TCONS_00000105 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000105
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1566

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000105 ID=TCONS_00000105|Name=|organism=Clytia hemisphaerica|type=transcript|length=1566bp
GAATGGTGCTTTGGACCAAAAACGTTAAAAGAATAAACGAAAAATGGCTA
CTGCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAG
AAAAGATGTGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCA
AACAATTACACGCCAGCAACCTACAAATGACAGATGGTATTATTTCTTTG
GATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGATTTAACA
TACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAAATCACA
GCCACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCATGCTA
AACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAG
CAAGCATTCCTTCAAGAAAGaCTTAGACAACATGAAAACTGGTCTTGGAT
GAAAGAAAAGAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCA
CATCAGACAATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTG
AGAGTTCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaa
tgaagaagaagatcaacTGTCCGCTACCggatgttttgaaaatgaagatg
atggTGAAACAGTTGACTGCACACtgcatgaaaatgaaaaagaaacttta
aaacGGAAAACAGAATCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAA
AATTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAAG
AGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCAT
AACCAAATTGGAATGAACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCG
ACAAAAAGATTTCGTGCAACGTTACACGGCATATCACCATTTTCGTAGCA
AAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTT
TATCAGAGTGGTATGCCTTTCTATCATGCAAGTTATTCAGTCTTTGTACG
CTATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGA
AAGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTG
CTGATTTGCTACGTCGTGAAACCCAAAGATGTCGATGAAAGTGAACTGAA
AAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGAC
GTTGGTTACCAGAAAGACATCGTGAGctgaacaaagaaaaaatctcttga
aaaaGAATATACAACGGTGATAAGTATGTGAAGGATTGTTCGAAAATTGA
ACTATACTGTATGGCGTGAGATCGATGCGATAATGAAAATGGTGAAGATT
GGATGCATAGAAGAACTTATTGAGTGTTTTATAGTTTTATTACCaaacaa
aatatataattgACCATGGAGCAGCATGGagttataaagaaaaacaggag
atgTATGTTATTATAACCACCCttgccctacgattaaaaaatgTTACGAT
TTTACATACTCATAAT
Run BLAST on NCBI

protein sequence of TCONS_00000105-protein

>TCONS_00000105-protein ID=TCONS_00000105-protein|Name=TCONS_00000105-protein|organism=Clytia hemisphaerica|type=polypeptide|length=418bp
MATAPNYLMTDELLRKPRKKRCGRQVPLSPFPVPIQTITRQQPTNDRWYY
FFGLLKSDHVAVYRKGDLTYLYQMGFFGKGILSKSQPQYEKYEEESFLLD
HAKRQSRSEGRSKAQLESKQAFLQERLRQHENWSWMKEKKDDIESTRNTL
KVTSDNSTELSSTINSVDLRVPDESYGTDGEDELSNEEEDQLSATGCFEN
EDDGETVDCTLHENEKETLKRKTESQDDWSVGKMAKIEDQYKLFEYLQLT
FEEAFFLSYGLGCLCVEDHNQIGMNVGEMWRTFSCRQKDFVQRYTAYHHF
RSKGWVVRFSNLFGADFVLYQSGMPFYHASYSVFVRYMDEKDGGLEEKSF
SWKDLSCICRVNEKVAKEVLICYVVKPKDVDESELKSPGVLKKLRVVEMV
IRRWLPERHRELNKEKIS
Run BLAST on NCBI

transcript from alignment at sc0000001:1947941..1987921+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000105 ID=TCONS_00000105|Name=TCONS_00000105|organism=Clytia hemisphaerica|type=transcript|length=39981bp|location=Sequence derived from alignment at sc0000001:1947941..1987921+ (Clytia hemisphaerica)
GAATGGTGCTTTGGACCAAAAACGTTAAAAGAATAAACGAAAAATGGCTA CTGCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAG AAAAGATGTGGACGACAGGTAAGAATAgaataaaccagttatcagaggAG AGCTGTCAAATGGACAGTTTATCAATGAAGTTAGTATCGATAAGTTATAA GATATAGAGCCAATAAATATTCTGTCAGTTCAACAAAATACAAATATATT TATTTGTAAGTCGTTGGTCAGTTTatgcatgtttttaagaatATCAAACA GGCTCATAAATGTATAGATTGGTTTTGATAGGCACTCAAAATCGATAGTA AAATATTAACTACATGAAGATGGGTAAAGACTTGAAAGAATAGACTGTAT TAGATTATTACAAACTGGTACATGAGACCGAACGTACAAGTCAGAAAAGT AGGTCATAGAGAAAGATAAATGCTTTGAAAATACAGCCggcgctctctaa tttgacgttctcctattcgatatgctccattattcgataatattgaaagt caccgtcaacaagaaacctCGATGGATGTTAATAGAAATAGTTTTAAAGA ACTTCAAGGAAAATAGGGtgttctttcatattttttttaagtttaaggGC ATCAATTGACTTatccatttgcttacacagcattttcaaacaaaaaaaaa accgcAACTTTTTCTCCCTTCTACAGGTTCCGCTTTCACCTTTCCCAGTT CCCATCCAAACAATTACACGCCAGCAACCTACAAATGACAGATGGTATTA TTTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTG ATTTAACATACCTTTATCAGATGGTAAGTGATGAAATAAAAACCCTATAC CTGGGCCATTTAAGcaatgattgattgattgattgattgattgattgatt gattgattgattgattgattgattgattgattgattgattgattgattga ttgattgattgatatgcTTGGCTCATTCGAATGAAGAATGTATTAAGAGA CTTTTTGTGAGGCATACGTGAATTACGCCCGTTGAAACGGCCAAAAAACT GACGTTATAGACAAAACATTTAAGGGAAAAAAGTGGAAATGATTGATACC ATCGGAAAGAATGTGAAATTCTAAAGCAAATAAGTGTACTAAGACATAAC CTTTAAATCGAACATACAAAGGAATAATCACCTCAAAATCCTGTCAGTTA CAATCAAATTTATTCTAAGCTGCACAAAGTTTCATAGCTTCTTCATAAAA ATTTAATCGTTTATTGGACTTACTTGGAGGGCCTATAAATTAaactttgt ccgtccgtccgtccgtccgtctgtcagTTCGTTTGTCTTTTGCCAGCTAT TCTCGAGATccgttcattattttttttttctggttaTTGGCAAAAAGATG GTTTCATTAGTTTTCATCAGGTGTAGATCAGATCAGTatctaatttgatt tttatgtttctcCTCCGCAGGGTTTCTTTGGTAAAGGTATTCTATCGAAA TCACAGCCACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCA TGCTAAACGCCAAAGTAGAAGTGAAGGTATGACAAGCATTGATTTCAAAG TTCCGAAGGGGCTAGATACGCAAATCCCGGATTGGGAATGAAGCCACTtt tttcccatccaaaacacgTGACCCGCGTTGTTTTCATAGGCTTTCACACA AATTTTCTAAATGCGGGGCAAATTTTAAGAGTTTACTTTTTCTTGCTCGA GAAAGGTTGAATCTCCCTATCTAGTCCCTTCAGGGCTTCATACTCAATGA TGGCAAGTATACTTATATTCTTTTAGTAAAGTAGCATGAATACAGTGTCC ACAATCATCTGAATACCTTATCGGTCCTTTTTACGctggccctaatttaa cgccggccccttttacgccggcccttattccaccacagcctaattttggg ttTACGctaattagggccgtaaataatgccaaaacttgtaaaaatcgcta ttcaggcttcaaaacagtaagtattaactagaatttacattaaaatgtca tctttcagtattaaactgttgaaaattccattgaaaatcattgattttcg tGAAGTTTTGGATATAGAGTGAAAAATGGATAGTTTTCATCCTTTAATTA TGCccaaaatcctttaaattgaaaaaaaatggtCAACAATTAACGCCGTT TTTAGGTAGACATTGCAAAATGTTGGCCCTTTTTATGCCGGCCCTTTTAA CACCGGCctttattacgccacgagcccaaaagtaacgccaataagggccg gcgtaaaaagggccgataaggtaatttttttcacaaagtgTTAGTGAGAC TACACAGTATATGGGCGAACAATTTGGTTTGCAGACCGTATAATGTAAGA AGTTAACAACATTACAAAAAGGATTTTTGTTTCGGAAAACAATCCCCTTG GagtattgcaaatcgagctggcAATATATTGCGGACGCTTTTTCAATATT ATGCTTGGTGACTTTAAGTCACTTTATTACTCTTCCTATTACCCTAGAAA GAAATATGTTCAACAACGCCTCCTCCCCTACTTAATTAGACCCTTCTATA ATCAAGCACAGACCTTTagtatttcattagaaaaatgtttaaaactAGAA AACCAATAGTTTGAATGCCTGTAGAAAAGGATTTTAtagaagatttgaaa aaactattttttttttttctgcataGGTAGATCAAAAGCGCAATTAGAAT CCAAGCAAGCATTCCTTCAAGAAAGGTAAGTCTAACACCCGTAATTTCCC gtaattaccttttatttcCGCGAtgtgtacacgcttttttttataagaat acactttataagaatgtccatgatgaaaatgaccaaaaaattaagaatat gctaagaatatcaccatcatggaattttactactcaagctaagaattcca tttttggagcattttcaattataaattgtcaattaccccccaagtaaggc tcactcctttcacaaaaatgccatcttatgcttgagacgtatgtactaaa tttTAAATCTAGTTTAAATTAACCTAAGaatatgctgtaagaatatagga tgattttcctaaaaaagttaagaatatccatgatgaaatggatttacacc attcttataaaaaaaaaagcgtgtattaaaaGACACCATTTAACGTATCT CccaccatttgcttacacagcgtTTTTAAACGAAAACTTTCTCCCCTTTC GGCGCCGCTCGAGAAAAAAATTCGCCaagttcttttatttattttgcttt gtcagcatagagaCACGCCTCCtttctatctcataaaaaagaatCTTTAA AGTAATCGAGGcgcgaaaaacaaaaaaaaataaagaaatgaagCTTTTCA TTTGGTTAAGTATTTTCCATTTGGCGTTCTAATTTCTTTAAATTTCCTTA TATTAATCAAACAATCAAATCCTTATATCAAGCAAAAATTAATCCGATCA TAAATAAGTGCAATGGTACGAACATGGACAACTCCTGCCTCGCCTTCACA AGATTACCATCAAGGCGATTGTCTTTTTCTGCAACCTTCAAATATACTTT TATGACAAGAGGAATGCATCAACTCAGTTGGGAATGAAGCGAGCGCTATT TTTCGCGTTTGGGCTTGTAAGAAATTTGCCTTTTACTGTAAGACCACTGT ACGCttaaaatactaaaatcaagtaatgttttaatttcaatttcagaCTT AGACAACATGAAAACTGGTCTTGGATGAAAGAAAAGGTATTgttttttta gttcttttttgCTGGGATGATTCAatgaattatttcaaaatgtttttatt ttattttataagcataacgtttataagcgtattatgcaggctcagttttt ggtacctaagcaatggctctattgtttgagtgagaacaatagaatgctaa gcataatgcgagcctggaatagggacagacacttgcttataaaaaaaaca tgtatgatgTTTGAATGAAGTATGTCGTAACCCTGAACTCGAATTTgagt caaaaaataattttttgcgcGATAAAACTTTCGTCCTAGATAGAAATATT GATTTCTTTCCTGTAATTAAAGCTgtttcccgtcgtcgcaaacgttGAGT AAAAGTACTGCTtatgcttgaaataaaaaaatattcttatgtCTGTTACG ATTGTATTAAATACGGTAGTATAATTAACTGAACTCCGTCTTATTTCTGC AACTACTTACCAGCGAGGCTTACAGCGCCCATTGGtctaagaacaagaaa