Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000030 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000030
Unique NameTCONS_00000030
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3562

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000030 ID=TCONS_00000030|Name=TCONS_00000030|organism=Clytia hemisphaerica|type=transcript|length=3562bp
ATCCATCTATTTACCATTTGAAATGATTACTATTTTATATAGTTAAGGGA
AGAATTGGATAATGCACTTGAAGAACTTTCGTGAAATTCAGGATCAAAAC
TTGACACTTTTGATTAAAGCACTATGGTGGAGAGCATATGTTGCATTTGT
ACGCGATAGTTTTCGGAAAATCTAAATTGTAACCGGGAAACGACAAGATA
AAAATATCTGAGTGTAGATCACaggtcaaaaaaaatcaaaacattgaaac
ttttatgtaaatttttttggtaTGATTTTGTTAGCTTTTGGAATTTAATG
ATGTTCATATACTATTGAATTCTCCCATCATATATGAATCAGCATTGGTA
TTTGTATTATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGA
AGAAATGTAAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATAC
AAACCACCCAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCAT
CCTATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAAT
GGATCAGAAACAGATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAAC
AAAGAAAGTACTCTTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTA
TGAACATCGTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGG
TTTGCTGGTACTGGATTGTCACTCCTCATTCTATTGATCTCATTCCTCGT
TGCCTTGGTAACATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATC
TAGGTCATGGTGGCGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAA
GTGGGCGGTACTGTTGGTCTAATGTACTGTGTGGGACATtgCATCGCAAC
ATCTCTTTACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATT
GGGATCATCCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTT
TTAGTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATT
AGTGTTGATCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGGAA
CGTTGGCCCAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCT
AACTTCGTCGAGAATTTGAAATCGGATTTTAATAAAGACATTTCATTTTT
CGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCG
TCAATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGC
TCAGTTGCAGCTCTTGCTTTATGTGGTTTCATTTACACCATATTGGTGTT
ATTCTTGGGTTCAACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCA
TAATGGAAAAGATTTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTT
GTGGCGGCACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGT
CCTTCAACGTATCGCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCG
CTGAGTTGaGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGT
GCTTCAATAGCtctcatcttcatttttgtcGGTAATTTGAATCAATTGGC
CCCAATCGTCACCATGCCTTTCTTAATGACGTATACAATCATAAATTATG
CGTATTTCGCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGGCC
CGTGTAGAGGGCCGTTATAATAGCCCGaccaaaaataataacaaatctGT
TGAAATGTGTGATTACGGATCTACGACGGTCACCAAACGACGTACGTGGG
AAAACGGGAACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACGTA
GTAGCGGAAGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAA
AGAGCCACCAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGTCT
CCGACCATGACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAA
GATACAACGAGTTACCAACGACAACGGAGTTTGAATGAGGGACAATATTT
AGAATTTATTCACGAGCGAAACACCAACACTTTATATGGTCGACTTTGTA
ATCGCTGGGTTTCATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTT
TGTGTGAGCTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATCCT
GTTCATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTA
GTGACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAA
AAGGATGAAGAACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTA
TGGAATTTCAATGCATGTTATTACTCAAGAAAATATGGACTATGAGCACA
GAGATCGAAAACATTTAGCCTCGACTATCAATAAACCGCAACCTTACCAC
TAGCTTGTGGTGACAGCGGTCTTACTTCAGGCCTGTGGAAATGTGTTTTT
ACTATGTTTGGGCTTAATGGTTTTATATTGAAATTGGTGCCTGGAGAATT
CCTTGGTTTTTCCGTTAGCGCTGATGCTTCCTTGTTCATGCTAAGTATTG
ATATGGTTTCTGTGCAAATTTTCCCGATCACTGTCGATCGATGTATTCAA
TCTTTTATCTTGGTGTATACAATGGGGTTTTTGGAGAATCTTTGACACTT
GTTATGCTCTTTTAAGAGCCTGGAATCGACTTGAATGGGGTTTCTTGATC
CAGTCCTATTTGATCACCTGTGTAATAAGCTCCTACTAAATGCTGTGGTT
CTAccttcaattcaattcaatgcaattcaattttttttcaattcaaactA
ATTTATTCACCTGCATTGAtgataatagacgatatcggctttNTTCAATT
CAAAGTAATTTATTCACCTGCATTGAtgataatagacgatatcggctttc
cgaattctccctgaatgattacccatgatgcattgttagGGTTAAGGTTA
TCGTCCGTGagtttttttgcgcaatgcatcatgggtaatcattcggggaa
aattcggttaagccgatatcgtctattaaatACATTTACAAAGGTTTTCA
AGCAATAAATTATGGGGAATGTAGGCCAGGAGTCCATACAATAGATTCGC
ATTATCAATGCTAACATGGAAATTCCACCGTCCCAGTGAATTTGAAATAA
TCACTCATAGATGCCTAATAAATGCCCTCCCCCCGTTTgttaatcttgat
ttttttctgtctataaattctttaaaatactTTTTGCTGTAAAAAGGAGT
AGGCTATTTGGAGGCCTGTCCAACGACCTTGGACGAATCTTGGCTAAACC
TTAAAATGCCATCTCAGcataaaattagtttgtttagctctctttttgat
catgtgattaaatcttaaaccaatcccaagaggaatatttggtaacgtga
tcaaaaactgagcacatcgatttttatcttttgatattaacaaaggaaaa
aagcCAACAAAA
Run BLAST on NCBI

protein sequence of TCONS_00000030-protein

>TCONS_00000030-protein ID=TCONS_00000030-protein|Name=TCONS_00000030-protein|organism=Clytia hemisphaerica|type=polypeptide|length=714bp
MGENGSVNGDKVGGRNVNGVDWNQYGLASDTNHPAALNDNGSKGFLSSYP
KEEVKELFEHEQENGSETDQEPWWKSNFFVTKKVLFGTWDGVFTSCVMNI
VGVVVFLRTGWMVGFAGTGLSLLILLISFLVALVTLMSAVGVSDRCDLGH
GGVYFILTHVLGGKVGGTVGLMYCVGHCIATSLYCTGFSESMVGLMNWDH
PWAIRLVSIITLVVLVGIALSGVKWIVRFQLVLIIILAIAMCDFILGTLA
QEKPESGFSGFKNANFVENLKSDFNKDISFFVVFGVFFPTACGVLAGVNM
SGDLKEPGQNIPEGSVAALALCGFIYTILVLFLGSTCTREALQTDSLIME
KISLVGALLIFGLFVAALSSILGGLVGPPRVLQRIAEDNVLPILKPFAEL
SGGNKEPRNATLLCASIALIFIFVGNLNQLAPIVTMPFLMTYTIINYAYF
AMAMSYDVKLKQTARVEGRYNSPTKNNNKSVEMCDYGSTTVTKRRTWENG
NEYHELTSDDGGDVVAEEETVIDNSKTLEVKEPPDYDTSQRESGLAVSDH
DEELNVESNRVSSEDTTSYQRQRSLNEGQYLEFIHERNTNTLYGRLCNRW
VSLFTSFVCLVLSFCVSWAYALANLSITLILFIFVSQARPGLSPGVASDF
NFGVWLCTLLPRDKKDEEQEHVIIQSSQVPYGISMHVITQENMDYEHRDR
KHLASTINKPQPYH
Run BLAST on NCBI

transcript from alignment at sc0000001:779125..805026+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000030 ID=TCONS_00000030|Name=TCONS_00000030|organism=Clytia hemisphaerica|type=transcript|length=25902bp|location=Sequence derived from alignment at sc0000001:779125..805026+ (Clytia hemisphaerica)
