TCONS_00000070 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000070
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1730

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000070 ID=TCONS_00000070|Name=|organism=Clytia hemisphaerica|type=transcript|length=1730bp
GAAACATCttgaatattttgttttgaatgattGTTGAGAGTGTCACCAgc
atgaattttttgtttgggAATGAAGTTGACAGAAATAGAGCAGCACAGCG
GCCTTCGCTCAGCATGTTCATAGCAAACGATACAAGTACACCTTCTACAC
ACGTCCGAAGAAGAGGCTCTGTACAAAGTATAAATTCGGACACTGACTCA
CGTGGCGTGTATGATCAAAAACAATACAAACGACGACGTAGAAGAACCTG
GGAACGAGGTGAAACGGAAAACTCGTTGAAACGAAACCCGAATAATGCAC
CGAGGATTCGGATCAATGTTCGGGGACGGAAATATGAAACGTACATAGac
ACACTTGACCGTTTTCCAGACACGTTACTAGGCAACAAAGAACTTCGTAA
CCAATATTACAATGAACGTAAAGAAGAAATTGTCTTGGGTAGAAATTATG
AAGTCTTCGAAGCCGTGCTCTTCTATTAccaatcaaatgggatcttggCA
AGACCAGCTTGGGTTAgcgaaaaagattttgaaaaagaactaaaGTTTTA
TCAACTGCAACCATCCGAATCTGAAAAActgagaaaagaaaaagaagctc
AGAAACAAGCGGCTAAAACGTTAGCATCAGAGCGCCGCCCTGCTTATCAG
AAACTCATATGGAACCTTATGGAACACCCTCGTTCATCAACGCCCGCCTT
CACATGCGCCATTCTCAGTATCTTTACAATCATCATTTCAGTCGTTGTAA
TCTGTCTTGAAACGATGTCCTCGATCACAGACGATCCTGATAAAAAACGA
GGCTACATTAATcgcaaagttttattttatcttgAAACGACAGTCATGAT
ATGGTTTACTATGGAGTATTTATTGAGAATCATTTCAGCTCCCAGAACGT
TCAAATTCATATTATCACCTACAGGAATAATAGATTTGGTTGTTATATTA
CCTTATTACATCAATATTATAATCGGTGAAGAAATCCGTTCGTTTAATTT
AGCGGTATTCCGTATAGTGCGAATGTTTCGCGTTTTCAGGATTTTCAAAT
TAACTCGATACAGTACCGGATTGAAAGTGCTGGGTCGTACTATTCTTGAA
AGTTTTGGACAACTTGTTGCTCTCTTTCTCTGCTTATTTTTGTCAGCGAT
TCTATTctccagttgtttattttttatcgaACACGATAGCTTGGACCATA
ATTCCGAAGTGTTTATTAGTATTCCGGACACTTTTTGGTACGTCATCATT
ACTATGACTTCGGTTGGTTACGGAGACGTCGTTCCGCGAACGTTAATTGG
ACGTGTAGTTGCTGCCTTTTGCATGGTAACAGGAATTATAGTTTTGTTAT
GTTTACCAACACCCGTCTTTGTGACGCATTTCGGACGATTTTATGAAGAC
GTCATCAGTAGGCCGGCCACTGAACAAGAAGAGGATGATGAATTGACCGA
CTCTGAGATTTGGCGTAATGGTGAACACAATCTTATGATCCCAAGGTGGG
TCAATGATGATGCGTGGAAGGAGAAAATTAGGACTGATGTTAATCAGAAT
CTGACGTTACCAGGGTTAAATGTTTACTTGAGTACGTCTAATCTGTTTTT
ATCCAGAGCTTGCAGTCAAGAAGTGTTGCATAGTATTCATAACTCACCAA
GTAAGTAGAATctggtaattttgaaaaatgttttttttgtaaaaattata
tactttttgggttttaccaaagaaataaag
Run BLAST on NCBI

transcript from alignment at sc0000001:1523361..1530269+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000070 ID=TCONS_00000070|Name=TCONS_00000070|organism=Clytia hemisphaerica|type=transcript|length=6909bp|location=Sequence derived from alignment at sc0000001:1523361..1530269+ (Clytia hemisphaerica)