tccaTACGAATTAAGAGTTTCCGAAACacgagtgaaatattttggACGAT GATATAAGAAATCTACCTTCCATTAAAACATTCACAAAAGTAATTACTGA ATTTTTGAGACTCGACCAGtgtcatgtttttgatgttcctgatAATCAAG GTGCTATCCTCAATAGGCTTCGTGTTAGATTCAGTCATCTCAATGAGCAT AAGTTTAGACATGGTTTTCGTGATACTCTAGATCCTTTCTGCGGCTGTCA gacaaattttgttgaaaatacaCAGCACTTTATTTTGCattgctctatat attcccatgaaAGACTATCActattataaataaaataaatataaatttag AAGTTTTTCCCACCAGCTCGCTCtaaatctgatttttttatCTACTTCAG GCGTACCAATTTTTTCGAGCAGCTGGTTTCGCGAGgccgaaaaatcgcga aatttataacaaaatttcacaaatcgaagtaaaaaatcttttttgtgagc ataaactttcgcgaatcaagacatTAATAGCTACTAATaattttcaaacg aaaaaaCGGCCGAGGGGGACAAATACATTTAATTGGATTGAGACTATGTT CAGCcgttacggtttcgtatcgTTTCAAAACGAAACGATTCCagaaattc gaaacgtcaaaaaagaagactttacaaagcaaaacagattgaaacggttt cgctccactttttttcaTCAGAgtggaactgctccgttttctcgCCCCGA AAAgctccgaaaccaatatgaacactctcgatccgtaacaGAAGCCATAC CCGAgcgatacgaaaccgtaacgtctgaacatggtctgaaACTTTCTTTT GCCTGAGCAAATAACGAAATTCATCGGAAAAGACCTGAGTACGAAGCTCT TCTTCCAGGGAGCACAAAAGGATTATGGGTACACTAAAGGTTGGATTTGA TTGCTCTCCGTCGGTAATATAAGCATGCCTCGTTAGAACTTTAGTAAGCG TGGGCGGACGCCAACCCGCCATCGGAATATGTCAGAAAAAGATAGCAACA CATAAAACGTCAGTGAGTGttgatgtaattttttttgacgtcaaatataa tttttacaaAAGTATTCTTTTGAACGTGGCCACCGAAAAAAAGttcattt aaaagttttattctGAATTGGATAGACGTGTGAAGTAATTATCgacgaaa aacttttttgaaagatgTGGTGGCGCGCTACATCATTGATGACCGAAGAC ctaaagaaatcttcgaaagcAAGACTTCCAAAGGGGTTCTATCATGGTGA AAATCAAATCCAGGGTTTTCAATCAGGCTGTGGAAATACACTAAGCCGAA ATTTAAATGATGACGAGTTGTGTCAGACCAATAGAACATTAATCAGTTAC AAGAATGTTACACTTCCTGACAAACTTTACGGTGGCCGAAACAAACAGCC ATGCATTGTTACCGATgataaagaatttcttcaaagAAAGGTTTGTTTAC CGAGTCTATAATTACAATTTTCAGTATACAGTAAGGAAATGAAGAATATT ACCCCAAtcagctagcacacaacgttgtttcaatgtttaaATAATTTTCA CAACTTCAAtacaacgttagatgaatgttgaaacaattTTATGTACCAGC TGGGCATATCTCACTGTCCTTGTTCGATTAGAAAACATAATATCTTCTAC CCCAACTACAACAGTCACCTGCTGAAGAAAGGCCGACCAAATTTACAAGA ATTTTCATTTACCTTTGACAAAATAAGTTTTGTATAACTTTTCggtttta aacaaaaagtgaACGGATCTTCTTGTAAAACCGCCGGCTTGATCCGGACA ATGTTTGCCACGCGATATACGCTTTTTTACGACTGTTTATCGGCATAAAG GTGGCTCTCACATTGATGCATTTTGTCACACGAAAAAGGCGTGGCCTCAG CTTTAATAAATTTAGAACTCGGGTTCATCCGCAAACTCCGACTTAAATAT CTTTTACATCGGTTATAGATTATGAAGGAGTTAAACGTTGGCTCATTGGA CTTCAGCATTGCGATGAAAACTTATCAAAATGTCGTCAAAGTCCAGAATG AGGAAAATGCATACGTTGGAGAAGAAGAGAGTATTGGTGCACCTTTAAAA GATAGTGATGTCGATACAAAAGTAAAGGGATGTGAGGATGCTTCTCCAAC AAATGATAATGCTCTTTTGGAAGAACTTCGCACAATCAAAGGTGATTACG GTAAAATAAAAGGTGACTATGAGAGTATTTTAGAAAGAAACACGGCAGCT GAAACTGAGATCCGGCGATTATCTTTGGTGAAAGAAGAATCTGATCTGGC GCACCGTGAAGAGGCGGACGCTTTGTGCAATACGATCGAAAATTTAAATA AACAATTGATAATGGCCCGTGAAGAGGTTGAAGATATGAGCTTCGATATC AAGGAATGTGTGACCGATACTACCTCGaagttgaaacaacattttgaCGT GTTGTTGaccgaagaaaaaaaacacaaccaAGGCCTTCTAGCAGAAAAAG AGGCTAAAATTTGTCACAAGGACGCTGagatttctgaaataaaaaaatat tttgagaggGAGCTAGATGCCGTCAAGGAACAAGGAGCTAAAAGTTTAGA AAGAATGCTTTCTATGGAAAAAGAGAAAGCGGAGCTTAACCAAGAAACTA TTCAGGAGCTTCGTAAAAGCTTGGACGTCGAACAGAAATTATTCCTTGAG ACGCAGCACTCCTTACAGCAACAAATGGAATTAGTTAATGCCCAAGCTTC TCAAATCACAGAATTGAATGACAAGAAGGCTGTCATCAAGAAGAAATTGT TTAAAGCAACCAAAGAGGTCAAGGAAGCAAACGCTAAGGTCTTCCAGGGC CGAGAAGAGTTTAACAAGCAACAACAGGAGCTGGATGATCTTAAGGTAAT GAATGAGAAATTGATAAATGATAACGAGGAAGAGCGTAAGAAATATATTG AAGAACTGACACTAAAAGAGAGCGAGTTGGTTAAGATGTGCGATagtctc aaaaagaaaatcgaCATCAAGGAACAAAATGTGGGATTGCTCAAGACAGA GAATGAAGGATTGAAGTCGGCGCAAGTCGAATGTGAATTAAACCATGCAA AAGAGATGGCAAAACAGGATGACGAATTGCTCCGTGTGAAAAGCGCTCAC ATGGACGAGATTGGTAAAGCTAAGGAGCAGCTTGAACAGTTGAAGAAAGA AACCAGCCAGATGGATTCGATGCATCAAGAAGTATTGGCTGCAAAAGATG GCAACCTGGAAGAATCTGAATTGATGATTACtttcttacaaaaagaaaaa gcaatCTGCGAAAAGAAACTAGAGACTGCATCGAAAAGTGTGCTTCGTTT GGAGAAGAAACTAAACCAACGTGAAGTCGAGATTCGTTCTCGTTTGGAAG ATATTTCCGAATACAAGAAGAAAGAGAAAGCTGGCCAAGCTATTATCGAA AAACAAAAAGCCGTAATGGAGAAAATCCAGAACGATTTGAAGCGTGAAAA GAAGAGGATCGAATCTTTGATCCGTGAACGCAATGCTTACAGAGAAGAGG TAAGATTAGCTTTTTATTCCAATAAATTACCATCGATCAGCATCGATAAA GAATTTTTAGGAACTGAATAGCTAGATAGCTAGGTTGTGTGAGTCCCTAA GACAATGTTTGAATGATTGTTTGATAATCAAACACTTCCCCCTGTGCTTC TGCAATTTTTTTCCGTCAGCGAACGCAGACCTgatttaacggccgaagac ctgaattaacggccgaagacctgaattaacggtCAAAGACCTGAATTTCG AGCCGAAGACCTGATTCAACGGTCGAGGACCTGATTTAACAAGTCACCGG CCGAATACCTGATAAATAAGTTAGAGTTCCCTTGCATTCAAATAAACACA ATAGTACGAGAAAAATGAATAGTAAGAATGGTAGATCGACAGGACAGTGA TAGTGGGTATTAGAAATGTTTACCCTCTAATGAAATAAAGGCTATTCTTT TGGCTACGATtaatattttttgaacatttagCGAGGAAAAGCCGTAAAGG TTTTCAAAAAGAGCTCTAAAGGTCTCGATTATGCCAGTGTTATTGAAATT CTATTTCAGGCTCACGCGAATAGTATGAAGAAGATTGAAACCAACAAAAA GCTTGAGGCCACCAAAGAACACTTGCAAACAATCAAGCAAGAATATGAAC ATAAAATTGCTCAAATGCAAACCATCCAAGAAGCAGAGGCAGCGGGTAAG CAAAAGCAAAGAAAACGCAAGAGAAAATCTAAACAAGTTACCTCCAACGA TATCGAAGCAAATACCCTGATCGTTGCTACACAATGTAAGAAAGACCTTC CAAAGCCACAAGAAGCAAAGAGTAACAATCCAAACAAAGATCGACCAAAA AAATCAGATCTTGACAATGGAAAGATAGAAAAAGTCACTAAAGTACAAAA AAGGTATCTATGCTCTATTCTTCTACAATCAGTGTCATAACATTggcaat tttggcaattttggcaattttaccatttttcgaaaattgaagttcgtNGT GTCATAACATTggcaattttggcaattttggctattttaccatttttcga aaattgaagttcgagcgagaaagtcaatttcgggccttcaacttgatctC ATGgaatatttcgatctgggagggatttattggtttctaggctatatttc aagccctatcGGACCatctttgaacttttggatcctcacgTCCTAgggtc ttaagtctagcgttaaaactcagagtNCATGgaatatttcgatctgggag ggatttattggtttctaggctatatttcaagccctatcGGACCatctttg aacttttggatcctcacatcctagggtcttaagtctagcgttaaaaagat agagttaaaactctacctttgCAACCTAATTtggagcacttccaaatcgt ttgtggttataagatttcgtggggaatttcccttttgtgccaagtatttt ggaacTGATTGTAGACATTTTCAATGATTGCCAATTCACCCTTTCGACCG TATCCGCCAACTGCCGCGCGGGCTCTTTTTTGTCTGTTTATTACCCTAAA CTCGCATAGTCTTTTTTTCCCCacataaatacaaaagaaaaacgtATCAA AAAAGAATGGATCTAGTTTAGGGGGAGAATTAAGTAATCGGTCGAAAAAG GCGTACTTTAACTTCTTTTTACAATGGTAAAAGATTGGTAAAGCTTTCTT TTCATTAAACATTATCTTCCACTGATTTTATAGTACGGCTCAACGAAGAA GTCAGTCAAAAGCATCTAAGAACATTGTTTGTACGACGCCAGATGCTATT TTCGACCAACATGATAACGAAAGGCCGTGGAGCGTATATGACACTTCACT TATCACCTTTTGTATCGGAATATGGTTTCTTCTCATCAAGATCTGCAGCA TTGTCACCAACGATGACTCACTCTGGTAGTAACGTCATCTCCAAATCATA TGTATACATTTGTAAATAACTTCTCACACTggatattttatattatttta tacCAATTTATTATATCAAGTAacagtgtatatttttttgtatactttaa tcggatttaatttcaaaaattcgcgaaagttaatccgattaaagtaggtC TCAAAAAACGGCAGATCCTATCAGTAGATTCCGTTAGCAGAACATTATTT CAGATAGTAGTAAaagactgaaatttggcaaagaTGGGATCAAAAACTTA ATTCCCAACAGGCACACCAAATTTACAAAGACAATATTCCCAACTGTCGA TTAAATGTTTACCGCAATACACTGGCttaatttcagtttttttataaatc cTAGGCCCATTTGTTAAATCAATATGTAGGCTTAGATTTTAACCTGCCTT CGTTTTGACGGTGAAATTCTTCCcaagacaaaagattttttggaaaaatg aaataaaaaatatttcaaggaaTACTCCAAAGTGCAAAAAGTCCAAAGTG CAAAAATCTAGCCCACCCCAAAGTTTTGTGGGAACAGACGTCTGTAGCCT TTTCAGGGGTGTCGGataatttgtgtaggagagcagacaAAGATAATCTT GTCAGCAAGAGTCTGTTCACTTTTTCGTTGAAGATAGCGAAACACGTATA AAGCCCCATATGCCGTCGGGACCCGAGTGAACAAAAACGTGAAGGATGCA TAAACCGGGTGATCTTTCTTAGCATACTCAATTCCGAGTAAAAAATCCGT CCAAAAGTTCACCAATGACATCAggctagactagtaaactagtcgttgaa aacagacccatatacaaacaagtgatacttttatggacctacctggttat gcatttaacacatttataattgatatctacgtgatgtgaccattaaacaa tcattcagaacacaaatagtgacgatctattaaaattagttgtttgtttc ttattaaaaaaacgttgagaaaccaaaatttcatgctcttgaaatattct ttcatattacagactttgtgagcaaaaaaaacacaaagtccaaaaattcg ttttttagctgttttttggcccaaatttgccccaaattttttttttcgga aattgggctccgtcacattcaaggtttatagttatgcatctttgtgcaaa aaatcttaaaaaatgaaagagaatctcgagaaaagctaatacctaagtaa ttgataatgtgcttataaaaatatatcgaatttggccagtttttctataa aaacaagccaagcaaccaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNtattcttcaaaagtaagccct cgtgagcaaaaaaaacatctatctcataaaaaaattgagtaatttgacta agaacattgatgtatgcttattagtagtggttcttatagataaacatgcg ttttttgagccaacaaaatttttttgcaaaaatctgcttgagccgtcttt tacctatgatggtaccctactttcatNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtccaaaaaacctgt tttttagccgttttttggcccaaatttgcccccaaattttttttttcgaa aatcgggctccgtcacattttggccactaccattttgcacctttgtacca aaaatcaaaaaattcctataattcaatcccgagaaaagttggtaacagac ggacggacggacggacggacgaacacaggttgatttataggacctccagg taggtccaaaaatcaagctccaaataaaaagaatcgaaggggtgaagttg