ATCCATCTATTTACCATTTGAAATGATTACTATTTTATATAGTTAAGGGA AGAATTGGATAATGCACTTGAAGAACTTTCGTGAAATTCAGGATCAAAAC TTGACACTTTTGATTAAAGCACTATGGTGGAGAGCATATGTTGCATTTGT ACGCGATAGTTTTCGGAAAATCTAAATTGTAACCGGGAAACGACAAGATA AAAATATCTGAGTGTAGATCACaggtcaaaaaaaatcaaaacattgaaac ttttatgtaaatttttttggtaTGATTTTGTTAGCTTTTGGAATTTAATG ATGTTCATATACTATTGAATTCTCCCATCATATATGAATCAGCATTGGTA TTTGTATTATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGA AGAAATGTAAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATAC AAACCACCCAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCAT CCTATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGGTA TTACTTTCACCCTTTGCCTTACATATTTGAAATTCACAAAAAGATctcaa aaaaaagcaaacatgaatgtaatttttttaacatgATGAGATCTGATTCA GTATAAAAGTTTCCTTGACAATCAAAGCTGCCTAGATGACAAAAAATGAC TGTATGCAGCACTTATTTATgaatatttgcaatatttttggCGCTTTTGG ATTATTGTAAGTTCTgtattaaatgaaaattgctgCAAACAGTAATATCC TTagccagacgatgtcaatcgaacgaatcaaacactgaatcaattgaacg caatcgaacgcaatcgaatgattgaaattcgattgccgaacgcaatcgaa tgccaatcgtatattaccgcgattttctcgattgattcgattgcgttcga ttagtgcctggattcgattgattcgattgtgttcgattgactTATGTAAT CGATTGATTCCATTGATTCGACTACGTTCGGTTGGCTTATGCatttgact ggtctgactaattgattctgttgattaacGTAGATTCTCATTAACATTTG AAGAGTTAAACGAGATGATAtgaatcattttagcctggatttTAGAAAAT GCAGATTACCCAGGCCCACATGTTTACTGGCTGCTGGTTGTGTGTCAAAG CCTGTTCGTTGCGTTGATTTACCTATcgtatcgatacttaacctccctaa taagtggcgctcgaaattgaaaggaatttaGGTAAATTGGGATCTAATTT AATCGACCACCCGGCGAACgcagtcgaacgtaatcgaaaatcaattgaac gtaatcgaacatcaatcgaacgtaatcgaatatcaatcaaacgtaatcga atatcaatcgaatcaatcgaattttacccagaattttacgttcgattggt attcgattgcgtttggcaatcgaatcgcaatcattcgattgcgttcgatt gcgttcgattgattcgattgattcgattgattcgattggaattttccttc gattccattcgattgacatcgtctggccTTAGGGGTCACTAATAAATCGA CCACCAATACCCTAAAGCTTCAAACAAAATTCCAGAGATTCCTTAAAAGC AATGAGAAACTACCttcattgggccattccagaatttgtctgtaacaggg gggcggacgacacaggatttccgagtgcaaaagttttcaccacaATCCGA AATTTCCAAGGCATGAGaacaggccatattttagaaaggcaaggcagcgt ccgttggtggccaaaaagggcactttttccgGTGTTTTTCTActaaaagg ctgtttttaccaatattttactAATTTCAAAAGGGTCAGCGTCCGATAAC CGGACGCTTaaaaaagggcatgaaaaatggcctggagaagaaaatgtatg aatttccaaggtaATCGaataaaaaaaggcaaaaaagagtggaatttcca atgcttttttaaaaagtacatacatggatttttattgaaatttccgacca ccactggaaaagaaaaattatttcagagtctaaaaaaaattaaaaaatgc acgtcgtccgacggggagtaacaaaaattttctggaatggcccattgctG TATTGTCAGCCATCTTGATATTTTCCCTACCTACGGCTCGCATAGCTGAA ATTTTTCCACTGATGCAATTTACCTGATCTCACGTCACTAATGTCGGGTC AATTGACATTAGTGACGTGAGATCAGGTAAATTGCATCAGTGGAAAAATT TCAGCTATGCGAGCCGTAGGTAGGGAAAATATCAAGATGGCTGACATAGA TAATAGAGAGTTTCCACAGTCACAATGGCAACTGCAACGGCAATGTGAAA ACGTGTGAAATCACATTATAGgtgttaaaaaaaatcagcGTTCCCTTTGT TGCTCATTTTTAattctgaaattatttttcacaacgACAACGTCTATCAT TATTTTTAAAGTaacgaaaaacgaaaaatctagGAGAAAATCTGGAAGCT TTTCTTTTCAATGCAAACTAAAAATACTGTAATGATAAGAATTATTTTGT AATGTTATTAGTAACGAGATTAACAAACTGAACAAATTTAGAATcaggat ttcaaaaattcaatactTGAAACTTACACATTTagcagaagaaaaaaaaa ctagaaaatgataaatagtttaaagattctgaaataTCTTACTTTTTGTT TGATGTTGATTTTTATGTCTAGAAATCTCACGTTGTCTGACAACGCCAAA ATGAGTGATTTGCTGTCGGGCATGAGAAGAGAAAACGGCTAATTGGGGTT TACTCAGAATTTTGAAAGCTCAAAGGtgtgaatttgatgttttcacGTTG CCGTTGCAGTTGCCGTAACTGCGGAAACTCTCTAATGATAGCCTTGTcta attgatttgtcttttacaagCCAGTTGTTGTCTGGAGACAAAACAATTTA TCCAGTTTGTACTGTTTGAGGGTTGATATTGATATGCTgcagtaatttgt tattcattAGACTGTCATTTTCTCCGAAAGGTTTAAAACTGCGGGGTTTT TTCAAGCTTGGTAGAACTCAAATAGTGGGgtatttcagaaaaaacaacaa ttttttcaacaatgaaatgctgaatcagcagaaatgTAAAAAAGCAAATG ATTGTGTTGGAAAGAAAAggtttttattattgaacacaaTGTATTCAAAA CCCACACAATTAGTAGGCCTATTGTGcctcttttattttgttatcttttt acatattattttagTTATATTATtgagcaataaaaatttgaaaaaataac ttttaaaaatcctAAAATGACAATGACCATCGCCAAGTGGAATAAGAAGG TCAGCAGAATGGCtaatcgaaaatttttgaactaTATATAATTATATTTC TTTGCTTAAAGCGCAAaggaaataatatttttcaaccagTGAAACCGAcg ttcctattattcctattaTCTCTAAAGAGTGTCAAAATTAGATGCGGATA TCAACATTACAgcaatcttgtagaagaaagattatcTTGCTTATCATGAA GACTGAAATTAATTATATCTTATAATCTCTTAAgcgagaccaaattaatt tattgttctacaaGCCCAACCGACCCAGTGTCTGTTTTCCTNGTCTTATA ATCTCTTAAGCAAGAccaaattaatttattgttctacaaGCCCAACCGAC CCAGTGTTTTcctaaaataacaaaataacatTGCAAAGTTGCAAAGCTGG ATGATCGAAGttttttaatttaagtttttttccgGTTTTATCAGATATTT TTATACTGAGCAAAGCAGAAAAGTGTAAAATTCATCCCAGAACAGGgatg aatttaaaaatatcacaaTGGAGATAGCACAAAAGTTGTTCATTCAGGTT CattcataaaaaagaaaaagtctactCCTGCAAAATGGAgatgtaaattt ttatttagatCTTGACTCTTTTCAACAcagattttaagaaattttttttt attttactgacgGACTGACTGCAAAATTCCTAGcagtttttttcttcgaa aaaatgAGGATTTCAGAATTCTTCTTATTAATACCAGGGCTAAAAGTCTT GAAAAGCCTTTTAtccaaattttcttctttcacaAAGCATTCAACCAAAT TGTGTAGCCTTGAGTCCACAACACATTAGATTGATGGACCTGTAACAGCT TTAAGGCTCAATTTTAGCTTTAGTATTCATACTTGGTATGAAGAATTTCA ATTCAATACAGCCTTAATAAGTCCAATTAATGACATTTTAGAGCCTGTTG ACCAAGCTaggaaaatgacttttttaaacCACAAAAATATCCATAAAGCC TCCATAATATCAAAAGTATAGAATTTGTTCTGAAGTTATCAAAAAAGGAA AACCTTTTAattctcaaaatggaaaaatgttgAACTGTTTTCTCTAAACA ATTGTTCAGTTGACAATCGCCTTTATGTTGAgaaattctaaaataattta ttaTCATTTACCATTAAAAACCACACTACACATGATGAAATTCTTTGTGC TATTGCAATACTATTTAATATCATTAATACAATTCGGAGAGCACAGGAGA GCAATCACCTGACAAGGGAAGGTCACATGATTGGGTTCCATCCCCGTAAT GTCATTTACCGTCATAATTGTTAGAAAGCTCATATTCTTTATATGATTTT GTGTTCATTAAGGCATCATAGTGTGAACCCTTCCCTTTCTAAAGGGGttg atatattcttttattttgaaattcctAAAATTGAGAAGTATGGAGAATAT GACATGTAAAGCAAAGTTTAACAtaagttttgtaataaaaccaAACTTGT TTGATTATTATCCCTATTGCACAATATGAGTATGTTGGAATTTATCCTAA AAACATATCAGGTGAACCACCTTTACAAGATCATTAAAATGGTGGTTTAG TAGCTGAACTAGGACTTCTGAATTATGATTTTAGATGACTgccttttttt agttttcttgtgtttttaaGCATGACCATGCATTAGCTACTGGAATAACT AAAATGTCTGAAATCAGGTTTTTGTGAAAGATTTCATGGTAGAGTAGCAT GGGAAAGTGTTTTCAAGGTTCAAAATTGCCAGATTGGTCATAAAAATTGG ATTTGAActtcctttttcattttgaaacccAAAAAATGATATCGTTTTGT GTTGGGCTAAATTTCAATCTCCATAATGACAaagaattgtttaaaaaaaa atttaactgaAATCTTTCCACATGATCATTTTGTCTCGTTTTCTCAGAAA GTGGCATAGCAATATACATCAATCTTCGGGTAGGTCCGTTCAGCTTTTAG cttgttttttctaaattttctgtTTCTTAGGCTGTAGAATTCATTTGAAG