GAAACATCttgaatattttgttttgaatgattGTTGAGAGTGTCACCAgc atgaattttttgtttgggAATGAAGTAAGTTTGATCATTTTAAAAGAATG CAATCTAAGActcaaagattcttttttttataagaacaatgttttaagaa caacgaggctggaaaatataagaacaatttaagaataatgctgACCCTGT GGAACTGCCGAGTTTCAAGAAATTCAaagatgttctttttttttaagata tctCAATCTTGCTCCTAAAATATAGGAACAgtataagaacaatctgaggA TTAGAGGTTCAAAAATAAGAATGGTCGGTCCTTAAGAAAAGTTAAGACTA CAAttcactggttcttataaaaaaaggagtATACGGCATTAAAGTTAAAC CCGTAGCCGACTAAGATTTCGACAgacctgtctcacagccccggtggaac tctTTTTCTTAATGggaataaaaattctattgttccaaggttaaaaaatc cagtggggatggttttggagtgcaatttttaaacattgaatttcgagtgg ggatgaaatcaaagtcaattttccaatggggctaaaattccagggtattt tccaacCGCGCTacattttccagtggggctggggttccAGCGGGTTTGTA ACACAGGGGTGCATTTTGTCAAAACGAAAAAGTTAGAGGGTTTGATCAGA CGAAAAGCTGAGGCGTCAAAGAAGAAATGGACCAACTATGAAAAGCGGTT TCCGTGATGGCGTGATAAGGAACTTTTTCTTGCGTAATAACgtgttttgc aaattttttattccaTCTTTGAGTGATCAGAGGTCAAAGCGTGATTGTGA ttggaaagatttttgagccgtgatgcgtGATCTGGACTTTCTCAAAAGGA ATGCGTgattatccaaattttttatttattttcgtgatcgtgattgaaga caaaaaatagCGCAACATTGTGATAAATCATAcattcaatttttgaagtt tAAATCTATCCTCTACTTTGAAATGACATGTATATGTGTTCATTGTACTG GGCTAAGTTACGTTAATAATACTCCGGTATAGATAATATTTTGATATCCC GCACTGGCATTGTTTGCACTCGTGGGTCTGTAAGAGAATTTGGCCAGGTT TGCTATTCAGATTCGGAACGAATTAACCCAGTCGCTTTCGAGCATGAGGC AAGgaggttttgaatgttttgactAAACAACCAGTAAGATCGTCACATTC GCCATATCCTATTAGCAAAGCGTGGTAttcgcagaatggatgatctgtta cacgtttttttataccaacaaactatataagaacataaggcttcgacggc caaaattttcagaatatttttaaggctttatggactcaaaaacactcgat ttcttaggaaaatgggtaaaaatggtcaaaaatttgttaaaataagaaca tgctaaggaCATCTCTTAGTGAAGAGTATGAGATGACAGACTTTTGAAAG ATGAGGAAGAGAGAAGAAACCACATATGATTCTAGACACGCGGTAGGGGG CGAAGCAAAGCAGCTACCTCCATTTAATCGTGATTCGAATTAAAATAACT GAGATAAATCGAAATTAATTTGCCATTCAAAAGGGTAGGGTTTCATTTTT CATAGATTCCAATTGAAATCTATGACGACTGCATAATGAATTGAATATGT CAAAATGAATTCGATAGCCAGGGGAGGTGCTATTGTTTCgactgttcttt tttgtttcctGTCTGTGATTTGATGTATCGAAAATCATTTCCGTGTAAAG TTAACGTGACATGTGgggaagttgaatttttctGAGTCAGTTTATTTTCT GAGTCAGTTTATTTTCTGGTGTAAAAAATATTGAACCGTTGAACAGATTT AGTGTTGATACTACTAGAATTCCAAAATGACTCCACAGTCAACAGATGAT GAGGTAGGATTTATCAACATTCTCCAATATACCGTGTGCATCAAGAAAAA GTTGATTCTTTTTTATTCTATATAGGAAAActcaacttaaattttggtat atgaAGCTTCAGTTCAGTCAATCAAAACCTAtgtttaaaaacctgaaaat tttgaCCTACCTAAAATGACAAAATCACACTTGCgtatgtttcttttctc ttctaACTCCACACTTAACAAATTATAAGGTGGGATTCAATAACATTCTC CAATATACAAGCAAACTTTCTTCCTTGAGTAAATTATTCACTGtatgttt cttttgtttctcttttctaaaactttttaaaactgCAATCTACAGTACTA ACggtacccggggggggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNc aattttttcaaaatctgtcgTTGCTATACATGAGGATATTTATAAGATTT TTCAGGAAAGTTGTGAACGATTGCCGCGTTTACgcttgtatttttttaaa ttaaaatgccgtttgaagaaactttttgttaatttaatgCAGGCTGTGTA CTGTATTAAACATTTTCACTTACACACCTCAAAAGCAAGCTCAgtaatat gcttgtaatatgcttattttttagacaaattcaggTCTTGGTATgcttat gcttataaaaaaaacatgtagtctaGATATTTTGCCCAAatatgctagaa ttttgaccattttttgctcaaaaaggattgaaaattTGGGAGGAAATGTA