cgtctcttttctgaatttcaatttcaaaggttattttccttttctctcac gcgcgctgaatatttaattagtgtttacattatttgattgatagttttat tataaggttataagtaataaccgactagtttactagtctaacaTCAGGCA AATATGGCGACTCTGAAAAACAAAATTCCGATGCGCTTCAGGTTGCCAGA TTTGTGTATTTGTCCTGTGTCTTCTTCAACAAGGCTGCTTTCCATACTTG AAACTAGAATCTTCATACAATTGAATATTTTATCCGCACCACCACGCAAA ATCTTTACAAAGAAATTGTGAAATCAGTTTCTTTTCACAAGTATGTAACA GAACTACAGAATTTTTCTTGATGATTTTAATTATTGCTAGTGGTAATTAA TGATAATGCTCAATTAGTTGGACGCTCAATATTGCGTCACTTTAAATAAG TTTCTTGAATCATCTTCGCATGCTTATATTATAAGGTGTGCGCAACTACA CAAATATTAAACGGGTTTACGTGTAGCCATTCTTTTAGCGgatacaagtt tttttgataaaaacttcCAAGATTTTTGAGGtctttggatattcttaaat ttttgagatttaagcctaaaaatgttcttaacatgatCTTATTCTCACaa ttttttgtgtattttgcCCTTTTCCTAAGACattgggtgttttagggtct gctaagccttaaaatgttcttaactttttcttgacatttttgtcatcaaa gccttatgttcttatatagtttgttcttataaaaaaggttgTGAGTTTTA ATCAAGTTTGAATAAGATTGCCGATGTTAGACCACTGCTTAGCACCGTTC TGGGACCGGTCTGAAATTCAGGTACTTGAAATCCCTTTGGGAGTCAATTT ATGCACattgattttcgtatttttcatGCTTGATTTTAATGGAAAAACGG TCTGGCTTACGGACACGACCCCATTctaaaaatgatttatttcaagCAGT ACTTTGACCAACGTTTGCGACGACGGCAACCGTCTAATATATACTATGTT ATAAGGTAGAGCTGTTCATGATCGCAATGAATCTTGGGGAATCTTctact taaaaaattgtttacgCTTTTGAGTCACAGGCCGGCTTCCCTTTTTAATG GGAAACAACTGCGCAAAATATTCTTCATGCTTTTCACATTACAGCTGAGG CTCTCTGACACTCTaccattcgatacgctcccttattcgttgaaaatcaa attccccttgaaaatcaaattaaagagagtaagataaaaatcatttttct tctAGAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCACATCA GACAATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTGAGAGT TCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaatgaag aagaagatcaacTGTCCGCTACCggatgttttgaaaatgaagatgatggT GAAACAGTTGACTGCACACtgcatgaaaatgaaaaagaaactttaaaacG GAAAACAGAATCGCAAGACGTGAGCAACCTTTTCTACATTTTCTTTTGGC TGAATATTTGAAATTCTCCCATATCATATTCAAGTAAATCTCATTTTAAT GCAACGATTTGCCTTTTTTTTAATCTGTGAAGTGAGTGTCACAAACAAAT TATTTCTCGCGGATTATTTCTAAACTCCTATTTAAAGAATTTATTCGGGC AAGTACTTAGAGCACTGTATGATTTTCTTGGGATTCACtaataagtaagt ctgcgactgcagtcggaggcgacccgaagactcctctttcgatagctatc tacccgaaggtaggggaaggTGCagctctttctccctggattccTCCACT CACCTTAATTGATGAGCATCAAGCATAGAGGTATCAAGTATCATTTTGGG AATccttggtatgacccggctgggggttgaacccacaacctttcgagccg tagccggatgctctaccactgcactacggtcgcttcaCTTTTAATTTAGC TGGTCGACCAATATCTTTCCCATAGGATTGGAGTGTTGGAAAGATGGCTA AAATTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAA GAGGTATGCTCCCATCTTTAATGTTTATTGTACTTTGTCTGGCTCTTTAT AACTTACGGTTTTGGAAAGTAGAAgatttaactctgagttttaataaaat tagaCTCGACACTCACTCAGAATGTAAAAGTTAGAAAAATGGTTAAATAA GGCTTAGAATAAAGCCTGGAAACCGATAAACCCTATGGCATAAAGTGTAA GGACTGAAATTGGCATTCTCGAAAAACGAAGAAACACTCAGAAATACTCT ATTATAATATTGTTTTTTAGAAACCAGGGCACAAATCTTATTTCCACCAA ATTGTCTGAGATGCTTAGTATCTATAAAATTAAAGCTTATTATTTGGCAT TACTTTAATTGTAAACTCATATCTAGCGACTCATACTTATTTATTAATCA TCTTAAAAACTGTTCTTATACTGTTGAGCCTTTCTATTTCTTTGTTTGTG AGAAGTTGGCAAAAACTTTGGCAAAAAcaagacaaaacaaaaaattaaat atttacagttaaaaacaCGCTTAGGTTGGACATTTCCCCTCTAGTCCTCT ATTACGTACAAATCCCATCCTAGtcatactttataagaaaaatgctTAAA ACATTAACGTTTGGGCAGCAGAGCTAATTGTAACTAATATTCATTTTGTA GAAATGGAGCTGTAGGCTGTTCTGTTGCACTTTCGCTATGCTTAAGTTAT ATAGCTTATAGTTCAAATTTTGGTTCAGCTTCAACATCGGGCGGGACATC GGGCGGTAGTCTTCTATTTCCATCTTTTACGCCATTTGACGTCCGGACTG TTTGTTACAGGCTAATCATCACCTAGTTCAATAGACATTACAACATTATC TGAAGGTCGAAACGTAATGTCTGTATTGGTTGCCTTATTCTTCGTTGATA GTTTACtattcttttttacttttaatggAAGCTTAACTTTTAGTATGTTG TCATGATTTTCTTTTGCGCAAGTCTTAGGAATCTCTATTGCATCATTGCA AGCTCCCTCAGGAACATATTTTCGTTTGACAGGTAAAGTTTCAACAATCT TCGGAGGACTTTCCAATACAGGTTTGGTGAtctgtgaaaaaaaatataaa aacggAATGGTTAAAGTGTACCTTTTGAAcaatacacttttttagttTAC ATAAACACACACCGTTAAAGCTGCATACGACTTCCGGTCGTTTTTGCCTG GCTACCCCCTTCTGGACCAGGGAATAAAGCGGTGTTTCATGCCAGTTTCT CATGAATAAACTATATCTTCCATTGGATCAGGATTTTTAGAATTAGGTAC GTTCGGGGGCACTCCTCAACGAATGTTAATTTCTAATCAAATGAAACTTT CCATTATAATGTTTGACCCACATCAATCAATGGTACCAAAATCACCAGCT TTTGTTTGGGGAAGATTGAGATACTGGTCCTCCGGGGCTTATATAAAACT TAGAAAGTTGGGTCTGCACTTTACAGTTTCATCTTGAAATAACGTGTCTT ATGGTGTCTCgtaatttttctctttctcgTGGACTTTTGGAGGGTGGGGg ttatttttgtaaaaggttAGATTAGAACAAAACCCatgtttctatttcta ataTCCAGTTGCGGCGGAaaaaccgtaaaagtggggaggttGAAGGCGCA AAATGAGATAGGATTCGgtagaaatttaagaaaaatatctcatttgctca aaagtggggagattgaagtctccccagtctccccgcttccgccgggcctg caTTCTAATCTAACCTGTTTCTCGGTTCTATTGTTTGCTGTCTTTAAACG ACGCTTCAAGGGTTTGTCATGGTTGAATATGGTTGGTACAGCATCTTTCT TAAGCTTCATCTTGTTTTCACCTCTCATAAGTTCAGCCTGTATACAACGA AAGATTAATTGATGATTAATGTAACCCTAATAACAACCTGCGaaagtttt aataaaaacaGCGAATTTATAAGGGCAAacagtcgactctctctaattgT TGACTCATGGGACCAaagttttcttcgaattagagaaagattcgaataac ggAAGTTCGAATTTATACcctatgaaaagaaaatttaaaataaaaacatt gcacTTTTTTTTCTCATATAAGAACAgttatataagaacaatgaggctca gaatcgccaaaaaataagaacaatgctaAGCCTGAATTTACGTCCAAGTa ttttaggggtcaaagtattAAAATTGGGTATGACGCTTAAAATTCCACAA atacaccctataaataagaacaggattgatgctcaaagtgccaaaaaatt aagaacagccgaacctcagcaaaattttactggttcttataaaagaaagt gtaTAGTAAGAGATGATTTtggtttaaaagaacaaacaaaaTATAATACT TTTTACAACGGAAGTATATATTTCGatttgccctaaaaataagaacagaa taAGGACAGTTTGACGCTTAAAGTgtataaaagaaaacaaatctACTAAA GCCAGGGgagggggtcttgcagttactcattgacactatgtggagtaact gcaattctggacattttctacagacaccaccaccctNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNCgatgttgcagttagtccactggtggagtaa ctgttttcccaaattttggtttatataccaccacggtagtaattgtcata gtgtttatataataactgcatatcttaatcattttccaagtttgttaaaa tatctttcatgccttgattgaagaaaaaatgtgattttttttttactttt gaaaaaaatgttttgaatttttttgcttccggaatttttaaaaacctaaa attttaagtgaaaaattgaaaaatttgctcANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNcccccccccccccccctgctaatGCCTCTAACT ACCTCAAGATCTTTTTCGAAACAATCAgcttcaaaatgttttgaacATAT GTAAATGTGTTTTGGGATTTCTTTTCGTCTGATCTGTGTCAGCCATTTCG TTCTTAATGATTTATCTCTAGATTCAGCTGGTATTgaataaaatttgatt tcaggATGAGTTGTGCTTCTCCTCTTGCAACCATCTGCTCTGCAGTTTGG CATGTCTTAAAACAAGAATCTCTTCACAAAAATTTCTAGGCGAAGAATTT GCGAGATTATGAGAAGgaggagtctgctaaattgcgtgggttgcgtgggt gcgtgggtcaatatttttgcgtgggtcaatattcttgcgtgggtcatttt tttgcgtgggtgcgtgggtcaaaatattttttgcgtgggtcaattttttt gcgtgggtcatattttttgcgtggctcatattttttgcgtgggtcattat tttttgcgtgggtcatattttttgcgtgggtcattattttttgcgtgggt caaaaattttgcgtaggtcaaattttttgcgtgggtcaaattttttgcgt gggtcactatttttttggtgattttttagctaactcgatttttttaccaa attaaaactttcaagctatcttatacaaaaatgtAATGTGTATctacgaa aactaaacaaaagcacaCTGTTTTTATCTAACGCGTTGTGGTTTATTTTG CATAGCTGCACTTATTTACTATAATATTATACATAACCAACACACACCAG TCTAATTTTTGTAGACACACTTCAGTatcacacttttgaattttagcatg CTATATGGATTCCAGTGTCATGGAAATAAACCCTATAActctaagcaaaa aaaatgagatacagggtgtccctaattaaagtatcgagtcgaaacacaac tatgagtagaaagttttatgtgcgtgttcacaaaattgtattttaagctc tccctcttttttctttgtcattacgattaatttatacgttgtaactacct tctGTAATAAGCcttgtgatggagaacgttcttatattttagcgataaca cacacaaacttttctactcaatcgcatgttcaaactcgatactttaatta gggacaccctgtaNNNNNNNNNNNTTCCGACCTCGTTTATTGGAACAAAT TCACCATATTCAGAAAGTACGGAACTGTACAgctatgcaaaataaacaaa ataaaccaaaacgtgttatgtaaaacacagccaacattttggatgtgacc agttcgaatttcaagggaaggcttcttttcgaattacagatataattttg acccacgcaaaaattttgacccatgcaaaaaataatgacccacgcaaaaa ataatgacccacgcaaaaaataatgacccacgcaaaaaatatgacccacg caaaaaatatgacccacgcaaaatttttggcccacgcaaaaaatattttg acccacgcacccacgcaaaaaaatgacccacgcaaaaatattgacccacg cacccacgcaaaaaaatgacccacgcaaaaatattgacccacgcacccac gcaacccacgcaatttagcagactcgagAAGGAGCAACCTTCTTCTTTAA AACTCTACTAACCGCATTTTGAACAGAGTTTGAACAGATTTTTTGGACTC GCTTTCTGAACCGTGTGACGTCATACTTAATAGGATTTTTGAAAGCCTGC TTAAAAAAAGGGAAGAATTGAATTTattgttttataaaaaagtaaaagag tGAATGAAACATAATGTGATTTTATACGAACACGCGCGTTATAAAAACGG GTTATCCATTACGGATAATTTTCTACAGATCGGTTTGAATCGGAATATTT TGGAAAACCGATCCCAACAGTTTCGCAATATCCACTTCAGATTTTCTGAA CCAAATACTTTCTGATAACAATATTcatacaaagaaaatttaattgaTTT AATCTTGTGATCTATTAGGAAATCCATCACCGTTATCGCAAATGTGTCTG TTTTGATCAAAAACATAAGTTTCTAAAAATCGACCAGAAATAGCGACCAC GACCAATGAACcttttgataaataacgagattgctcacgggaattctTTG ACCCGCATTCCGCGCGATCGTATTTAATCGCCCGCGCGTGTACGCTCTGT CTGCTGTATGGGTACTGTATGCAAAAATAAGCTCCTCTTTTCAgtctttt