TGGTTTTGATCCTTTCAAAGtgcaaaatgcaaaaatttgcagcTAGAAGA ACTATCAAAGATACATTTCTCTgttcaaaattgttcaaaactAAAATCAG ATACTAAGTTTAACAAGGCttgaaataacgatttcaagtgggtcagacaa aatgtccgatcagggttgctttagcttgaaaattatgatttttgggtcgg acaagGAGCAATTTCAGTTGGACAATGTCCAATGTCCAACCGTTATTTCA AGCCTTGGTTCAAGTATATGGATTTGACCCAGATCTCTGGCTGTGGGTTA GAATATGTAGTAGTGGTTTTATTATGGTTGGCACATGGTCTTACATCCTT GTATATTTACACATGTTGTTTTCCATCAACAAATTACTTGTTGTCTTTTG CTCAGTTGATTTTTTCTCTATCATCTAATAATAAGCAAATACGGTTTTAT TGCTTGTATAATATGCTTTAAAACCCAtggtgtttttgaaaacttttcat aTTTTAAATACATGAAAATGTATCTAATAATGAAATAAACAGCAAACTCC AGTTTTcctaattttaagaaaattttcatttacttTTCAGTGTTCATTTG CAGTGTCTTTATCTTGTGTTGTGATTTCGCTACAGggattaaaaagattt ttttgggaatttcagccaaatctaaACTCTGCAATTattatttccctttt tttgacAACAAGGTGAAAGACACGTTTTTTCTGTTTATCAGAATCAGATT TTAGtattatatcaaaatttctttaagtaATCTGAATACtcttttaataa attttcttcaacatAAAAACTTGAGGAAAATCGACtgtttaaattttatt aaaacacCTAAAAGGAAAAGAATGCTCATTGTTGTTCATATTACAATAAA GAGTTGGAGAATCCCCACTATGTTCATGTCGTGAACAGTTTTCTTATTGT GTTGGTTCCTTTATTGCAATAAGAAAGGCAGACACTATGTTTAAAATAAT ATCAGTTTATACTATGCAATCACTATATGCCTGTGAAGACTTCATAATGA AGTATCAGTTTATTAATAAAACTGATTCTAAACGTGGTGAATAAAAGCtc acgaaatttttttttgaatttacaaGTTTATCTTAAAAGAACTACCAATG TCCAAACAAAGAGGAGGGacagtggaatttccgataagattttataacac ccccttctcacagacccactgggaaaattgttcaaaatattgTTCCCTGT GGAAATTTAtcttccaatttttgtccccactgaaaatgatcaaataaacc aatcactgcaaaatattatgctatttttctcaaacccactgaattttctg acttgaaaacaaaagaattgaaatccacAGCCATAAAAGATATCGGAATA TCAAtacccatcgagtttcagtccgtcaTTTTTATCCCCCACTAGCCAaa gaaatcctaccgggtctgtgagaagggggtatttTATTATACTTAGAGTT GAAATCCTCGTTCTTAAGAACAGGGGGGTACAGACACAGGGTACTGACCC ATAgccaggtggtggtgtctattttgcatttcaaaaaagttagtaccctt GTACTACTTTGGGGGCgggggtgtgtatttttcactcttcaagCAAGTAC AGGTTACTATTTGGGTATTTTTTCACataattttgctgtttttcaatcaa aaaagtagtttgttgtaatattttgacttttttcaaatgttaatttttgg acctacctccgggtaccccggtggaggttctataaattaacccatgtccg ttcgtctgttcgtccgtccgtccgtccgtctgttaccagcttttctcagg attggctcattagttttttctgattttttgcacaatcaTGCAAAAtcgca atgcccagaacgtgacggagcccgatttttaagaaaaaatttatttgggc gaatttgggccaaaaactacctaaaaatagggttttttggactttgtgca aaatcctgtcattacttttttctgattttttgtaacaagatggagggcaa gattctctaaagaatggctgaagtggattttcccggaaaattcatattcg ccttaaaaaacggattttcgtattttggggaaattccctttaaccaaata agaaaatatagcttttctcaaagttaactcattatttttttgtgattttt agcacaatgatgcaaaatggcaatgcctaaaatgtgacggagcccgattt tcaaaaaaaaatatatttgggaaaATTTGGGCGAAAAACTGCCTAAagat agggttttttggactttgtgcaaaatcctgtcattacttttttctgattt tttgtacaaagatggagggcaagattttctaaagaatggctgaagtggNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNggagccagatttttaagga aaatctttttgggcaaatttgggccaaaaacagcttaaaaggttttttgg gcctgaatggtttaaatgattttcgtatttggggaagttcctttttacca ttttacattatttaacgcacaagctttatttttccattctgaatttttgt acaattattgtcacttttttcttattttcatctgatgttaatcattaggt aggtccattcagcatgttgcttgtttgatttgaaatttttttaattgaaa atttttttttactcttttgagaatttttttgatttttttgaagacgAAAC TTCCgaaatggtcaagaagtgtgtgctgaaaatcaaaggacaaaagcttc TGACTTCATCATTGATAGTTTTTGCTTGAATTATCTGTCAATTTTCAGTC TGAAAAACTAACAATAATACCCCTCTCTTGGTCTtatctgtaaaatttaa gattttaggggtggtgtccctattttttatttttctcattgtCTTTAAAT AAAAGGCTTGGAAAAGGCCAATGTAAAAtcataacaaaaaaattttctat gtcTGCTATGTCATGAATTTCTATGTTAAAATCACGTTTttcatgcaaac ttttttcgtttttcttttccaCATAGAATGGATCAGAAACAGATCAAGAA CCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAGTACTCTTTGGAAC ATGGGACGGTAAGACACATATTTTTCTTCTCTTGTAAAATACTACAGAAT aaagaaatttccaaatttttactgaaatattttttgttcaagttaATAAA ATTGTTTGTGAACAGCTCACTTCGAGAAAGGGGAGGTCAATTAAAAATAC AATGATTACATTAAGGAGGAAGAATTGTTTCTCTTAACTTTTAGGCATTG GACTTGATCATACGGGGGATCTGAGCGGATGTGCCTGAGTTTcagatatt attatttttaagaagaacatttttaaaacaaaatgtttacactatatctt taaatttcactttaaaaaaaaattgtgaagtGTTTACTACGGTAAAACAT TGTATCCAATAATTCTTAAGTTTAGGATCGGAAACAAAGTATGCCAGAGT GTGCAAATAAGGCTTGGATCTGAACTGTTCAgaacttttattttgaattt taagtatAGGGGCCAACATTTGATGAAATGAGCTACATTCCTTGTCgtaa atttgcaatattatatttttctcgAATCACTTATCCTATTCTGGATTGGA TTAGAATAAAAACCCTCAATTTGTTGttatttcaaactatttttccaACA CAGGTGTGTTCACATCCTGTGTTATGAACATCGTGGGTGTGGTGGTCTTC CTTCGAACGGGATGGATGGTTGTAAGTGTTCTTGATATCTTTTATTGTGC CAATTCTTGGTTTTGATTTGACGACTtcttaaaggccggtctccacttgc gcgcgctgcgatcgcattttttggcttcaatcctttttgcttggataaaa gattacgtcataaaaatgtagacacatatattcatgatatgcaccactgc aatgtcttctgacattacgtcatagctcattggttggaagtgacgtaaaa gcagtcaatacgtcactttcaaccaatcagctattgggtggaacggaaga cattgcaatggtgcatatcatgaattgacaCAAATATAGacaacacattt caacttttttcaaccgttacgtcagatcgcgccaatggagttgcttcatt tttcttttgaccaatagcgtggaagcttcgCTCGAAAAAGTGCAATCGAA GCGCGcgtaagtggagaccggcctttacgaTGCTACGACTCgttttattt gaatttatttttcaagacGTTAGATACTTCTGTATGTAGCTGACGACTGT TCATTAAACTCAGACCGGGGTTACTAAGGCAAAAAATATGTGCTCTCTAT AAGGgttacattttaaattttgttgcTTTAATGTTATAACACAAAGAGgc tgttttaatttttgaaacagTTGTTGGCACAACCAAGCCATTGTGACTGT GAATGCGATGCTAGAAACACTTTTCCTGGTGAATCTGCTTTTTTTTCCAT TCTTTGGAATCCAAGCAGTCTTCATCTATTTGTTAATCgggtttttttat tgaaaaaaaattaacccttgctgttgaggatattaatttttcgaagtatt gaactccctggatatcctactttattagaaAAGACCCCCTaaatatccac ttttgaacaaaaatcgttaaccccctggatatcccaTACAACAGGGGGAC ACGGACTATtactggaaaagcccattctgctaaaaatgaaatattagaaa aaatattaaagcTATACAGTAAGTGTGCAAAGATAACCATAACAGAAAAA GGGTTTTAATTCAAGCcttcttttatattttgtagGGGTTTGCTGGTACT GGATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGGTAAC ATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCATGGTG GCGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGGTACT GTTGGTCTAATGTACTGTGTGGGACATGTAAGATAACGCTAATTGTTAAC GTCATCATcgcaaatacacgttttttttaagaaactagttttaccaagca gcctcaatgtttcttaagaaatcggcgtTTTGAGCCTATTGGCCCCaacc ttttttgacttttgtatccccagggggggggggggggggaaacccccccc cccccaaatttttttaaaaaatcgggtgttttagccTATTTGCCccaacc tttttttttttttttccccggggggggggggggggtagaatctaccaccc tcgataattttcgatctagaagagctatgaccatgaaatttggtacagat gttctccatcatgatacaattttccaggaagaaaaaataattgatgacgt cattcaaaaaccgatgacgtcatcacaaaatttccacctgttggaaaaaa