CTCTAAGGGAACGGTACTCTTTACCAGAGCAGAGTGTCTATATCTTACGT ACTGTGTGACTTAGTATAGCCTTTCACTATCCCAACACATGATTTCTCTA GCACTCTGTGGGACAGGGTtgaggaaaaagccgtggtcgttTGCCGCAGT GGTAGTTACAGAGCCAAAGCCGATCGAGCACCAAATAACGCCCCACGCAG CGAAGCCCATAGTGATAAAGAGGCGGTGCAACAACAAGACAGTTAAGTCT GTGTGTGGATAAGCCTGGTGTTATGTAGTGCGTTAATGAATTATGAATGA AATTCCGTATGTATCGGGTCTGGCATTATACATTCAGATATTGGGTACAT CTACCTTGAAATAACACAAAACCAAGCTGGCGAATAACTCACAAAATTCG GTCAATTCGGTTCGTCTCTCGAAGTATtcggaaattttcattttcagtgg ataCCTATGTTTTCATTTAAGTACGGTACATCTGCTGGAACAAAGTAGTT TTGCCGTTTTTAACAAGCCAatgcaaaattttataaaatttgaaattttt cttcaagcCTGTGCTTATCATATTTGCATGACAACTTTAACACCTTGAGT GAAAAGGCTCTGTTGGACAGATTCTATTATGAATAAAATCAACATCTTAA GTGTGAAATGGGTAAATATTAAGTTCAGTGAATTTCCAAATACTGTATAT AAGCGAGCCTCAAAGAAAAGCTGCAAACTTAAATTACCATCTGCAATGCT TGAAACTTTTCCAGACAGTAGGGTTTAGAAAGTGAGAGAGCTTTTAACTT ATTCCTGTCaagactatatatatatatatacggGATTGACGGCATATTTA AGAACGTCATAAtacagtctccataactcgaacacgttcgggaacacaaa tttgttcgagttaaagagatttcgagatatggagtaaggtttacaTGGCA TAACTgcggacgagaaaacttgttcgagttaaggagatattcgagttaaa gaggttcgagttaaagagactctactgtaattCTAAGCAGGGAACTCTCA GCAGGCACACAacgctgtttcaacgttcatctaacgttatatggacgttg tgaacgttagataaacgttgaaacaacgttgtatgccagCTGGGTAGTTA TTGATGATAAGTGTAGCCAAGTCTGAGAAGAAAACGTTTCAAATTCTTCA TTTTATAAATTGATAGGTTGACAGAAATAGAGCAGCACAGCGGCCTTCGC TCAGCATGTTCATAGCAAACGATACAAGTACACCTTCTACACACGTCCGA AGAAGAGGCTCTGTACAAAGTATAAATTCGGACACTGACTCACGTGGCGT GTATGATCAAAAACAATACAAACGACGACGTAGAAGAACCTGGGAACGAG GTGAAACGGAAAACTCGTTGAAACGAAACCCGAATAATGCACCGAGGATT CGGATCAATGTTCGGGGACGGAAATATGAAACGTACATAGGTAAGATAGt tgaatttccatttttcattgaaaactgaaaaacctCCAGTGTCACATCAC GATTTGAATTATTTCAAACTCCTACAGGGTCAATGAATGGATAGACATTA TTTGAGGCTAGAAAAGCGTTGCTTCCAGCTCAAAGATTATCCAGAGGTCA GAAAGTTGGTACggattttttttgtaagaagcctttgttcttttaacttt tttagttttaagcctaaagatgtttttattttcaccactttgtgggtatt tctttccattttcctaagaaatcgggtgttttagagtccgcaaagccttg aaatgttcttgccttgttcttaaaatgttggCCATCGAaacattatgttc ttatattctTTGCAAAAAACATGTATCAATTAGATAGTGAGAAGGCNGTT CTTAAAATGTTGGCCATCGAaacattatgttcttatattctTTGCAAAAA ACATGTAAATTAGATAGTGAGAAAGGTACTTTCAAATAAGTTTCCATAAT ATTAAACAAATTCtccattttctttttattagacACACTTGACCGTTTTC CAGACACGTTACTAGGCAACAAAGAACTTCGTAACCAATATTACAATGAA CGTAAAGAAGAAATTGTCTTGGGTAGAAATTATGAAGTCTTCGAAGCCGT GCTCTTCTATTAccaatcaaatgggatcttggGTAAGTTTTTAAGAAGAC AAAACTCTCAcaacaagttttcaaaaaatcttggcGGAAATTACAATAAA TCTTTTGTCCCATGGATCTTTGACCAAAGCCTTACCCTTACAAGCAAAAC GGAAATCGTACAAACAAGTTACGCAACTATACGATAAAGTCGTTCTTTCT AATAATATTGATTTAATCAAGATAATCAGGAATTTTATACACCATTAGCA TcagcatcccctatatcaaaacatatcagagggaaTGCGTGCAGCCTAAT AGAATTTTAAACATTATTCCATTCCAGCAAGACCAGCTTGGGTTAgcgaa