gagactttaaagGAGATTGGAGAGTGCCCTAACCCCTCAGATGGAAATTT CTAATTTCATAGACACTAGCAGGGTTTACCAGCCCGTTTGCTGAGTCCCC TTACTGAATTGGAATAAGAGTCACTCAAAAGAGTCCTGAATATCGCGAAG ATTGATCGGCTCTTGCTCGGGCTCTTGCATTTTAGAATtaatctaaaatc atttctttaagAAGTTAATACCTTGACAGGGTGAAAATATACAGTTCATG GCAAATAAAAGTATTAAATCATTAATGATTGTTTAATTTCAAGTCCTAAT CGGTGATTTATAAAAAGAgttattttgtcagcattgaccaaactttttct ggttttatgagcttttatcgacgattttgaaaattctcgttagaatttta agaaacaaaaatgttCTAAGTAGTGTCACCTCAGTGCAGTTTTactcaag tacagtatttcaaaatggatcaggttggTTAGCCGTTTAgcgggtggaga gtcaagagtcatgactttcccttctcttgaaaatccagtattCCAAAACT TTTAACTAAAAGAAAtacatcaaaattaaaaaaaaacacttttttcagaa ccacaagtgaaacTTTTACTCACTTTTACTCATACAATATTGGATATCTC TCCACCGTAGAAAATGTCtaaatcaagtcctcagaatactaaaaagtgac ctttgaattaaccagtcattttcttgacaaagtcgacactatttgataaa aattaatGACTGAAGCGAAattactgatgtatcatgtaattatgcttctg tttaatttgataggtcgatttttttttattaaattgagCATAGCTTTTGA TATAATGAACCAAATtttataaatgacccatcaaaattttagtttatctt tcttctttccaatgaaaaatgttttttatttttttatttttagacctCGA GAAAATCCACTTTaaatagagaaacttttttcgtgGCGCACCAGGTACTT TTTCATCGTAGATCCCTTCTGACCCCTCTCTTATCAAAGATGTAATATCT GTTAAGCTGGAAAATCCACTTCACAAATCCAGTGAAAAGGAAGATGAATC TGCAATTCTAAATGTAAAATCATCTGTCCGTTGAAAAGAAAGATGGCGGA tgcaaaaagtaaacaaacgaaaatgaaagtgaaaatataaTGGCTCAGAA TGATTCTTTCCACATGTACACGGGAGAGTTACTGTATTATGTTACTGAAG AAATTTCGAATGGATGCGATCCGTAAATTTGTGATGCCTTAAGATTAAAT ATtcaaattgattaaaaaaaaaccaatAAACTtcctgttttttgtttttc gaatATATTTAGCAATTAGAAAATGTAAGCTtacaaaaacgtaaaaatta tcaaaagtagctaataaaatttttttttcaatttagtaaTTCAGTCCAGT TCATTTGCTCCGATTCGGTTGAAAGTCTAGATCTAGTGTTTGATGTAATA GACTTTGACCAATTTGGCTTTATTGATGACACCTGCagattttcgaattt tgaccaACTGTGGTGCACTTTTATAACATTTGACTTTGTAGCCTCCACCA TGTCTGATTCTGAAACATTTCTTGATGATGAATTTGGATGTGAACAAACA TGTCTTTGTGAATTTGAAAACGCAAAATTTATACACTTTCTTTTTGATGC ATTTGTTACCATGACGTTTGACGCATGCGTACTTGAGGTATCATCTGATT GGTTTGTTGTTGCTTTTGGTGAGTCGACATTGAACAGGGTGTTTGTCTTT GAAGATGAAGATCTTCTTGGCGTAAAGAAATCGCTTGTAGCTGGCATCTT CATCTAAAACCGGNTGAAGATGAAGATCTTCTTGGCGTAAAGAAATCGCT TGTAGCTGACGTCTTCATCTAAAACCGGAGAAAAAAGCCTTATTCAAATT TCAATTGACTGGCTTTTGattatctttgaaaaattttgaattcaaaaaga GGGTTCAAAGTTCAGAATTAAAGTTTTTGCTGCTTTCACTTTGGCCTGGA AGAAGAAGATAAAAGGCTATACAAAGACCACACAATATATAGAGACTTAT CGAGTAGAATTCTCACCTTGTTTGAGATCTTGATCTTCAAGTTCATCTTt tatttcttcttcatcttcatcgtCTTGTTGGTCGATCGTTTCTTCGTCAC TCATTTCTATTCCTGGAAGTTAATCCTCCTCTGCTTCAATGTTTGCTTCT TTTGCCTCTTCTTCTGTTTCACAGTGAACTGTGTACACCAAGAAGGAGAC GAGTAACAAAGCTTTCCAAATCTTCATCTTTGTGAGTGTTTGTTGTCTCG TTGTTTACACTGAACTTGACAATTTGAAACTGTTTGCTGATGATTTTTCG AAGCCATGATACGCCCTATCTATGCATTTTAGAACACAAGGAAGCCCTTT GTTTAGATAAAAGATCTTGGTTTCTCAGAACTTCCgaccttcaaaaaaaa aacatcttttaaatcattaaaaagatTGTTATATTTTAGATGACCTTGCC ACTGGAATTGCAGATTCATCTTCCTaggcaatttaaaaaaatgtaccTCG GATGAATCGTATGTGAACAATGATCTTCTCCGTAAAAATGACTTTCCATT TTTGGTTAAACGGGGAAGTACTTTGAACGGTTTTTAAAAACTCTTAAAAT TTCTACGATACAAAATTAGACTAATTTATCAAAATGTcactaggctgctg gcatccactaatgGATTCGTTTTCCTTATATTGCCGGTGGTTTTGTTGAA GTCTGTGATCCAGTTTAGGGATGTCATAAATCGAGCAGTTTTTTGGACCC GTTGAAAGaatccttataaaaagaaaccTCCTAAATTCGAAGGATTTATA TCCCCTGACTTTCAAGTTACCCttagtggattaatttttgcgtaGATTTA GTTTGGCGATTGgcaaaaatgagatttttcgcGGGggtttaatttggcga ttgatCGATTTTGTAAATGTTGGCAGGGAtttaatttgacaaatttgGAA TTTGGAGACACTAAAATGGATGAAAGTTACTATAAAAATATACTGAAAAG GTTTGATTATACCcataatattctttttgttaaatttatcggggatttaa tttgggtGAATGGCCAATCTTTGAagttttggcggggatttaattggCGA AATTTGtcgaaatttgtcaaatttgccAAATctaattcctgccaaaatta atccacttagaGCATGCGGCCTTGTCTGTACTTCTTTTTGAGTGGTCAAA AATACAGGTAGTACTTCAAAGCGCCATAAAGTTTAAATCAGAAAGTGTGC TtgttttttgatacattttttaaATCCACGTTGAATTCTACGTCAATGGA TATATAATTTGAAGGCGTTTGAAGCAAAACCATAGTCAAACTTTCACTGA AATTACAGTGGACATTGTTAACTGGAAGGATTTACAATACCTGAATTTAA AGTTATGTAGCTTCGAATCTATCTCTTTTATATGAGCCACGTCTAACTGA ATTGGGGTAACAATGAAATGGTTTGAATTTCGTAAATGAGACTGAAAAGG CCTTGCCAGGATTCGTTATGAAGTAAAATTGGTCCATATACAATGCGCCA GTTTTATTTAGCTTTTATCTTTAGTCTTCTTCCTTTTAAGCTTTCCTGTA CTAACCAAAAATAATGAGCGCAAGTGGGTGAGAGAGTCAGTGAGTGATTA TTCAATTCGCTTACTCCAAATTACATCCTGCCAGATTTTACTTAAACGAG GAAGGAAACATAATGTCGATCATCGTCGTATAAATTCGTATAAGAAACCT TAAATCGGctccgagcctggagttccttatttttctagaaaatttcagcc tcaaagttccttaccGAATCCCTTATTTACTTAGCTGCTAAGTGCTAACC TTGGATTTGTTATAGAAAAAGACGTTTACTGAATGTTGTTTCGTCAATAT TTTTCATCGTTTTGTATAGGGTTTTGTAAATGTGTGCAAGTTCAACttct actttttggacctaccccggtggaggtcctataaattaacctctgttcgt ttgttcgtccgtccgttcgttaccaacttttctcgagattggctcattag tttttctctgattttttgcacaaagatgtgtaactatagaccctcgaatg tgacggagcccgattttcgaaaaataatgtttttggccaaagaacggcta aaaaaagggttttttggactttgtgaaatattgaatcattgtttcattga ttttttgcatcaaggtaggtaaaagatggctcaagcagatttttgttaaa aaataatttttcagctcaaaaacgcatctttatctataagaatcactatt aataagcatacatcaatgttcttagccaaattactcaattttttgatgag atagatgttttttttttggtcacGATATCTTGattatgaaagaacatttc aagagcatgaaattttggtttctaaacgtttctttttataagaaacaaac gactaatttcaAGATTCGACTAATACGATCGTGTAAAAAACGTGCATCTA TGATGTAATCTTATTTACGGAAAAAGCTATcgccagattttgaaaaaatg tacaGCACGAAAATAAAGAGAGCACTAGATTGCTAGTCTTTATTTTGATA TCCGGGTTGAGAAGGTAAGTCGTGGTCAAAAAAAGATAACGcttttaagg cttggggacaagagaagtttttttcgcgtttgtACAGTGCAACATGCTCC GTCTCACCAACACAGGAAATAATatgcgtgtcccatggtttaTTTTGGTT GTtccatgggacaaaaagtgagggaaatatcCAAAAGACACGCTAATTTT GTCCCGGGGACAAAGAGTGAAAAACAGGCAAATGTTATTGAAAGTGTTgt cgatttcacttttattggtagaaagaagaatggggtggagacacgagaaa gtgTTTCAGGTTGGTaggatagagcatgttgcattgcacaaacgcaaaaa aacttctcgtgtccccaagcctttagtgTCGCAGTATCAGAATTTGTTCA GACAAACTTTCCATTGGTGCAGTAAATTTCCAAGACAATGTGCAATTCAT CTACTAAGTAAAGGAAGATGAGAGTGCACTTATTTGAGTAATTGGCATTT TGGTGAGAATTTTACTGTGAAGAGTTTACAGGAAAACGATTTGACATTTA TTTGATGTTCCAAAGACAGATAATGATTTTTCCTTTAAGAAAGTATCTTT ATGGAATCACGTTGCAAGTGCTTAGGAATTCGATCGTGACTTCCTCGTCA GCTAAAGTGTATAAATAAGCTGCAGATTCAATTGAAAAATCATCTGCAAA CAGTTTCAAATTGTCAAGTTCAGTGTAAACAACAAGACAACAAACACTCT CAAAGATGAAGATTTGGAAAGCTTTGTTACTCGTCTCGTTCTTGGTGTAC ACAGTTCACTGTGAAACAGAACAAGAGGCGAAAGAAGCAAACATTGAAGC AGAGGAGGATGAACTTCCAGGAATGGAAATGAGTGACGAAGAAACGATCA ACCAACAAGAAGATGCAGATGAAGAAGAAATGAAAGATGAACTTGAAGAT CAAGATCTGAAAGAAGGTGAGAATTTTACTTAAGCCTCTATATATTTTAG TTTACTTTATCTTCTTCTTTCACACCAAAGTAAAGCAAAAGCTTTACGTC TGAACTTtgaaccttttttttttaattcagaaTTTTTCTAATCATAAGCC AGTCAATTGAAATTTGAATAAGGCTTTTTACTCCGGTTTCAGATGAAGAC GCCAGCTACAAGCGATTTCTTTACGCCAAGAAGATCTTCATCTTCAAAGA CAAACACCCTGTTCAATGTCAACTCACCAAAAGCAGTAACAAACCAATCA GATGATACCTCAAGTACGCATACGTCAAACGTCATGGTAACAAATGCATC AAAAAGAAAGTGTATAAATTTTGCGTTTTCAAATTCACAAAGACCTGTTT GTTCACATCCAAATTCATCATCAAGAAATGTTTCAGAATCAGACATGGTG GAGGCTACAAAGTCAAATGTCATAAAAGTGCACCACAGTtggtcaaaatt cgaaaatctGCAGGTGTCATCAATAAAGCCAAATTGGTCAAAGTCTATTA CATCAAACACTAGATCTAGACTTTCAACCGAATCGGAGCAAATGAACTGA CAAGATTTCTAAACGGACAACAATTTTTAACTAGCtgctttttataattt ttatgtgTTTGTAAGCTTACATTTTTAAAATCGCTAAATAATATTTGCCA AAAAGGGAATTTACTCTTTCGTTTTAAACTATCCTTATTTGATCTTCGGG CATCTTAAAGTTAAGGTTCTCACCCGTCTGATTTCCCTTCAATGACAGTA AATATAAGTTTCACTTGGACTTGTGAGTCAAATCTtcctttcaattttct ttcaccAATTTTTGATCTTTGAAAAAGGCGTATTACATGCAGGCAGGAGA ATAGGTCCCACTTGGACTAGTAAACCAAATTTCCCTCAATATTTatattt ccccaattttttaatcaaaaggaTTCTTAAGTTTATAAAATAGTTTTTAT CCAAACCGCATCAGCTTTTAACTTTTGATgggagaaagatttttcatatg ATATGATAGTAATAGCCGCAATTAAATCCAGTTTTTCAGTCTTTAAGTGA AGTCAATAGCGGACAACAAATCTTTCCCTATAAAATCTCCCCAACCTATC CATATATTTAAAAGAGGATTGAAAAAACATCCCAAACAATTGTTTATaca cctacatagggttacctTAACCTGAAATTTCCATTCTATAATCTTGAAAA TCCTCAACCTCCCTCTTAGGACTCTTAGTCTAAAGGGGGTTTCTATGAAG CCTTTCTTGGAAGATGAGCTAACAGCTTCATGGATATATTGACTGGCTAT AAATTTGATGACTTAGACGCAGAAGGAAAAAACGATTCTGATCATTTTTA TCGTTCTACGaattattttggtttaaacacccccttctcacagactcacc GGTACCCCTTCCCACTTGGAagtttggccaaaatattgtcccaattagaa aatgatgaagaaaatgaaaaaagtcatTAAGTGATCATTCGAAGGTAAAA TGTATAGCAATAGTGTTCTGCAGACGGGGCTCCTAGCATGAAAATGAAGC CACATAAAACTCCTATCAAAATCTCATAGCCCTAGTTGGATTGAAAGTAA ACTAATAATATTTTGGAAAGTACCTACCCTAAATGAAGAACCCATTAGAT CCAACttcaaaaaatgtgtcaaagtttttcaaaactaAGCAAGGCTTCAC