCAACAGTCA
ACTCATTTACAATTACTTAATGGaatcggcagaaataaaaatgaCTGAAT
TCAGTACATTAGCTATCTGTAAAGATACTGAGAACGCTTTTTGTGGTGTC
ATTGACGAACATGGATACATCATCACTAGCAACCAAGGAGAGGCTTACAC
AGGACAATTTATCGGGGAACGCTTAGGAGAAATAGTCGATGCTCTACCGT
TCTTTACCAAAATTGAGCTTGAAGATGCACAAGCAGAGTGTCCGCTATCA
GACGAAGTTTCCGCCGCAAATATTTTGCTGACGCCTGCAAAATTAATTTT
CGGTTTTATTACCGGGCTTTGTAAAACATGTTATTGGTTGGTTATTCAAT
TTggtattgttttgatttcattgtTTGAGCATGCGCAAAGAGTTTATGCG
GAAGTACCAAAAACAATACGGGTAAGTTGTACCAAAACAATGCCGTTTTA
CCAATTCGATATGAGTAAaatccagaatggaaaaatattcCAGGAAACGT
ATAAATGTGAAGATTGTTCGGATAAAACAAAGGACTTTAAATTAATTCGA
ATCAATGATACTAATACAATGCTATTGATGGCTGAAGCAGACTCTAATTG
TTGTTATAAGAAGCGAGTTAGTATGAATCACGTTAAAAAAGACTCGACCA
TTGATTGGTGTAATCCGCCCGAGCAACCGTACAGGCGGTCGCCCGCTGTT
TGTTTGAACGATACGACTTCAAAACCGGAGAATGCTAAATGTGGCTCTGG
ATTTGTtgaaaaaccatcaattttGGTTTTAACGATAGCTTTTATGTTAG
TGTGTTTCGTTTTTGGATAAATGACTGATTTCAAATACCTTGGATTTATA
TTGTTAACAATCTTTATACTATGGTTGCCTTTTGGTCAAGCAAGCAATGA
AGTATATAATTACCGTCAGCTACGGGAATCTGACTTCCAAGGAATAGCTG
ATAAAATTCATACAAAAATCCGTGATTATGCTAAAAAGACTTTACAAGCT
GAGAAAATTGAAGAACAATTGAAGAAATTGAATTACATTGTTAAAACTGT
AGATGGTCAAACATTAGAAACGGATTTCTCAGCTGGTCTTGAATCGGTTT
TTAAcggaaaacaaaaaatcttggaaaatATTAAACATAAGGCTGAAAAA
GCTGAAATGGATTATAATTATGATCAAACATTTGACGAAGAGCATGCTTA
TTTTAATATGCGTGATATCAAAACACAATACAATGAAAATCAATCTCTGG
TAATTGTACCCAAATTTTCAGATAATGTTCGTGTTAATTTCACGCATAGC
TTTGTACAAGTACCGACGAACGTGTACGCGTACAAAAAGTCCGTTTTAGA
TCAGGTAACATGGGGAGCTGAATTGGATGAAACATTTGAAGGCAATTTTA
AGAACTCGAGTGGATCGCTGTTGTATCAATACTTTGGAGATGCTTCTACA
GGTATCTTCCGCATCTTTCCTGGAAACATTATGGGAGTGAAAGAAGATGA
ACATAAAACGGATTTGTACGATTGTCGGCGACGTGTGTGGTATATCCAAG
CAGCTGCTAGTGCAAAAGATATCGTCATTGTCCTCGATCTTTCTGGTTCT
ATGATCGGAAATAATATTGGTATTGCAAAGATTGCTATCTCATCTTTGAT
TGACACATTACAAGagaatgattattttaatgtcatCACCATCAACACTG
AAGTCAAATACATTGTCCCATGTATCAAATATTTGATCCAAGCCaccaaa
gaaaataaagaaatgatgAAAAGGGTAGTACAAAATCTCACGGAGGCAGC
CGAAATTGTGGATGTCAACAAAGGCATGGACGAAGCATTTAAGATACTAA
ATATCGGTCCTTCAATCAATCGTACATCTGCTGGTTGCAACAAAGCCATC
ATGTTCGTTACTGACGGGATAGAAGGAACTTACGCCGGACAAGAATCATT
CGAGAAAAACAACCCAAATAAAGATGTACGGGTATTCTCATACCTTGTCG
GCCGAATCAAAAACCCGAACGAGAAAGCACTGAAAAAGATGTCGTGTGAA
AATAATggttttttctataaaatcgaAACATTAGGAAATATATGGGATAC