aaagattttgaaaaagaactaaaGTTTTATCAACTGCAACCATCCGAATC TGAAAAActgagaaaagaaaaagaagctcAGAAACAAGCGGCTAAAACGT TAGCATCAGAGCGCCGCCCTGCTTATCAGAAACTCATATGGAACCTTATG GAACACCCTCGTTCATCAACGCCCGCCTTCACATGCGCCATTCTCAGTAT CTTTACAATCATCATTTCAGTCGTTGTAATCTGTCTTGAAACGATGTCCT CGATCACAGACGATCCTGATAAAAAACGAGGCTACATTAATcgcaaagtt ttattttatcttgAAACGACAGTCATGATATGGTTTACTATGGAGTATTT ATTGAGAATCATTTCAGCTCCCAGAACGTTCAAATTCATATTATCACCTA CAGGAATAATAGATTTGGTTGTTATATTACCTTATTACATCAATATTATA ATCGGTGAAGAAATCCGTTCGTTTAATTTAGCGGTATTCCGTATAGTGCG AATGTTTCGCGTTTTCAGGATTTTCAAATTAACTCGATACAGTACCGGAT TGAAAGTGCTGGGTCGTACTATTCTTGAAAGTTTTGGACAACTTGTTGCT CTCTTTCTCTGCTTATTTTTGTCAGCGATTCTATTctccagttgtttatt ttttatcgaACACGATAGCTTGGACCATAATTCCGAAGTGTTTATTAGTA TTCCGGACACTTTTTGGTACGTCATCATTACTATGACTTCGGTTGGTTAC GGAGACGTCGTTCCGCGAACGTTAATTGGACGTGTAGTTGCTGCCTTTTG CATGGTAACAGGAATTATAGTTTTGTTATGTTTACCAACACCCGTCTTTG TGACGCATTTCGGACGATTTTATGAAGACGTCATCAGTAGGCCGGCCACT GAACAAGAAGAGGATGATGAATTGACCGACTCTGAGATTTGGCGTAATGG TGAACACAATCTTATGATCCCAAGGTGGGTCAATGATGATGCGTGGAAGG AGAAAATTAGGACTGATGTTAATCAGAATCTGACGTTACCAGGGTTAAAT GTTTACTTGAGTACGTCTAATCTGTTTTTATCCAGAGCTTGCAGTCAAGA AGTGTTGCATAGTATTCATAACTCACCAAGTAAGTAGAATctggtaattt tgaaaaatgttttttttgtaaaaattatatactttttgggttttaccaaa gaaataaag
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000035XLOC_000035Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000070-exon-sc0000001-1491911889:1523361..1523434TCONS_00000070-exon-sc0000001-1491911889:1523361..1523434Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1510915933:1523361..1523434TCONS_00000070-exon-sc0000001-1510915933:1523361..1523434Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1575043694:1523361..1523434TCONS_00000070-exon-sc0000001-1575043694:1523361..1523434Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1491911889:1527777..1528050TCONS_00000070-exon-sc0000001-1491911889:1527777..1528050Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1510915933:1527777..1528050TCONS_00000070-exon-sc0000001-1510915933:1527777..1528050Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1575043694:1527777..1528050TCONS_00000070-exon-sc0000001-1575043694:1527777..1528050Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1491911889:1528593..1528742TCONS_00000070-exon-sc0000001-1491911889:1528593..1528742Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1510915933:1528593..1528742TCONS_00000070-exon-sc0000001-1510915933:1528593..1528742Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1575043694:1528593..1528742TCONS_00000070-exon-sc0000001-1575043694:1528593..1528742Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1491911889:1529038..1530269TCONS_00000070-exon-sc0000001-1491911889:1529038..1530269Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1510915933:1529038..1530269TCONS_00000070-exon-sc0000001-1510915933:1529038..1530269Clytia hemisphaericaexon