TATTTGGGCTTTGAAATTCAGCGGTGAAAAGTTGATTTTCGACAAAGAGA AATGCATCTAtaactaccgggtgacccacgaaaaagttcggaccttttct cggcgtcttgaggccgaacaaatgtcccaaagtgctcggaattttggtat ttaaaaagtagatatcctaacttaaaatttgagctatcactttttaaatt tNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNcctgttttttacactttccgaaaagtgaattttga gtttaaaagctcataactagggaacttgtgcgtcaaatttaaaaagtaat ggctaggattttaagttaggatatctactttctaaatgataaaactccaa gcactttgggacatttgttcggcctcaagacgccgagaaacgtccgaact ttttcgtgggtcacccggtataaggGAAGATGAGAGTGTACTTGTAAATC GTAATCGGTATATCTATGCAATCACGCATGTTTTTtcccttcaaaaaaaa aacggttttaaACGGGGTAGTTTCTGAATCTTGATGCATCCTTTACCAAG TAAGGAAGAAACCGGAGGCAGTTTCTATGTCTTGGCCAACCAAAATCATC GATCgtagttttttttgaaagtgataccCGTAGCATTACTCAATAGCGGC GTatatgcatcgagagcgctagatctacttttcttTGAATATTTGTGATG TAGCGCTGTTGGAAATTACGCAAACTTTAAACACCGCAATGCCTTCCTTG CGATTACcactttaaaaataaattcgaTCAAAAAGGCGGATAAAGTTGAG TCCAGGGTTCGTAAAGGTCAGTGGCTCTAAGATGTAACTACTGGTTGACA CTGTACTTGGATTTTCTTGGAGTAAATACTGCTCAGTCACAGGGTTATTT TGCTCGTTTCTTTTCTTGTATTTGGCTTTTTCTAAGCATTTCCACATGCC GTGACTTTTTATagaagaaaaacagttttaacAGGTAATAATCTGTAATA AAATATGTTGCAATTAATAAAATGATTATCTTAATACTCTTAATGACATC CTGCAGTCAGAGGAGTGGACTCTATGCACGAGTTTAAGTTGACGAGGAAG GATTAATTATCAGACTATCCATTTATActttaataaaaatgaattgTCAT TCTTCCTATTTCTCGCATTACATATCTTGCTCACTGCCTTCATGCTCTCT GAAGAAACTTGATTTTTGCCCTTAAAAACCACCCCTTCAAGTAAGATATT TTTTAGTTTGCAATAATTTTCACTGTGCACTTAAGATTTAatttcttgaa aactaaaaaaaacataaacctGCTTAAACCTAGACTTTTTTGCTAAGATA CAGACATCATTCAGACAGGTCCGCGCAGCAGGCCTGACTGCTATAATTCC CCTTAACTACCCCCCTTCACCCCGCCCTTCCTAAATGGGGCGCCGTaggc gcctaaaagaaagaagaggctcCAAACTTTCCAACAAGCTATGAACAAGC TTCTagctccttctagatccggagatacaagcctttaaagtttgaactag cgatcttctttaaaaaacttagaaaaaaaatgaccgtggtacttaaaggg ttatTACACGATCGGTTTAGGAAAGGCAAAAATACTGGTGGTAGTCTAcc gccagatttcaaaagtcaaaaaatcacattttttgcaataactcaagaac ttctttacatttcgtaatgaaattttcagaaggcGGGGGTAAAATCAGTC AGGgggtaaaatactttattttgcttgtgtcaggttttctgaatagtcgg cttgacctatgaagttagttttttttttaaatgNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAATTTCcaggagatgttcag aaagacctaaggatctcaaaacacccaaaaaccaaaattcgacaattttt tcgatgattttccatttctcggtagactataaactttcgcggggattaaa tttcgcggatttcgcggttTTGGGTGTCATCTAAgaaaatctgcgaaatt aagtcccaatgaaAATTTGGAAGGGCACTATtcgcaaaatatttctaaaa aaaacttaaaatatgtcaaatacttacttttgaatgtttactggcatcaa agaagcgctaataatgtgtattaCAGCAACCAACAtgtatgatttgacag taaaagtcacaaaatcgtgaaaatattgccacccaataatgccacccgcg aaattaagttcccgcaaaatttttgcatttcgcGGATAGAcctagccagt accttcccacaaacctaattttttctttgttttaaatcgctataaaaaag cggttttcgtctaacatgCTAGGATAGACCCAaccgtgaaatttaatccc cgcgaaagtttatcccattaaagtagtatTCTGAAATTTCTCGATAAAAA AACATGATTATCCTTTAATTTTGACGGGGACTTAATTTGGCGAAAGggaa gtttcaaaaattttggcggggatctaatttggcgaattgccgagTTTGGA AATTTTAGGGAGGATTTAATTTAgcgaattttgacaaaattcgccaaatt taatccccgccaaaatttatccacttaaggtatttttGCAAACTATTAGT TATTTAAGCCTGACCCAGTTGTAAGTATTACTTCTAGCACTTCTCGACTT TAAAATTCCATGGTGAAAATTTAGCAAGGTAAATGGCAGATCTATCTGAT AAAGGAAGATGAGAATGCACTTGTTAAGTAATTGACATTTTGGTGAATAT TTTAACAAAGACGAACTTCCAGGAAAACGATTTGAcactattttattttt aaatgagAGATAatgatttttccttttcaagGAAGTAATGCGAGAAAAAA CGTTGCAAGTGCTTAGGAATTCGATCGTCACTTCCTCGTCAGCTAAGGAT AAATAAGCTGCAGATTCGATTGAAAAATCATCTGCAAACAGTTTCAAATT GTCAAGCTAAGTGTAAACAACAAGGCAACAAACACTCACAAAGATGAAGA TTTGGAAAGCTTTGTTACTCGTCTCCTTCTTGGTGTACAAAGTTCACTGT GAAACAGAACAAGAGGCGAAAACTATTTCCAAtgatgaagaaacaacaaa tgaCATTGAAAATGACGAAGTAACGATGGACCTTCTAGACCAAGATGAAG ACCAAGAAGATGAACAAAGTGAAGATGAAGCAAGTGAACaacttgaaaat gaagaagaaatgaaAGATGAACTGGAAGAGCAAGATCTTAAAGAAGGTGA GattttttcttctgatttttcaaAGAAGAGTCTGTCAAAACTTTGAGGTT ATTTTTCAGCCACACACAGTGTAAAACTTTTAACGTTAACGGTTTGATac gtttcaagtttttttttgtaaattcaataaaatcttACCTTGCGTTTTAT GTTCAAAGATGAAGACGCAAGCTACAAGCGATTTCTTTACACCAAGAAGG TCTTCATCTTCAAAGACAAACACCCTGTTCAATGTCAAGTCACCAAAAGC AGCAACAACCCAATCAGATGCTACCTCAAGTACGCATGCGTCAAACGTCA TGGTAACAAATGCATTAAAAAGAAAGTGTGGAAATTTTGCGTTTTCAGAT TCACAAAGACATGTTTGTTCACATCCAAATTCGTCATCAAGAAATGTTTC AGAATCAGACATGGTGGAGGCTACAAAGTCAAATGTTATAAAAGTGCACC ACAATtggtcaaaattcgaaaatctGCAGGTGTCATCAATAAAGCCAAAT TGGTCAAAGTCTATTACACCAAACACTAGATATGGACTTCCGATCAAATC AAACCAAATGAACTGGACTGGACCTGCAAACGGACAACAATTTTTAACTT ACTACTtaacaaatttttttacctttttgtaagcttacattttttaaatt gctAAATATATTTGACCGGCTCGAAACTTTTTTTGACTCtgaattttctc attttggTCAAATTGTTGTCAGaggttttttgttttgacatttCAATTTG GGGTTCATCATATTAGTTCATCTTTACTGCATTCGTCATAAAGTGAACCA TGCACATCTGATTTAGCCAAATCCCATCATGAAGTTTTGAGGACTATCAA aattagcctcgttttggcgaaaaaactGTCCCAAGGCATGgcatacctta ttggtatatattttcgcgtgttacaaattttcgcgaatcgcgaaattttt tcgaaaaaacgtgtttcgcgtgtattaaatttcgcgattgccgNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNattaaatttcgcgattgccgacttctggaaaattttcgcgtgtattaa atttcgcgattcactaaactaggtattttcagaaagtgggaatataaagc aagaaaaacactgattttgcttgaaacgcaacgtttttgatgtaaaaata ctaacaaaatactaacaaaacatttttcgcgtgtatttaatttcgcgatt ttgtaattttgaaaaatttaaacagtattaaatttcgcgaaaattgacca aaaaactcgcgaaattaagtacccgcgaaaatttgtaacacgcgaaaata tataccaataaggtacctCCTGACACTCTTCTAGTTTGGCGAAAAAATTG TCAGCTTTCAAAACAACACAATGAAAGGCAAAGCTGCTCTCCCAAACCAC CCCTTTTATAtcatatttttgagaaatttaggAAAAGTcccttttgttaa aaaatttagatattttttatgtgaaaaaagaaggaaaattgTACCGAAAA TATTGATTTGAGAGACCTTTTGACGTCTGTTTTTTCTGCAGTTATCTCAC CCACACTTGTGAGATATGTGGCTCCTTCCCCCTGAAATCATTCAACCTGC ATGCGATCCTTTTTTGTTAGCACtaaaataatcttttttctttgttcttc aGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCAT AACCAAATTGGTGAGTGTTTTCTCCACAtcatagtagggggaaatttgta aaatcgctcgatttttttagtcaaagcacttgttatacatttttggaaag ctaaggggtaggggaatcaaaataacttgggtaccaattttttttcggac actttggtgtgatattcggacaaatacgacggtctcaggcaaaaatcata gggtgaaaaattaatgaaaattttagcttgagaaaacggtaTCTATCAGt atctaactcgagatattgagcttccgaaagcgcaaaaactggacaaaaca gctgtttctggctgaaaaacactgaaaaacactgtttttaaggattaata tctcgagttaggtaaagaaatcacctatactcgcaatatatcactaatct taatttattgagagctttccaaaactattcaacaggtctccgttttctca agctaaaaatttcattaatttttcaccctatgatttttgcctgagaccgt cgtatttgtccgaaaatcacaccaaagtgtcccaaaaaaaattggcaccc aagttattttgattcccctaccccttagctttccaaaaatgtataacaag tgctttgactaaaaaagtcgagcgacctcaaaaaaacgaacaaatttccc cctactatcaATTAGTATCTACATAAACCATGACGTTTATTCATATATTG GTCATGTTTATATCATTCCTGATTCACTGACTCAGGTTTCccttcactga aatattgttcCGGCTATGAATATACCCTAAATGTTGGTTCCCATGGGAAT AGTGCACCCAAGTTTCATTTCTATttggaaaaaacaatttttaggaTTTG AATTCCTTATGATGCTGGATTTTTATAAAGGTATGCACAAAAGGATTAGA AATTCTCTGCTTCCCCTTGGTCCTTCATCCCATCCTAATTGGATTCTGAG ACAGGGCTGGTATTTTACACGAAACCCAAAAACTATGAACTTAATATATT TTCATCATCTTTTTTAAACCAGGAATGAACGTTGGTGAAATGTGGAGAAC GTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTTACACGGCATATCACC ATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCA GATTTTGGTGAGTTGATCTACTCTTAGTATTATTTAAATACTCGGGCTTA CAGTTGACTCTTTAAAACGTCAAAGTGTTCTGAATTAGCGTCCTTTCTAT GTCATAAAAACGAATATCTTTAAGATTATGATAGTTGAAGTAGTGAAAAT TATTGTATCAGTACTGACAGTTTCATATCTTATTCAAACAATCCACAGTG GAAAAATCTTTAAGATTAAAAATATTAGGCTGGACATTTTACTCGATAGC GTGTATAGGGTACGAAAATCATTGAAGGGGCGTGGTCCTAGCTAAAGGAA ACTTAAAGTATTTAACTTGACTCTGGTATTTTTATACCGAATTTTAATTT GATgaatcttttgtattttttttctccagTGCTTTATCAGAGTGGTATGC CTTTCTATCATGCAAGGTAAGGGTTTCATGTTGTTCCCAATCTGCTACTT GTCTGCTGCAACATGAGTTCAAAACCGATCAGCCTCGTACCCAGAGTTAC TTGCCCAACTTTTTAATTTACTTGCACCATATTTTAATTTTACTGGTGGA AGTGATACACCTTTCCTGAGTGCAATCAGAATTATAAAAAGCGAACTCTG GGTTCCAGTTTGGTTTGAAGTTTTGATAGTTTTGATAGTTTGGATATTTT CAAGAGCTAAATCTTTGAGCTGATTGAGACATTAAAAGACTGTATAGCTA CCCTGTAGTTTTAGACACTATTTAAATGCTAAGCTTCTGCCCCATCGCCG AAAAAGTATATCTGCAATTGATTATGTTGTAAAACCACACAACGTTATTG TCTTTTTTCGTTTTCAGTTATTCAGTCTTTGTACGCTATATGGACGAAAA AGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTA TTTGTCGAGTCAACGAAAAAGTTGCAAAGGTTAGTATGACTGTTCACTTT GTttaattgccccccccccccaattatgtgagccataagggtcccttttt cacatcctcaaaggggtacaaacaCCATTAAACAGGAATTAggtctctgt aagggttccaaatttacaaaaataaaatccctcaaagggtcataaaggGT