gcccaaatatatggtttacaaaagtgtctattacagtcgaaccaataaag atatttagattctgtttaaagactatgaaaggtaaaagactgttatttaa catatttgccggttttgcaatttccatgaagattagtttcttaaaatcta tgctgaagatgagtaaaattttcaaaattcgataacgtcataaatgatga cgtcatcattttcaaactttttatttttatttttaaatttgtattataaT TATATTATCCTATCGcgtgtcaaaatttgacaatgattgaataaatagtt tagaagttatcagcactttaaaattttgaattttaagcgattttagctgg gttttatgtcatgtttcacaataaagtcacaaaacctgatctggaaaacc tatgaccctaaaattttgcacaagtactcttaataagattttattaaaag tcagaaagtttcaagtcgttaaaaaaaatttctctgagatataaacaaaa gaactccatcgtggtagattctaccccccccccccccggggctaataggg tttaaatgtttcttacatgtttctaaactttttgacataatcagcctatt tttcatgcaaagaaaaaaaaaatttgttttgattggaaggttcttaaaaa agccaaattaaaaaatgttattttctcattctcagcctcagcatgttttt tagatgtttcttagatgtttctaaGTTTTAAGGCattcatagcccttttt tgcttgttttttttgtagctatttgcgtacgcttgcctacagaggggggg ggggactcaattttcgatattttagtgcgtacgtactatttGGGCGGCCC CCTTTATCGCAATGTAAGCCTGAAAAGTCAAAGCTAGATTGACATTATCA GAATTAAAGTCTGTACAGCTACGAAAGAAAGTGCTGGGTGAGAATTAAAA CGAATGGTCTAAATTGCTGATGGAAAAAAAGAAGATCAGCAAACAGTTTC ATATATGTAAAGATTGGCTTTAAAActacaaatcaataattcttggTGGA CTccctagtttagacggcccacttttcgccctgcctaatCTAATTGTAAA TTAAAGTTGGCAgaaagttggctgtctaaagttAATGtgttgccctcttt tgacgtcaatgtaATGTCTtagttcaaaaattttaactgcCGACTTTCTG CCCGCTTTTTGCCTCCTCTAATAATTAAAATatgcagggcagaaagtcgg cagtttaaactagagctaactatgatattttattttcagtgCATCGCAAC ATCTCTTTACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATT GGGATCATCCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTT TTAGTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATT AGTGTTGATCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGGAA CGTTGGCCCAAGAGAAACCAGGTATGtgtctcttctttttttttcataag aatatgatttttctgtgattttgaTTTAATCCTTAGTACAGTCAATTCTC Tccaattcgaacctctattattattcgaatcttttagtaattcgaactaa aacatttgTCCCCTCAGCTGAAAAGTGGTTTAAAATGCTCTCTGcgattc gaatctttctgtaattcaaactaaaatattGATTTCCTCAGCTAGATAGT TGGTTTAAATTCgattctttctataattcgagtAAAATCTTTGGTCCCTT GAGGATCGAATTcgagagagagtcaactgtacataaccttctcttttttt ttgtagaaaaaggTTTGTTGTTACctcttttcaaaattacaaattcTTTT TACAATGGATTGAATAATAAACTAAAGCAGTTAGATCTTCTTGGAGTTTC GACTTTCGTTTACAGCTTCCCTCGCCTTTACTTTTATTAgttatttcatt caaaaagttctcattttgaattttagaatcTGGCTTCAGCGGGTTCAAGA ATGCTAACTTCGTCGAGAATTTGAAATCGGATTTTAATAAAGACATTTCA TTTTTCGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGC TGGCGTCAATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGG AAGGCTCAGTTGCAGCTCTTGCTTTATGGTAAATGTTTCGTACAGTAGAC TTTCTCTTATTCGAATCTCACTATAATCCCTTacctctagtttagacggc tgaCTTTCTGctctgcctattctaattgttagagtaggcagaacGAGGGC ACATAGTTggtagttaaaatctttgcttggaaaagattgaaaggaGTCAT TGCATTGGCGTCAAAAGatggcaatgcattgactttagacagcccacttt attcccactttaattcacaataagaataggcagggcaaaaagtgggccgt ctaaactagagcttaccTTCTATGATTCTTCtctctttgtaattcgaaca aataagattccgaGTTTGAGTTTGAATTTGAGAAAGTCCTGTAGTTGATT CTTCTACAGTAAAATAACACTGTAACACTACATTTCCATTCCATTTAATG TTGCTTTGACAGTCATCATTTTCCATTAACTgaacttcaaatttcaaaat taagattttaaaaacaatCTCTAGTTTGGTCGAATATCATAAAAGGTGAA TATCTTGCCCCCCTTGTCTGGGCTCCTTTAgtcattacatgtttttttta taagcatacaaaaatccgaaaacaggctcagagatgcttagatcgaaagc ttaataaggctgaaaaatgcttgaggggatgcttaaatctaaagcataaa tttatggaaatactgaaaatccgtaaaattccagctaaaaaagccaaaat caggaaaaaaacatttttcgtaggctcaagtaatgatTGCCAtgtgctta atttttccccatatctgagcctagatatgcttataagtgcaatgcttata aaaaaacatgcatCGGTCTTAACGGAAAACCATTTTTGCATTACTGAACT TTTTATATTAAtgttaactttcttttcatctttGGCAGTGGTTTCATTTA CACCATATTGGTGTTATTCTTGGGTTCAACATGCACTCGTGAAGCGTTGC AAACAGATTCCCTCATAATGGAAAAGGTGGGtcataaatttaattttctc atatacacgtttttttataagaatatccgaagttttgaagccttcggatg ttcttaactttttcagatttaaacctaaagatgttcttaacatgttctta ttttcgccattttgtgggtaatttttgtataattttttaacataatgtgt gttttagagtcttcaaagccttaaaatgttcttaacattttggccatcaa agccttatgttcttttttttttattcatagaattatatttcacaggtcta tcgacctctacgaaataattttagatttataatttgtctaattcttcatc tgtcgtccagtcgtcagaagatatggacagaagagaagacgttgttttgg tctttgtcctaggttttcgaactaggcAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtcttata tagtttgttcttataaacaaaaacgTGTAGTCCCAAATGCGCTTGGAACC AGTCACTATTTATATCCCTATTTTTGTTACACTGCTTTGATTGACTTTGA AGGCAATAActctaaataattatttttgatgaACAATTCCAGGAAATACA TTTTATAATGTTAGGTGAACTGGAATGTACTTGAGTCTAACAGACCTTCT TTGCGCCTTATTTTTGTGTTTCTCTGCGATTGTGAGCAAAATACAGTTTA AAAATGGGAAGAACCTTTGTTACACTATTTATTTCTCTCCGCAACAATAT TTCGAACATGACTTCACGCCCACCTTGCTTTTGAAACCATTAAGTTTCAA GTCAGAATAGTTAGAgtggaatcttcaacctttctcaagcaagaaataGT TAAGCCACAAGATATGCGCCAAATTtagaatgacggattgaatgTGTAGT GCGTTATTAGattttgttaaccggttactttttcggagcgggctacacga ctttttgcgcaatgcaattggttcttttcgcatgacgacggacctacatt gtccagagttgcccgtcgttaggaaaattcattgtgacgtcactttttca aaggaaaatgaacaatgcgttgacatcatttctctcattttttatttctg acgtcagaaattatagcaattttttatctcttttcgcttgtttttctgct ttatttcgctatttttcctgcataaagcgctaaaaatcaatcaaagctga aggaaacggttaacaaatacaataatgaccggtttttttcgggctgtact gaaaatattgccctcggtcaacgcaacaacctcgNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNgccctcggtcaacgcaacaacctcgcaagctcggtcgttacttgacc tcgggcaatatttctcagtacagccctcactaaccgggcattattgtatt aatgttcactacaattttccaaaatcttgcGTTAGCTTTTACGTTTAGTA TGTCATTTGCGTGAAAACCATGTGGGTGACGTGTTTTGGATTtgaaataa gtggctttatttcatattcaaGAGTTTCATCTTTAACCTCTTCGGGGCTT AAAATGTTTGAAGCTCTTTGCTTATTGAGGACATGCTGTCTTTGACAGAA AGGAAATACTAAGGGATTTATTTGCTTCATGTTGAgttttagatgttttt ttttcttctcaaatCATTGCGTGGTTAATCCCTGATAATTATTTCCTGTT AATTAGATTCGTTAAGTGAGCCATGTTTAATTAGCTTTTCAATTGTATTT GAGGGAATTACACCCAAGCGTTCTGTTAATTATGAAGAGGAAGGAgtctt tttcataagaaaaaacTTCATCCGCCAGCAGAGGGCATCAGAATCATTCC TTCTAATATTAACTTTGAACTCTTACTATACTCAATGACCCATTCTGTCC ATCCAAATTAAATTGATGACTTGCCACTGACATCCTATCATTTAACTTGG TCCTTTTCTGGCATATTTTTACTCTTGAGTGCAACGAGAGCAATATCTTT ACGGTCGGGCGTTCACACCCATTCGAAatccaaaaatatttgaattaaaG AGTGATTACAAGTCTTCATACTTACCGGTGCAGACAAACAGTTCCAGTGA TGTCTGTACATGTTCGCTTTAGAAATACTATATTaaaagcagaaactttc gcggacAGGAACTTTCGCGATATagcaaaatcgcgaaatttcgtgaattt