TCONS_00000070-exon-sc0000001-1575043694:1529038..1530269TCONS_00000070-exon-sc0000001-1575043694:1529038..1530269Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1523361..1530269 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.17987e-08 6.32448e-08 3.8189e-09 1.82432e-08 3.59293e-07 1.86811 5.29396e-07 2.13483 5.52766e-09 0 0.334183 1.36672e-07 2.34495 1.99831e-09 1.00727 2.16193 7.34217e-08 1.36487 0 0.651196 2.11474e-08 1.06347e-07 6.19622e-08 1.40278e-08 1.88822 0 5.53854e-09 0.921611 3.29831e-08 1.16058
Blast
BLAST of TCONS_00000070 vs. Swiss-Prot (Human)
Match: KCNA1 (Potassium voltage-gated channel subfamily A member 1 OS=Homo sapiens GN=KCNA1 PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 1.291e-64
Identity = 151/402 (37.56%), Postives = 231/402 (57.46%), Query Frame = 3
Query:  324 GRKYETYIDTLDRFPDTLLGNKELRNQYYNERKEEIVLGRNYEVFEAVLFYYQSNGILARPAWVSEKDFEKELKFYQLQPSESEKLRXXXXXXXXXXXTLASERRP----AYQKLIWNLMEHPRSSTPAFTCAXXXXXXXXXXXXXXCLETMSSITDDPDKKRGYINR--------------KVLFYLETTVMIWFTMEYLLRIISAPRTFKFILSPTGIIDLVVILPYYINIIIGEEI----------RSFNLAXXXXXXXXXXXXXXKLTRYSTGLKVLGRTILESFGQLVALFLCLFLSAILFSSCLFFIEHDSLDHNSEVFISIPDTFWYVIITMTSVGYGDVVPRTLIGRVVAAFCMVTGIIVLLCLPTPVFVTHFGRFYEDVISRPATEQEEDDEL 1445
            G ++ET + TL +FP+TLLGN + R +Y++  + E    RN   F+A+L+YYQS G L RP  V    F +E+KFY+L     EK R+++         +  E RP     YQ+ +W L E+P SS PA   AI+S+  I+IS+V+ CLET+  + DD D   G ++R                 F +ET  +IWF+ E ++R  + P    F  +    ID+V I+PY+I   +G EI          ++ +LA+ R++R+ RVFRIFKL+R+S GL++LG+T+  S  +L  L   LF+  ILFSS ++F E +  + +   F SIPD FW+ +++MT+VGYGD+ P T+ G++V + C + G++  + LP PV V++F  FY        TE EE  +L
Sbjct:   45 GLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGF-------IKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFT-GTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFIT--LGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESH---FSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLT-IALPVPVIVSNFNYFYHR-----ETEGEEQAQL 427          
The following BLAST results are available for this feature:
BLAST of TCONS_00000070 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCNA11.291e-6437.56Potassium voltage-gated channel subfamily A member... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php