CATAATCGGactaaaattttaaagttttgggGAAATAGTCTCTCCAAGGG TTCCAAAGACGCCAAgaaatggacaaaattttctgagggtcgattttcga actttggttTGGACATACTCGTCATCCCGTAAATCGGGACATTGTATGCG TCCAAATTATATTTGACACTGACAAGCTTGGTCATCCAACCCCTTGGGGA AATACAACTCAAATTAATAAAACTCCCTGGGAAAATGCTACAACTTTGCC TAGATTTGAGCTCTTTTCAAATGCACGTAAAATCTTACTTAAGAACCCTG TGGAAATGCCTTTAAACAATACGTAATAcgcggttttttttataagaata acttctataagaatatcagggtgagatttcagagttagaacaatacgcta ttgtttagaacaatagaaaaataagaataatgctcaacctcagccaaagt acactattcttataaaaaaaaacgtgtagattcCTGAAAATCTTAAGTAT TTTTATACGTACATGTGAGAAGCTATAGTTTTGCACTTTCTTTTTAGGAA GTGCTGATTTGCTACGTCGTGAAACCCAAAGGTAAGACAATGTAAACTTC ATTTCTTTACTAGTTTTTTGACAACTGTAGCTGAAAAAGCGACTGTAGTG CAGAGGTAGAGCAACCTACTTGGtgcaaaaatggtacttgatgtctctcA GGACACCAAAATTTATCCTTAGACATCGCAGATTTACctcctggacaatt catccacctccccatgaacggattttttctggaagagtgcAAAGGATGTA GTTCAAATCttcacaataattttttttagaattcatGTCGGAAGAAATTA CGAGCTATTTTTATTCTGCAGTATATCCGTAAACCTAAAGATTTTCTTCC CCtttttgttcgagttatgtaAAGTACGTTATTTTTGCTCAACCAAGGAT TTCGGTAAAtaaattctttctcattttcatttttccctaCCAGATGTCGA TGAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGG TAAGTTTTTAACACTTTCTTGGTCAAGCTATTTATCATGTTCTAAcgtca acaaaataaaaattgacgtcaaaaaggtGCCTGATGTGTCTTCCTCTTTT CGAGTATATCTCGCTATTAAGCACGGGTAAGTTTTCTTCTAAGAATCAAC CGTTCTTCAACCGATGAAAATTAGCTGGTTCGGTTAAATGGGGAAAGACA GTAGTACTATTCTGGACTGCTCTAGAACTccctctttttttcattttagg aaATGGTGATTCGACGTTGGTTACCAGAAAGACATCGTGAGctgaacaaa gaaaaaatctcttgaaaaaGAATATACAACGGTGATAAGTATGTGAAGGA TTGTTCGAAAATTGAACTATACTGTATGGCGTGAGATCGATGCGATAATG AAAATGGTGAAGATTGGATGCATAGAAGAACTTATTGAGTGTTTTATAGT TTTATTACCaaacaaaatatataattgACCATGGAGCAGCATGGagttat aaagaaaaacaggagatgTATGTTATTATAACCACCCttgccctacgatt aaaaaatgTTACGATTTTACATACTCATAAT

Coding sequence (CDS) from alignment at sc0000001:1947941..1987921+

>TCONS_00000105 ID=TCONS_00000105|Name=|organism=Clytia hemisphaerica|type=CDS|length=17598bp|location=Sequence derived from alignment at sc0000001:1947941..1987921+ (Clytia hemisphaerica)
ATGGCTACTGCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCC
GAGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTC
CCATCCAAACAATTACACGCCAGCAACCTACAAATGACAGATGGTATTAT
TTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGA
TTTAACATACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGA
AATCACAGCCACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGAC
CATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGA
ATCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACAACATGAAAACTGGT
CTTGGATGAAAGAAAAGAAAGATGACATCGAATCCACTAGGAATACTTTG
AAAGTCACATCAGACAATTCTACAGAACTTTCATCAACCATCAACTCTGT
GGATTTGAGAGTTCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAAC
TGAgtaatgaagaagaagatcaacTGTCCGCTACCggatgttttgaaaat
gaagatgatggTGAAACAGTTGACTGCACACtgcatgaaaatgaaaaaga
aactttaaaacGGAAAACAGAATCGCAAGACGATTGGAGTGTTGGAAAGA
TGGCTAAAATTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACT
TTTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGA
AGATCATAACCAAATTGGAATGAACGTTGGTGAAATGTGGAGAACGTTTT
CGTGTCGACAAAAAGATTTCGTGCAACGTTACACGGCATATCACCATTTT
CGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTT
TGTGCTTTATCAGAGTGGTATGCCTTTCTATCATGCAAGTTATTCAGTCT
TTGTACGCTATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTT
TCGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAA
GGAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGATGTCGATGAAAGTG
AACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTG
ATTCGACGTTGGTTACCAGAAAGACATCGTGAGctgaacaaagaaaaaat
ctcttgaATGGCTACTGCACCAAATTACCTGATGACAGATGAACTGCTCC
GTAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTCACCTTTC
CCAGTTCCCATCCAAACAATTACACGCCAGCAACCTACAAATGACAGATG
GTATTATTTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGA
AAGGTGATTTAACATACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATT
CTATCGAAATCACAGCCACAGTACGAAAAATACGAAGAAGAGTCATTCCT
TCTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGC
AATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACAACATGAA
AACTGGTCTTGGATGAAAGAAAAGAAAGATGACATCGAATCCACTAGGAA
TACTTTGAAAGTCACATCAGACAATTCTACAGAACTTTCATCAACCATCA
ACTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACGGTACCGATGGTGAG
GATGAACTGAgtaatgaagaagaagatcaacTGTCCGCTACCggatgttt
tgaaaatgaagatgatggTGAAACAGTTGACTGCACACtgcatgaaaatg
aaaaagaaactttaaaacGGAAAACAGAATCGCAAGACGATTGGAGTGTT
GGAAAGATGGCTAAAATTGAGGACCAATACAAACTGTTCGAATATCTGCA
GCTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTT
GCGTCGAAGATCATAACCAAATTGGAATGAACGTTGGTGAAATGTGGAGA
ACGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTTACACGGCATATCA
CCATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTG
CAGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCTATCATGCAAGTTAT
TCAGTCTTTGTACGCTATATGGACGAAAAAGATGGCGGTTTGGAAGAAAA
ATCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAG
TTGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGATGTCGAT
GAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGga
aATGGTGATTCGACGTTGGTTACCAGAAAGACATCGTGAGctgaacaaag
aaaaaatctcttgaATGGCTACTGCACCAAATTACCTGATGACAGATGAA
CTGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTC
ACCTTTCCCAGTTCCCATCCAAACAATTACACGCCAGCAACCTACAAATG
ACAGATGGTATTATTTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTT
TACAGGAAAGGTGATTTAACATACCTTTATCAGATGGGTTTCTTTGGTAA
AGGTATTCTATCGAAATCACAGCCACAGTACGAAAAATACGAAGAAGAGT
CATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCA
AAAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACA
ACATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGATGACATCGAATCCA
CTAGGAATACTTTGAAAGTCACATCAGACAATTCTACAGAACTTTCATCA
ACCATCAACTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACGGTACCGA
TGGTGAGGATGAACTGAgtaatgaagaagaagatcaacTGTCCGCTACCg
gatgttttgaaaatgaagatgatggTGAAACAGTTGACTGCACACtgcat
gaaaatgaaaaagaaactttaaaacGGAAAACAGAATCGCAAGACGATTG
GAGTGTTGGAAAGATGGCTAAAATTGAGGACCAATACAAACTGTTCGAAT
ATCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGT
TGTCTTTGCGTCGAAGATCATAACCAAATTGGAATGAACGTTGGTGAAAT
GTGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTTACACGG
CATATCACCATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTG
TTTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCTATCATGC
AAGTTATTCAGTCTTTGTACGCTATATGGACGAAAAAGATGGCGGTTTGG
AAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAAC
GAAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGA
TGTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAG
TGGTGgaaATGGTGATTCGACGTTGGTTACCAGAAAGACATCGTGAGctg
aacaaagaaaaaatctcttgaATGGCTACTGCACCAAATTACCTGATGAC
AGATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTC
CGCTTTCACCTTTCCCAGTTCCCATCCAAACAATTACACGCCAGCAACCT
ACAAATGACAGATGGTATTATTTCTTTGGATTGCTGAAGAGTGACCATGT
TGCTGTTTACAGGAAAGGTGATTTAACATACCTTTATCAGATGGGTTTCT
TTGGTAAAGGTATTCTATCGAAATCACAGCCACAGTACGAAAAATACGAA
GAAGAGTCATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGG
TAGATCAAAAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaC
TTAGACAACATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGATGACATC
GAATCCACTAGGAATACTTTGAAAGTCACATCAGACAATTCTACAGAACT
TTCATCAACCATCAACTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACG
GTACCGATGGTGAGGATGAACTGAgtaatgaagaagaagatcaacTGTCC
GCTACCggatgttttgaaaatgaagatgatggTGAAACAGTTGACTGCAC
ACtgcatgaaaatgaaaaagaaactttaaaacGGAAAACAGAATCGCAAG
ACGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGGACCAATACAAACTG
TTCGAATATCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGG
ATTGGGTTGTCTTTGCGTCGAAGATCATAACCAAATTGGAATGAACGTTG
GTGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGT
TACACGGCATATCACCATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAG
TAATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCT
ATCATGCAAGTTATTCAGTCTTTGTACGCTATATGGACGAAAAAGATGGC
GGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCG
AGTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAAC
CCAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAG
CTTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTACCAGAAAGACATCG
TGAGctgaacaaagaaaaaatctcttgaATGGCTACTGCACCAAATTACC
TGATGACAGATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGA
CAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAAACAATTACACGCCA
GCAACCTACAAATGACAGATGGTATTATTTCTTTGGATTGCTGAAGAGTG
ACCATGTTGCTGTTTACAGGAAAGGTGATTTAACATACCTTTATCAGATG
GGTTTCTTTGGTAAAGGTATTCTATCGAAATCACAGCCACAGTACGAAAA
ATACGAAGAAGAGTCATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAA
GTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAA
GAAAGaCTTAGACAACATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGA
TGACATCGAATCCACTAGGAATACTTTGAAAGTCACATCAGACAATTCTA
CAGAACTTTCATCAACCATCAACTCTGTGGATTTGAGAGTTCCAGACGAA
AGTTACGGTACCGATGGTGAGGATGAACTGAgtaatgaagaagaagatca
acTGTCCGCTACCggatgttttgaaaatgaagatgatggTGAAACAGTTG
ACTGCACACtgcatgaaaatgaaaaagaaactttaaaacGGAAAACAGAA
TCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGGACCAATA
CAAACTGTTCGAATATCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGA
GTTACGGATTGGGTTGTCTTTGCGTCGAAGATCATAACCAAATTGGAATG
AACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGT
GCAACGTTACACGGCATATCACCATTTTCGTAGCAAAGGATGGGTGGTTC
GATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATG
CCTTTCTATCATGCAAGTTATTCAGTCTTTGTACGCTATATGGACGAAAA
AGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTA
TTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTC
GTGAAACCCAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACT
CAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTACCAGAAA
GACATCGTGAGctgaacaaagaaaaaatctcttgaATGGCTACTGCACCA
AATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATG
TGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAAACAATTA
CACGCCAGCAACCTACAAATGACAGATGGTATTATTTCTTTGGATTGCTG
AAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGATTTAACATACCTTTA
TCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAAATCACAGCCACAGT
ACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCATGCTAAACGCCAA
AGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGCAAGCATT
CCTTCAAGAAAGaCTTAGACAACATGAAAACTGGTCTTGGATGAAAGAAA
AGAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCACATCAGAC
AATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTGAGAGTTCC
AGACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaatgaagaag
aagatcaacTGTCCGCTACCggatgttttgaaaatgaagatgatggTGAA
ACAGTTGACTGCACACtgcatgaaaatgaaaaagaaactttaaaacGGAA
AACAGAATCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGG
ACCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAAGAGGCATTC
TTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCATAACCAAAT
TGGAATGAACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAG
ATTTCGTGCAACGTTACACGGCATATCACCATTTTCGTAGCAAAGGATGG
GTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAG
TGGTATGCCTTTCTATCATGCAAGTTATTCAGTCTTTGTACGCTATATGG
ACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTA
AGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTG
CTACGTCGTGAAACCCAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAG
GTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTA
CCAGAAAGACATCGTGAGctgaacaaagaaaaaatctcttgaATGGCTAC
TGCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAGA
AAAGATGTGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAA
ACAATTACACGCCAGCAACCTACAAATGACAGATGGTATTATTTCTTTGG
ATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGATTTAACAT
ACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAAATCACAG
CCACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCATGCTAA
ACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGC
AAGCATTCCTTCAAGAAAGaCTTAGACAACATGAAAACTGGTCTTGGATG
AAAGAAAAGAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCAC
ATCAGACAATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTGA
GAGTTCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaat
gaagaagaagatcaacTGTCCGCTACCggatgttttgaaaatgaagatga
tggTGAAACAGTTGACTGCACACtgcatgaaaatgaaaaagaaactttaa
aacGGAAAACAGAATCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAA
ATTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAAGA
GGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCATA
ACCAAATTGGAATGAACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGA
CAAAAAGATTTCGTGCAACGTTACACGGCATATCACCATTTTCGTAGCAA
AGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTT
ATCAGAGTGGTATGCCTTTCTATCATGCAAGTTATTCAGTCTTTGTACGC
TATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAA
AGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGC
TGATTTGCTACGTCGTGAAACCCAAAGATGTCGATGAAAGTGAACTGAAA
AGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACG
TTGGTTACCAGAAAGACATCGTGAGctgaacaaagaaaaaatctcttgaA
TGGCTACTGCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCCG
AGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCC
CATCCAAACAATTACACGCCAGCAACCTACAAATGACAGATGGTATTATT
TCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGAT
TTAACATACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAA
ATCACAGCCACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACC
ATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAA
TCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACAACATGAAAACTGGTC
TTGGATGAAAGAAAAGAAAGATGACATCGAATCCACTAGGAATACTTTGA
AAGTCACATCAGACAATTCTACAGAACTTTCATCAACCATCAACTCTGTG
GATTTGAGAGTTCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAACT
GAgtaatgaagaagaagatcaacTGTCCGCTACCggatgttttgaaaatg
aagatgatggTGAAACAGTTGACTGCACACtgcatgaaaatgaaaaagaa
actttaaaacGGAAAACAGAATCGCAAGACGATTGGAGTGTTGGAAAGAT
GGCTAAAATTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACTT
TTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAA
GATCATAACCAAATTGGAATGAACGTTGGTGAAATGTGGAGAACGTTTTC
GTGTCGACAAAAAGATTTCGTGCAACGTTACACGGCATATCACCATTTTC
GTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTT
GTGCTTTATCAGAGTGGTATGCCTTTCTATCATGCAAGTTATTCAGTCTT
TGTACGCTATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTT
CGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAG
GAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGATGTCGATGAAAGTGA
ACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGA
TTCGACGTTGGTTACCAGAAAGACATCGTGAGctgaacaaagaaaaaatc
tcttgaATGGCTACTGCACCAAATTACCTGATGACAGATGAACTGCTCCG
TAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTCACCTTTCC
CAGTTCCCATCCAAACAATTACACGCCAGCAACCTACAAATGACAGATGG
TATTATTTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAA
AGGTGATTTAACATACCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTC
TATCGAAATCACAGCCACAGTACGAAAAATACGAAGAAGAGTCATTCCTT
CTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCA
ATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACAACATGAAA
ACTGGTCTTGGATGAAAGAAAAGAAAGATGACATCGAATCCACTAGGAAT
ACTTTGAAAGTCACATCAGACAATTCTACAGAACTTTCATCAACCATCAA
CTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACGGTACCGATGGTGAGG
ATGAACTGAgtaatgaagaagaagatcaacTGTCCGCTACCggatgtttt
gaaaatgaagatgatggTGAAACAGTTGACTGCACACtgcatgaaaatga
aaaagaaactttaaaacGGAAAACAGAATCGCAAGACGATTGGAGTGTTG
GAAAGATGGCTAAAATTGAGGACCAATACAAACTGTTCGAATATCTGCAG
CTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTG
CGTCGAAGATCATAACCAAATTGGAATGAACGTTGGTGAAATGTGGAGAA
CGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTTACACGGCATATCAC
CATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGC
AGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCTATCATGCAAGTTATT
CAGTCTTTGTACGCTATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAA
TCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGT
TGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGATGTCGATG
AAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaa
ATGGTGATTCGACGTTGGTTACCAGAAAGACATCGTGAGctgaacaaaga
aaaaatctcttgaATGGCTACTGCACCAAATTACCTGATGACAGATGAAC
TGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTCCGCTTTCA
CCTTTCCCAGTTCCCATCCAAACAATTACACGCCAGCAACCTACAAATGA
CAGATGGTATTATTTCTTTGGATTGCTGAAGAGTGACCATGTTGCTGTTT
ACAGGAAAGGTGATTTAACATACCTTTATCAGATGGGTTTCTTTGGTAAA
GGTATTCTATCGAAATCACAGCCACAGTACGAAAAATACGAAGAAGAGTC
ATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGGTAGATCAA
AAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaCTTAGACAA
CATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGATGACATCGAATCCAC
TAGGAATACTTTGAAAGTCACATCAGACAATTCTACAGAACTTTCATCAA
CCATCAACTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACGGTACCGAT
GGTGAGGATGAACTGAgtaatgaagaagaagatcaacTGTCCGCTACCgg
atgttttgaaaatgaagatgatggTGAAACAGTTGACTGCACACtgcatg
aaaatgaaaaagaaactttaaaacGGAAAACAGAATCGCAAGACGATTGG
AGTGTTGGAAAGATGGCTAAAATTGAGGACCAATACAAACTGTTCGAATA
TCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGGATTGGGTT
GTCTTTGCGTCGAAGATCATAACCAAATTGGAATGAACGTTGGTGAAATG
TGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTTACACGGC
ATATCACCATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGTAATCTGT
TTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCTATCATGCA
AGTTATTCAGTCTTTGTACGCTATATGGACGAAAAAGATGGCGGTTTGGA
AGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCGAGTCAACG
AAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAACCCAAAGAT
GTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGCTTCGAGT
GGTGgaaATGGTGATTCGACGTTGGTTACCAGAAAGACATCGTGAGctga
acaaagaaaaaatctcttgaATGGCTACTGCACCAAATTACCTGATGACA
GATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGACAGGTTCC
GCTTTCACCTTTCCCAGTTCCCATCCAAACAATTACACGCCAGCAACCTA
CAAATGACAGATGGTATTATTTCTTTGGATTGCTGAAGAGTGACCATGTT
GCTGTTTACAGGAAAGGTGATTTAACATACCTTTATCAGATGGGTTTCTT
TGGTAAAGGTATTCTATCGAAATCACAGCCACAGTACGAAAAATACGAAG
AAGAGTCATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAAGTGAAGGT
AGATCAAAAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAAGAAAGaCT
TAGACAACATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGATGACATCG
AATCCACTAGGAATACTTTGAAAGTCACATCAGACAATTCTACAGAACTT
TCATCAACCATCAACTCTGTGGATTTGAGAGTTCCAGACGAAAGTTACGG
TACCGATGGTGAGGATGAACTGAgtaatgaagaagaagatcaacTGTCCG
CTACCggatgttttgaaaatgaagatgatggTGAAACAGTTGACTGCACA
CtgcatgaaaatgaaaaagaaactttaaaacGGAAAACAGAATCGCAAGA
CGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGGACCAATACAAACTGT
TCGAATATCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGAGTTACGGA
TTGGGTTGTCTTTGCGTCGAAGATCATAACCAAATTGGAATGAACGTTGG
TGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGTGCAACGTT
ACACGGCATATCACCATTTTCGTAGCAAAGGATGGGTGGTTCGATTCAGT
AATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATGCCTTTCTA
TCATGCAAGTTATTCAGTCTTTGTACGCTATATGGACGAAAAAGATGGCG
GTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTATTTGTCGA
GTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTCGTGAAACC
CAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACTCAAGAAGC
TTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTACCAGAAAGACATCGT
GAGctgaacaaagaaaaaatctcttgaATGGCTACTGCACCAAATTACCT
GATGACAGATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATGTGGACGAC
AGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAAACAATTACACGCCAG
CAACCTACAAATGACAGATGGTATTATTTCTTTGGATTGCTGAAGAGTGA
CCATGTTGCTGTTTACAGGAAAGGTGATTTAACATACCTTTATCAGATGG
GTTTCTTTGGTAAAGGTATTCTATCGAAATCACAGCCACAGTACGAAAAA
TACGAAGAAGAGTCATTCCTTCTGGACCATGCTAAACGCCAAAGTAGAAG
TGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGCAAGCATTCCTTCAAG
AAAGaCTTAGACAACATGAAAACTGGTCTTGGATGAAAGAAAAGAAAGAT
GACATCGAATCCACTAGGAATACTTTGAAAGTCACATCAGACAATTCTAC
AGAACTTTCATCAACCATCAACTCTGTGGATTTGAGAGTTCCAGACGAAA
GTTACGGTACCGATGGTGAGGATGAACTGAgtaatgaagaagaagatcaa
cTGTCCGCTACCggatgttttgaaaatgaagatgatggTGAAACAGTTGA
CTGCACACtgcatgaaaatgaaaaagaaactttaaaacGGAAAACAGAAT
CGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGGACCAATAC
AAACTGTTCGAATATCTGCAGCTCACTTTTGAAGAGGCATTCTTCTTGAG
TTACGGATTGGGTTGTCTTTGCGTCGAAGATCATAACCAAATTGGAATGA
ACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAGATTTCGTG
CAACGTTACACGGCATATCACCATTTTCGTAGCAAAGGATGGGTGGTTCG
ATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAGTGGTATGC
CTTTCTATCATGCAAGTTATTCAGTCTTTGTACGCTATATGGACGAAAAA
GATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAAGTTGTAT
TTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTGCTACGTCG
TGAAACCCAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAGGTGTACTC
AAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTACCAGAAAG
ACATCGTGAGctgaacaaagaaaaaatctcttgaATGGCTACTGCACCAA
ATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAGAAAAGATGT
GGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAAACAATTAC
ACGCCAGCAACCTACAAATGACAGATGGTATTATTTCTTTGGATTGCTGA
AGAGTGACCATGTTGCTGTTTACAGGAAAGGTGATTTAACATACCTTTAT
CAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAAATCACAGCCACAGTA
CGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCATGCTAAACGCCAAA
GTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGCAAGCATTC
CTTCAAGAAAGaCTTAGACAACATGAAAACTGGTCTTGGATGAAAGAAAA
GAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCACATCAGACA
ATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTGAGAGTTCCA
GACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaatgaagaaga
agatcaacTGTCCGCTACCggatgttttgaaaatgaagatgatggTGAAA
CAGTTGACTGCACACtgcatgaaaatgaaaaagaaactttaaaacGGAAA
ACAGAATCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAAATTGAGGA
CCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAAGAGGCATTCT
TCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCATAACCAAATT
GGAATGAACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGACAAAAAGA
TTTCGTGCAACGTTACACGGCATATCACCATTTTCGTAGCAAAGGATGGG
TGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTTATCAGAGT
GGTATGCCTTTCTATCATGCAAGTTATTCAGTCTTTGTACGCTATATGGA
CGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAAGATTTAA
GTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGCTGATTTGC
TACGTCGTGAAACCCAAAGATGTCGATGAAAGTGAACTGAAAAGTCCAGG
TGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACGTTGGTTAC
CAGAAAGACATCGTGAGctgaacaaagaaaaaatctcttgaATGGCTACT
GCACCAAATTACCTGATGACAGATGAACTGCTCCGTAAGCCGAGAAAGAA
AAGATGTGGACGACAGGTTCCGCTTTCACCTTTCCCAGTTCCCATCCAAA
CAATTACACGCCAGCAACCTACAAATGACAGATGGTATTATTTCTTTGGA
TTGCTGAAGAGTGACCATGTTGCTGTTTACAGGAAAGGTGATTTAACATA
CCTTTATCAGATGGGTTTCTTTGGTAAAGGTATTCTATCGAAATCACAGC
CACAGTACGAAAAATACGAAGAAGAGTCATTCCTTCTGGACCATGCTAAA
CGCCAAAGTAGAAGTGAAGGTAGATCAAAAGCGCAATTAGAATCCAAGCA
AGCATTCCTTCAAGAAAGaCTTAGACAACATGAAAACTGGTCTTGGATGA
AAGAAAAGAAAGATGACATCGAATCCACTAGGAATACTTTGAAAGTCACA
TCAGACAATTCTACAGAACTTTCATCAACCATCAACTCTGTGGATTTGAG
AGTTCCAGACGAAAGTTACGGTACCGATGGTGAGGATGAACTGAgtaatg
aagaagaagatcaacTGTCCGCTACCggatgttttgaaaatgaagatgat
ggTGAAACAGTTGACTGCACACtgcatgaaaatgaaaaagaaactttaaa
acGGAAAACAGAATCGCAAGACGATTGGAGTGTTGGAAAGATGGCTAAAA
TTGAGGACCAATACAAACTGTTCGAATATCTGCAGCTCACTTTTGAAGAG
GCATTCTTCTTGAGTTACGGATTGGGTTGTCTTTGCGTCGAAGATCATAA
CCAAATTGGAATGAACGTTGGTGAAATGTGGAGAACGTTTTCGTGTCGAC
AAAAAGATTTCGTGCAACGTTACACGGCATATCACCATTTTCGTAGCAAA
GGATGGGTGGTTCGATTCAGTAATCTGTTTGGTGCAGATTTTGTGCTTTA
TCAGAGTGGTATGCCTTTCTATCATGCAAGTTATTCAGTCTTTGTACGCT
ATATGGACGAAAAAGATGGCGGTTTGGAAGAAAAATCGTTTTCGTGGAAA
GATTTAAGTTGTATTTGTCGAGTCAACGAAAAAGTTGCAAAGGAAGTGCT
GATTTGCTACGTCGTGAAACCCAAAGATGTCGATGAAAGTGAACTGAAAA
GTCCAGGTGTACTCAAGAAGCTTCGAGTGGTGgaaATGGTGATTCGACGT
TGGTTACCAGAAAGACATCGTGAGctgaacaaagaaaaaatctcttga
Gene-mRNA-Prot