aactttcgcgaattttactTTTGGAACGATTTCAGAGGATATAACTTTCG TCAATTTTagaatgttttttcattttgcagGCAAAAAAGCGATAAAAATG CGCAAAAACTGAACACCGAGTATAACATAGCAAATGTACTTTTCGCGGAA AAAACTTGCGAATTTCTCGTGTAATTTCTTACTTGGCAAAAACTTTCGTG AAAAAGggcaaaaatcgcgaaaatcacgaaagtttctgcccttaaagtac tAATAATATGTAAGCTAATTGATAATTTGAAACTATTCTATACATAGATT TCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGCACTTTC ATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATCG CAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTGGTAAGT TGGATAATTTTCAACGAAAGCGAGGTTCAGGTATAATcccagatctgtaa agcccgaagggctagataggcaactttaagctttctccaacaaaaaaaag tgaagcaaaaacttgactttttaaatttcgtgccgatagataggatctag cataattgttttcggagcgcgagataaaaaaagtaggcggcaaacgctat gtCGCATCTCTGAAACAAGTGAAATTGCTttttgtcacgtgatttctttg gtaggaaaacttgcttcacttttcgataaaggccgcggAGGTATAATAAC CATTATTCtctaaaaatcataaagaaagaGATATCGATCGCATTAGAAAA CACTGACAATATTGTAATTCTTAGCTTCAATGAGGATTTTTTAAGCGTGG TTTTGACGCTTGGACCAGGTTGCTTTCACGAATTCCTCATCAAAGGCTTG AAATCATCTGCCCTAGAAAACACCCTATTTTAATGGTTTTACCGCCTTCT TATCTTGGTAAATACACTGGCTAAATCGCTAAATAATGTTCactcgtttt cttttcagaGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGT GCTTCAATAGCtctcatcttcatttttgtcGGTAATTTGAATCAATTGGC CCCAATCGTCACCATGCCTTTCTTAATGACGTATACAATCATAAATTATG CGTATTTCGCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGGCC CGTGTAGAGGGCCGTTATAATAGCCCGaccaaaaataataacaaatctGT TGAAATGTGTGATTACGGATCTACGACGGTCACCAAACGACGTACGTGGG AAAACGGGAACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACGTA GTAGCGGAAGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAA AGAGCCACCAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGTCT CCGACCATGACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAA GATACAACGAGTAAGTGATTTTGATACATTCGTGAAGAATTTATTgaggt tttttttaactcggtttatttCTCTCTCACTTAGAGAGTGAAATTACTAA AATGTGAAGAAAGGGAATTCGGCACCACTTTCATGATAATGGAGTCGGTA TATTTATATTCCCATGTCAAGTTTACGGTTTTGCGGTTTTCGTTAGGCTA ATTTAGGTTTTAGGCAAATTTGTTTGCTTATGTAATAAAGGTTTTTGCCC AAAATTATACTACAACCGCTTCTGACGCTTAATGAAATTTCCACCAAGTC TGGCCAAGCTAGATTTTCCAGcaaatcgccaaattaaatttcttacaaaa tttcttccatAAAGGTAATAGTAAACTTTCACTTAAGAACATGAATCAGC TTAGAGACAACAATGgcccggggggagggggcacCGGGTTTTTTTGTACC ACGTGTTCTGTTGTATCATAGCCTGTACTAAATTCTTCTTCATGGTAAAA GAACTGCAAAGTACGGTTTGTTAGTGTTCGGAGCACGATTCCGTGTCAGA GATATCTTTTGGTTTTCGATTATTTAGTATCAGAAAGTTTGTCCTAGCGA GATGAAAAATTTCTCCAACAGTAAAAGAACAAAACACGGCAAGATCTTCC AACAAAAGCAAAAATTGTCTTCGGGATGTGTGGGACATGCTACAATCCca cacaaaatatttgagacaaaggggatttccctgtgaaattttaaatacca caattgatttttaagcgcgttaactacagttggaaagtagttttaactct gagtttttaacatgagacttatgagttacgaccttaggatctcaggattt caAAGCTCGAATTTGgctcgaataaggcttggaatatagcttAGAAGCCA CTGAACCcatccaaaatcgaaatattcaatgaaagaaagtggaagtgcta aaatatcaattctcgcccgaactttaaattctgaaaaacgttaaaataca ctaaaatctcattATGTTTTCGAGCCTCGACTCTTTATATCATATTGAAA TCTCATTTTGTTACCAGGTTACCAACGACAACGGAGTTTGAATGAGGGAC AATATTTAGAATTTATTCACGAGCGAAACACCAACACTTTATATGGTCGA CTTTGTAATCGCTGGGTTTCATTATTTACTGTAAGTGATTGTACcatgat ttttataaattaaacaagagccgcaaaagATGCGGTTAAAAATTTCCTCC ATAACATCTATATAATATACATAACGACAGtgtcaataaaaaaaatgtaa aaattagaCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNgctgcattttagtctccattgtcatattccatttaa tcggtatttgaaataattctgtgtcgagtttgaaaaatcaagccaccaaa taattcgttaaacgagaccgatctagaaataaccattttcacacgtagca tcatggaaaaagtttcaatcttgttcaaatttacacatgagctgcatttt agtctccattgccatattccataaTTGgtattgaaataattctgtgtcaa gtttgaaaaatcaaagccaccaattcgttaaacgaggtcagatctagaaa taaccattttcacacgtagcatcatggagaAAGTTCCAATCCTGTtctaa tttacacatgagctccattttagtgtccatcaacaaattccagaatcagt ttacttgaaatgattttgtgtcgagtttgaaaatcatgccaCACCTGACG GTGCCTGACGGTTGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNAAccttgtgtagcatcaagaaatATGTTCCAACTTATTCaaaca catgagctgcatttctgtttatttatttctatattagaagccattaaatt cctaaaaatgaaatctttttgaaaacaagaaactaaaaatgaaactgatt taaggtagaattttcactcagaaagctttatgaaaacttgagcaaaaact CTACgatatgacagaatgttgaaaaagtttacaaagaaaaatcaatacaa agtttctttggtttgaaagtctcttgaccattaaagcaaagaaaatgttc aagaacaaagaaagtatgaatcaaacgaaatcaatctcctcgcttcgacc gccatcttgttttgttttgaaaacgtttgttgtttaaggagcgcggaatc agaaaatatatcttttatagcccgtacccgactttagcaagcttttccct gtccagacggcagaaagtgtgttactggtatcaagcgccgtttctaccaa aacgaaCAGACAGAAGGGCGGTGGCGTAATACTGTACATGGGCGTAGAAT GGCGGTAAAAAACCGCGCACTGGAAAAGGAGGAGAAAGCGCAccgtttta agaaaaatttcccTTGAgcaggaaatttttgaaaaaagtttttactttcA ACCTTTCCTTATCATGTTTTGTCGACCGGGCTTGTGTAGTTGTAGCCTGA GAATGCCAAGTATGAATACttataaaatttccataaaagGGGGGTTGAAT CGAGTTTCCAACGTCTTCACGTATCAGTGCTTAAActgttgaatgaaaaa taaagcaTAAACCACGAAgacttttttttcgcgttggtgcaatccaacat gctctatcccatcaacacaagaaaaaaagtgcgtgtctcatggtttcttt ttttgtttcatgggacaaaaaatGAGGGAAAAAAGTAAGATTTctctttt attggtagaaagaaaaatggggtggagacacgagaaagcttTTCAGGTTG GTGAGCAttttgcattgcaccaacacgaaaaaaacttctcgtgtcacCAA GCCTTAAATATTTCTTGTAAAATCaaaacgcttttttttaatttataaga atggtgtatttccatttcatcattgatattGTTAATATTGTTAATATTGA TATTGTTAACAACTTTTGGGTAAAaccatcctgaaatattctaaaTGTTA TTCTCAAGATAGGATACAAATTCAATCTAAATTGGGAATAATATGTAATA TATACCTCAAGCAAAAGTTGTGAATTTGtgaatttgtgaaaattttaagc ATTACTGAGGGATAGTTGACAATTTACACATAAAAAAATGCTCTTCTTTT AGATTCAGTTGCATACCGTtgaatttttggccaatttgaTCATGAAGATT CTCATAAGAACGCGTGTAATACCCGTCGGCTGTCAAAATAATTtcccttt ttgttttcttttctttttcagagtTTTGTTTGTTTAGTTTTGTCATTTTG TGTGAGCTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGT TCATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGT GACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAA GTAAGAGTTTTTTTGgtaaactttttatttattttagggGTTGCCACAAG CTCTACTGTATTggaccatgaacatataaacgactggacatccatctcct ttgtatttttgaagataacactgctagcttcgttgccgcctcgttaaaat catcaaatgaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNctctgttgttctacttttctcaagtcttttatc tatatcataacaaaaataacagaggcaaaatcatcgtcaccttgtcaaaa ctccgactaatatttcaaaattttcatattcACATGTCatattctaattt cgatattcttatgacacaggctctcaactttggcaagctatttttttcaa