CGTTCTGGATTATATTCGGGTTATGAGTCGCCCGTTAATCCCGAATTTAA
AAGACAGTGGTCGGAAAGAACTCAAGCCAACATATACACCAGCATACCTG
GATAGTGCTGGTTTTGGCATGGTTATGACAATCTCTTTAAgcgttttcaa
gaaaataagtTATATTCATAATGAAGACCCAAATGACGTCAGATATTTGT
ATGAAGGTTTCTTAGGTGTAGCTGGTACAGACATATCTTTGAAGAATTTG
AAGGACCAAGTTGATCAATCCAAACTTGGTGTTTTTAGTCGTGGTTTTGT
TATCAATAAcaatggttttgttttgattcatcCGAAATTCCGTGACCAGT
CTGGCTATCTTCCTGTTCCCCCAAATGTCCTTATCGATGAGTTAGAATCA
GCTCAGGATCAAGAAGATACGAGTGCACTAAAGAAGCAAATGTTGAAATT
AACGGCTGATGACCTTGAAGGTGGTCCTGTCGAATTCATTACCCGGTCAA
CTTATGATGATGGTCGAAAAGTGTATTCAGGCAAAACAAAATATTGGTAT
AAATTGCTTCCTGATGCTGATTTGGTTTCCGCCCTTGCATTGGATGAGAT
TGATAATACTTACTTAGCTGTTGATGAATCGACACTCGAATTAAAGGCGA
TCAAGGAAAAAGGAATCGAAGCCTTAAAGCCACCAGTCGATGACTTTGAC
TATGATTATTGGAATTTGACAAAAACCAACACGTCATTTGTTACAATTGC
ACCATGGAATTATTGCAACTTACCCGAATCATTACATAATAAACCACTTG
GTATGAAATTCTACCCAACGGTTGGCGAGATCTACACATTCATGAGTAAA
AATCCAACTGATTATGAAAAGCATTGTAAAGATAAAGAGTTGGTAACTCG
GCTTTTAGCAATGGCTGGTGTAACGAGTGAAACTGTGGATAAAATTTGGA
GTCAATTCCAGTTTGATGAAGACCCTGATATGATTCAAGGAGCTTTCTTT
GCAACCTCCAGTGgatatcaaaaatatttgtctTACCATAATCACACAGA
TCCTTCACCGCCCTTCAATCGTGATATTTTACGGACCAAAGTATTTGAGA
CTCCAATCACAAACCCGGATATTAATCTCTTTTTATCATCGTCAGCGCGT
GACAAGACTGTAGGACCAGTAAAGATCTCAATCATGCATCCTTTTTGGAA
GCAAAAGAACATTGCAGCAGtaaccGGTATTGAAATCAACAGTCAACTCA
TTTACAATTACTTAATGGaatcggcagaaataaaaatgaCTGAATTCAGT
ACATTAGCTATCTGTAAAGATACTGAGAACGCTTTTTGTGGTGTCATTGA
CGAACATGGATACATCATCACTAGCAACCAAGGAGAGGCTTACACAGGAC
AATTTATCGGGGAACGCTTAGGAGAAATAGTCGATGCTCTACCGTTCTTT
ACCAAAATTGAGCTTGAAGATGCACAAGCAGAGTGTCCGCTATCAGACGA
AGTTTCCGCCGCAAATATTTTGCTGACGCCTGCAAAATTAATTTTCGGTT
TTATTACCGGGCTTTGTAAAACATGTTATTGGTTGGTTATTCAATTTggt
attgttttgatttcattgtTTGAGCATGCGCAAAGAGTTTATGCGGAAGT
ACCAAAAACAATACGGGTAAGTTGTACCAAAACAATGCCGTTTTACCAAT
TCGATATGAGTAAaatccagaatggaaaaatattcCAGGAAACGTATAAA
TGTGAAGATTGTTCGGATAAAACAAAGGACTTTAAATTAATTCGAATCAA
TGATACTAATACAATGCTATTGATGGCTGAAGCAGACTCTAATTGTTGTT
ATAAGAAGCGAGTTAGTATGAATCACGTTAAAAAAGACTCGACCATTGAT
TGGTGTAATCCGCCCGAGCAACCGTACAGGCGGTCGCCCGCTGTTTGTTT
GAACGATACGACTTCAAAACCGGAGAATGCTAAATGTGGCTCTGGATTTG
TtgaaaaaccatcaattttGGTTTTAACGATAGCTTTTATGTTAGTGTGT
TTCGTTTTTGGATAA
Gene-mRNA-Prot