gtcataaaaaaaattattggagtgacaaaaggaattcaaaagtatacatg catttcagagttgaaaatgttgataaaatatattgcaaactcgtgaaaaa atttgaaaataatttttttgtgcattagaagtaatgttcaagctctatca atcattttacctaaacaattcaaagaaataaaattacgacggaatattgt cggattttttatagcaatttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNaatacaggcggcaacgaagctcgcttcaaagagacaata aaagatagatgtccagtcgtttatatgttcatgataggACCTATTTATAA AGGCCGAAGgtctagatgtcgtgctttagcTGAAAAGCATGCCGTATTTC GGTAGGAAGTCCTACcgaggtcacgtgacattataatagaatttcagcgc tggACAAATCAGAAGCTTAacggattttcgaaaacaatagtaactatatt ttttgcgatattcaattTGTTTGCTTGGAAAGCTTAAATCACTCCATCTA GCagttcgggctttacagaaatctgtgattAGAAGGTAAGACGTATGCAA AGcccattgaaattttcaagcatttttctttaatttaacGCTATAATGGT TACGACTTGTGACAAAATTACTATAGAATTCGAGAAATCGAGAAAATCTG CTCTGTGGGGCATTCCTAGCGATTGATGGCTTGGAGTTTTCTTAATATTC TTAAACAGATACATTGTATATGATTGTACCAAATATCATTTTCTATGGGA GGCTTTGCTCATCTCCGTATTACACGAAGACATTTTCGCTAGCTGGTGCT TTCCTCTCAACCAATTGATTGTTCTGTTTTCATCACGAGATtccattttg atgaaaaaaataagcacaCGGGATCATTCAAAGTTGTGTTCAGccaataa tttttcttcttttaatcacgtgattttattttcCACCAATAGGGATGAAG AACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTTCA ATGCATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGAAA ACATTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAGCTTGTGG TGACAGCGGTCTTACTTCAGGCCTGTGGAAATGTGTTTTTACTATGTTTG GGCTTAATGGTTTTATATTGAAATTGGTGCCTGGAGAATTCCTTGGTTTT TCCGTTAGCGCTGATGCTTCCTTGTTCATGCTAAGTATTGATATGGTTTC TGTGCAAATTTTCCCGATCACTGTCGATCGATGTATTCAATCTTTTATCT TGGTGTATACAATGGGGTTTTTGGAGAATCTTTGACACTTGTTATGCTCT TTTAAGAGCCTGGAATCGACTTGAATGGGGTTTCTTGATCCAGTCCTATT TGATCACCTGTGTAATAAGCTCCTACTAAATGCTGTGGTTCTAccttcaa ttcaattcaatgcaattcaattttttttcaattcaaactAATTTATTCAC CTGCATTGAtgataatagacgatatcggctttNTTCAATTCAAAGTAATT TATTCACCTGCATTGAtgataatagacgatatcggctttccgaattctcc ctgaatgattacccatgatgcattgttagGGTTAAGGTTATCGTCCGTGa gtttttttgcgcaatgcatcatgggtaatcattcggggaaaattcggtta agccgatatcgtctattaaatACATTTACAAAGGTTTTCAAGCAATAAAT TATGGGGAATGTAGGCCAGGAGTCCATACAATAGATTCGCATTATCAATG CTAACATGGAAATTCCACCGTCCCAGTGAATTTGAAATAATCACTCATAG ATGCCTAATAAATGCCCTCCCCCCGTTTgttaatcttgatttttttctgt ctataaattctttaaaatactTTTTGCTGTAAAAAGGAGTAGGCTATTTG GAGGCCTGTCCAACGACCTTGGACGAATCTTGGCTAAACCTTAAAATGCC ATCTCAGcataaaattagtttgtttagctctctttttgatcatgtgatta aatcttaaaccaatcccaagaggaatatttggtaacgtgatcaaaaactg agcacatcgatttttatcttttgatattaacaaaggaaaaaagcCAACAA AA

Coding sequence (CDS) from alignment at sc0000001:779125..805026+

>TCONS_00000030 ID=TCONS_00000030|Name=TCONS_00000030|organism=Clytia hemisphaerica|type=CDS|length=25740bp|location=Sequence derived from alignment at sc0000001:779125..805026+ (Clytia hemisphaerica)
ATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGT
AAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATACAAACCACC
CAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCATCCTATCCT
AAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAATGGATCAGA
AACAGATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAG
TACTCTTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTATGAACATC
GTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGG
TACTGGATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGG
TAACATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCAT
GGTGGCGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGG
TACTGTTGGTCTAATGTACTGTGTGGGACATtgCATCGCAACATCTCTTT
ACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATTGGGATCAT
CCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTTTTAGTCGG
AATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGA
TCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGGAACGTTGGCC
CAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGT
CGAGAATTTGAAATCGGATTTTAATAAAGACATTTCATTTTTCGTTGTGT
TTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATG
AGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGC
AGCTCTTGCTTTATGTGGTTTCATTTACACCATATTGGTGTTATTCTTGG
GTTCAACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCATAATGGAA
AAGATTTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGC
ACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAAC
GTATCGCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTG
aGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGTGCTTCAAT
AGCtctcatcttcatttttgtcGGTAATTTGAATCAATTGGCCCCAATCG
TCACCATGCCTTTCTTAATGACGTATACAATCATAAATTATGCGTATTTC
GCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGGCCCGTGTAGA
GGGCCGTTATAATAGCCCGaccaaaaataataacaaatctGTTGAAATGT
GTGATTACGGATCTACGACGGTCACCAAACGACGTACGTGGGAAAACGGG
AACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACGTAGTAGCGGA
AGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAAAGAGCCAC
CAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGTCTCCGACCAT
GACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGATACAAC
GAGTTACCAACGACAACGGAGTTTGAATGAGGGACAATATTTAGAATTTA
TTCACGAGCGAAACACCAACACTTTATATGGTCGACTTTGTAATCGCTGG
GTTTCATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAG
CTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGTTCATTT
TTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTT
AACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAAGGATGA
AGAACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTT
CAATGCATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGA
AAACATTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAGATGGG
AGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGTAAACG
GTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATACAAACCACCCAGCC
GCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCATCCTATCCTAAAGA
AGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAATGGATCAGAAACAG
ATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAGTACTC
TTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTATGAACATCGTGGG
TGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGGTACTG
GATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGGTAACA
TTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCATGGTGG
CGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGGTACTG
TTGGTCTAATGTACTGTGTGGGACATtgCATCGCAACATCTCTTTACTGT
ACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATTGGGATCATCCTTG
GGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTTTTAGTCGGAATCG
CCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGATCATA
ATACTGGCCATTGCTATGTGTGATTTCATACTTGGAACGTTGGCCCAAGA
GAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGTCGAGA
ATTTGAAATCGGATTTTAATAAAGACATTTCATTTTTCGTTGTGTTTGGT
GTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATGAGTGG
CGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGCAGCTC
TTGCTTTATGTGGTTTCATTTACACCATATTGGTGTTATTCTTGGGTTCA
ACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCATAATGGAAAAGAT
TTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGCACTTT
CATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATC
GCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTGaGCGG
TGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGTGCTTCAATAGCtc
tcatcttcatttttgtcGGTAATTTGAATCAATTGGCCCCAATCGTCACC
ATGCCTTTCTTAATGACGTATACAATCATAAATTATGCGTATTTCGCCAT
GGCAATGTCATACGACGTCAAGTTGAAACAAACGGCCCGTGTAGAGGGCC
GTTATAATAGCCCGaccaaaaataataacaaatctGTTGAAATGTGTGAT
TACGGATCTACGACGGTCACCAAACGACGTACGTGGGAAAACGGGAACGA
ATATCACGAGTTAACGTCAGACGACGGCGGTGACGTAGTAGCGGAAGAAG
AAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAAAGAGCCACCAGAC
TATGATACGTCACAACGTGAATCAGGGCTAGCCGTCTCCGACCATGACGA
GGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGATACAACGAGTT
ACCAACGACAACGGAGTTTGAATGAGGGACAATATTTAGAATTTATTCAC
GAGCGAAACACCAACACTTTATATGGTCGACTTTGTAATCGCTGGGTTTC
ATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAGCTGGG
CTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGTTCATTTTTGTC
AGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTTAACTT
TGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAAGGATGAAGAAC
AAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTTCAATG
CATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGAAAACA
TTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAGATGGGAGAAA
ATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGTAAACGGTGTT
GATTGGAATCAGTATGGTTTGGCCAGCGATACAAACCACCCAGCCGCCTT
GAATGATAACGGAAGTAAAGGCTTTTTATCATCCTATCCTAAAGAAGAAG
TTAAAGAACTATTTGAGCATGAACAAGAGAATGGATCAGAAACAGATCAA
GAACCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAGTACTCTTTGG
AACATGGGACGGTGTGTTCACATCCTGTGTTATGAACATCGTGGGTGTGG
TGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGGTACTGGATTG
TCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGGTAACATTGAT
GTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCATGGTGGCGTGT
ATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGGTACTGTTGGT
CTAATGTACTGTGTGGGACATtgCATCGCAACATCTCTTTACTGTACCGG
GTTTTCCGAATCAATGGTCGGTCTGATGAATTGGGATCATCCTTGGGCTA
TTCGTCTTGTATCTATCATTACGCTGGTCGTTTTAGTCGGAATCGCCTTG
TCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGATCATAATACT
GGCCATTGCTATGTGTGATTTCATACTTGGAACGTTGGCCCAAGAGAAAC
CAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGTCGAGAATTTG
AAATCGGATTTTAATAAAGACATTTCATTTTTCGTTGTGTTTGGTGTGTT
CTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATGAGTGGCGACT
TGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGCAGCTCTTGCT
TTATGTGGTTTCATTTACACCATATTGGTGTTATTCTTGGGTTCAACATG
CACTCGTGAAGCGTTGCAAACAGATTCCCTCATAATGGAAAAGATTTCAC
TCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGCACTTTCATCC
ATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATCGCAGA
GGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTGaGCGGTGGCA
ACAAGGAGCCACGCAATGCGACCCTTCTATGTGCTTCAATAGCtctcatc
ttcatttttgtcGGTAATTTGAATCAATTGGCCCCAATCGTCACCATGCC
TTTCTTAATGACGTATACAATCATAAATTATGCGTATTTCGCCATGGCAA
TGTCATACGACGTCAAGTTGAAACAAACGGCCCGTGTAGAGGGCCGTTAT
AATAGCCCGaccaaaaataataacaaatctGTTGAAATGTGTGATTACGG
ATCTACGACGGTCACCAAACGACGTACGTGGGAAAACGGGAACGAATATC
ACGAGTTAACGTCAGACGACGGCGGTGACGTAGTAGCGGAAGAAGAAACC
GTCATAGACAATTCTAAAACGTTAGAAGTGAAAGAGCCACCAGACTATGA
TACGTCACAACGTGAATCAGGGCTAGCCGTCTCCGACCATGACGAGGAAT
TGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGATACAACGAGTTACCAA
CGACAACGGAGTTTGAATGAGGGACAATATTTAGAATTTATTCACGAGCG
AAACACCAACACTTTATATGGTCGACTTTGTAATCGCTGGGTTTCATTAT
TTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAGCTGGGCTTAC
GCACTCGCTAACCTGAGTATAACGCTCATCCTGTTCATTTTTGTCAGTCA
AGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTTAACTTTGGTG
TTTGGTTGTGCACGCTCTTACCACGAGACAAAAAGGATGAAGAACAAGAA
CATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTTCAATGCATGT
TATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGAAAACATTTAG
CCTCGACTATCAATAAACCGCAACCTTACCACTAGATGGGAGAAAATGGG
AGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGTAAACGGTGTTGATTG
GAATCAGTATGGTTTGGCCAGCGATACAAACCACCCAGCCGCCTTGAATG
ATAACGGAAGTAAAGGCTTTTTATCATCCTATCCTAAAGAAGAAGTTAAA
GAACTATTTGAGCATGAACAAGAGAATGGATCAGAAACAGATCAAGAACC
TTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAGTACTCTTTGGAACAT
GGGACGGTGTGTTCACATCCTGTGTTATGAACATCGTGGGTGTGGTGGTC
TTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGGTACTGGATTGTCACT
CCTCATTCTATTGATCTCATTCCTCGTTGCCTTGGTAACATTGATGTCAG
CAGTGGGCGTGTCTGACCGATGTGATCTAGGTCATGGTGGCGTGTATTTT
ATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGGTACTGTTGGTCTAAT
GTACTGTGTGGGACATtgCATCGCAACATCTCTTTACTGTACCGGGTTTT
CCGAATCAATGGTCGGTCTGATGAATTGGGATCATCCTTGGGCTATTCGT
CTTGTATCTATCATTACGCTGGTCGTTTTAGTCGGAATCGCCTTGTCCGG
AGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGATCATAATACTGGCCA
TTGCTATGTGTGATTTCATACTTGGAACGTTGGCCCAAGAGAAACCAGaa
tcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGTCGAGAATTTGAAATC
GGATTTTAATAAAGACATTTCATTTTTCGTTGTGTTTGGTGTGTTCTTTC
CCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATGAGTGGCGACTTGAAA
GAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGCAGCTCTTGCTTTATG
TGGTTTCATTTACACCATATTGGTGTTATTCTTGGGTTCAACATGCACTC
GTGAAGCGTTGCAAACAGATTCCCTCATAATGGAAAAGATTTCACTCGTT
GGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGCACTTTCATCCATTCT
GGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATCGCAGAGGATA
ACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTGaGCGGTGGCAACAAG
GAGCCACGCAATGCGACCCTTCTATGTGCTTCAATAGCtctcatcttcat
ttttgtcGGTAATTTGAATCAATTGGCCCCAATCGTCACCATGCCTTTCT
TAATGACGTATACAATCATAAATTATGCGTATTTCGCCATGGCAATGTCA
TACGACGTCAAGTTGAAACAAACGGCCCGTGTAGAGGGCCGTTATAATAG
CCCGaccaaaaataataacaaatctGTTGAAATGTGTGATTACGGATCTA
CGACGGTCACCAAACGACGTACGTGGGAAAACGGGAACGAATATCACGAG
TTAACGTCAGACGACGGCGGTGACGTAGTAGCGGAAGAAGAAACCGTCAT
AGACAATTCTAAAACGTTAGAAGTGAAAGAGCCACCAGACTATGATACGT
CACAACGTGAATCAGGGCTAGCCGTCTCCGACCATGACGAGGAATTGAAT
GTAGAAAGTAATAGAGTTTCTTCTGAAGATACAACGAGTTACCAACGACA
ACGGAGTTTGAATGAGGGACAATATTTAGAATTTATTCACGAGCGAAACA
CCAACACTTTATATGGTCGACTTTGTAATCGCTGGGTTTCATTATTTACT
agtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAGCTGGGCTTACGCACT
CGCTAACCTGAGTATAACGCTCATCCTGTTCATTTTTGTCAGTCAAGCGC
GGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTTAACTTTGGTGTTTGG
TTGTGCACGCTCTTACCACGAGACAAAAAGGATGAAGAACAAGAACATGT
GATCATTCAAAGCAGCCAAGTGCCTTATGGAATTTCAATGCATGTTATTA
CTCAAGAAAATATGGACTATGAGCACAGAGATCGAAAACATTTAGCCTCG
ACTATCAATAAACCGCAACCTTACCACTAGATGGGAGAAAATGGGAGCGT
AAATGGTGATAAAGTTGGGGGAAGAAATGTAAACGGTGTTGATTGGAATC
AGTATGGTTTGGCCAGCGATACAAACCACCCAGCCGCCTTGAATGATAAC
GGAAGTAAAGGCTTTTTATCATCCTATCCTAAAGAAGAAGTTAAAGAACT
ATTTGAGCATGAACAAGAGAATGGATCAGAAACAGATCAAGAACCTTGGT
GGAAATCCAATTTCTTTGTAACAAAGAAAGTACTCTTTGGAACATGGGAC
GGTGTGTTCACATCCTGTGTTATGAACATCGTGGGTGTGGTGGTCTTCCT
TCGAACGGGATGGATGGTTGGGTTTGCTGGTACTGGATTGTCACTCCTCA
TTCTATTGATCTCATTCCTCGTTGCCTTGGTAACATTGATGTCAGCAGTG
GGCGTGTCTGACCGATGTGATCTAGGTCATGGTGGCGTGTATTTTATACT
CACCCATGTGTTGGGCGGCAAAGTGGGCGGTACTGTTGGTCTAATGTACT
GTGTGGGACATtgCATCGCAACATCTCTTTACTGTACCGGGTTTTCCGAA
TCAATGGTCGGTCTGATGAATTGGGATCATCCTTGGGCTATTCGTCTTGT
ATCTATCATTACGCTGGTCGTTTTAGTCGGAATCGCCTTGTCCGGAGTCA
AATGGATTGTTCGGTTTCAATTAGTGTTGATCATAATACTGGCCATTGCT
ATGTGTGATTTCATACTTGGAACGTTGGCCCAAGAGAAACCAGaatcTGG
CTTCAGCGGGTTCAAGAATGCTAACTTCGTCGAGAATTTGAAATCGGATT
TTAATAAAGACATTTCATTTTTCGTTGTGTTTGGTGTGTTCTTTCCCACG
GCTTGTGGCGTTTTGGCTGGCGTCAATATGAGTGGCGACTTGAAAGAGCC
AGGCCAAAATATCCCGGAAGGCTCAGTTGCAGCTCTTGCTTTATGTGGTT
TCATTTACACCATATTGGTGTTATTCTTGGGTTCAACATGCACTCGTGAA
GCGTTGCAAACAGATTCCCTCATAATGGAAAAGATTTCACTCGTTGGCGC
CCTTCTTATATTTGGATTGTTTGTGGCGGCACTTTCATCCATTCTGGGCG
GCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATCGCAGAGGATAACGTG
CTGCCTATTCTCAAACCATTCGCTGAGTTGaGCGGTGGCAACAAGGAGCC
ACGCAATGCGACCCTTCTATGTGCTTCAATAGCtctcatcttcatttttg
tcGGTAATTTGAATCAATTGGCCCCAATCGTCACCATGCCTTTCTTAATG
ACGTATACAATCATAAATTATGCGTATTTCGCCATGGCAATGTCATACGA
CGTCAAGTTGAAACAAACGGCCCGTGTAGAGGGCCGTTATAATAGCCCGa
ccaaaaataataacaaatctGTTGAAATGTGTGATTACGGATCTACGACG
GTCACCAAACGACGTACGTGGGAAAACGGGAACGAATATCACGAGTTAAC
GTCAGACGACGGCGGTGACGTAGTAGCGGAAGAAGAAACCGTCATAGACA
ATTCTAAAACGTTAGAAGTGAAAGAGCCACCAGACTATGATACGTCACAA
CGTGAATCAGGGCTAGCCGTCTCCGACCATGACGAGGAATTGAATGTAGA
AAGTAATAGAGTTTCTTCTGAAGATACAACGAGTTACCAACGACAACGGA
GTTTGAATGAGGGACAATATTTAGAATTTATTCACGAGCGAAACACCAAC
ACTTTATATGGTCGACTTTGTAATCGCTGGGTTTCATTATTTACTagtTT
TGTTTGTTTAGTTTTGTCATTTTGTGTGAGCTGGGCTTACGCACTCGCTA
ACCTGAGTATAACGCTCATCCTGTTCATTTTTGTCAGTCAAGCGCGGCCT
GGTCTGTCGCCTGGCGTGGCTAGTGACTTTAACTTTGGTGTTTGGTTGTG
CACGCTCTTACCACGAGACAAAAAGGATGAAGAACAAGAACATGTGATCA
TTCAAAGCAGCCAAGTGCCTTATGGAATTTCAATGCATGTTATTACTCAA
GAAAATATGGACTATGAGCACAGAGATCGAAAACATTTAGCCTCGACTAT
CAATAAACCGCAACCTTACCACTAGATGGGAGAAAATGGGAGCGTAAATG
GTGATAAAGTTGGGGGAAGAAATGTAAACGGTGTTGATTGGAATCAGTAT
GGTTTGGCCAGCGATACAAACCACCCAGCCGCCTTGAATGATAACGGAAG
TAAAGGCTTTTTATCATCCTATCCTAAAGAAGAAGTTAAAGAACTATTTG
AGCATGAACAAGAGAATGGATCAGAAACAGATCAAGAACCTTGGTGGAAA
TCCAATTTCTTTGTAACAAAGAAAGTACTCTTTGGAACATGGGACGGTGT
GTTCACATCCTGTGTTATGAACATCGTGGGTGTGGTGGTCTTCCTTCGAA
CGGGATGGATGGTTGGGTTTGCTGGTACTGGATTGTCACTCCTCATTCTA
TTGATCTCATTCCTCGTTGCCTTGGTAACATTGATGTCAGCAGTGGGCGT
GTCTGACCGATGTGATCTAGGTCATGGTGGCGTGTATTTTATACTCACCC
ATGTGTTGGGCGGCAAAGTGGGCGGTACTGTTGGTCTAATGTACTGTGTG
GGACATtgCATCGCAACATCTCTTTACTGTACCGGGTTTTCCGAATCAAT
GGTCGGTCTGATGAATTGGGATCATCCTTGGGCTATTCGTCTTGTATCTA
TCATTACGCTGGTCGTTTTAGTCGGAATCGCCTTGTCCGGAGTCAAATGG
ATTGTTCGGTTTCAATTAGTGTTGATCATAATACTGGCCATTGCTATGTG
TGATTTCATACTTGGAACGTTGGCCCAAGAGAAACCAGaatcTGGCTTCA
GCGGGTTCAAGAATGCTAACTTCGTCGAGAATTTGAAATCGGATTTTAAT
AAAGACATTTCATTTTTCGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTG
TGGCGTTTTGGCTGGCGTCAATATGAGTGGCGACTTGAAAGAGCCAGGCC
AAAATATCCCGGAAGGCTCAGTTGCAGCTCTTGCTTTATGTGGTTTCATT
TACACCATATTGGTGTTATTCTTGGGTTCAACATGCACTCGTGAAGCGTT
GCAAACAGATTCCCTCATAATGGAAAAGATTTCACTCGTTGGCGCCCTTC
TTATATTTGGATTGTTTGTGGCGGCACTTTCATCCATTCTGGGCGGCTTA
GTTGGTCCACCCCGTGTCCTTCAACGTATCGCAGAGGATAACGTGCTGCC
TATTCTCAAACCATTCGCTGAGTTGaGCGGTGGCAACAAGGAGCCACGCA
ATGCGACCCTTCTATGTGCTTCAATAGCtctcatcttcatttttgtcGGT
AATTTGAATCAATTGGCCCCAATCGTCACCATGCCTTTCTTAATGACGTA
TACAATCATAAATTATGCGTATTTCGCCATGGCAATGTCATACGACGTCA
AGTTGAAACAAACGGCCCGTGTAGAGGGCCGTTATAATAGCCCGaccaaa
aataataacaaatctGTTGAAATGTGTGATTACGGATCTACGACGGTCAC
CAAACGACGTACGTGGGAAAACGGGAACGAATATCACGAGTTAACGTCAG
ACGACGGCGGTGACGTAGTAGCGGAAGAAGAAACCGTCATAGACAATTCT
AAAACGTTAGAAGTGAAAGAGCCACCAGACTATGATACGTCACAACGTGA
ATCAGGGCTAGCCGTCTCCGACCATGACGAGGAATTGAATGTAGAAAGTA
ATAGAGTTTCTTCTGAAGATACAACGAGTTACCAACGACAACGGAGTTTG
AATGAGGGACAATATTTAGAATTTATTCACGAGCGAAACACCAACACTTT
ATATGGTCGACTTTGTAATCGCTGGGTTTCATTATTTACTagtTTTGTTT
GTTTAGTTTTGTCATTTTGTGTGAGCTGGGCTTACGCACTCGCTAACCTG
AGTATAACGCTCATCCTGTTCATTTTTGTCAGTCAAGCGCGGCCTGGTCT
GTCGCCTGGCGTGGCTAGTGACTTTAACTTTGGTGTTTGGTTGTGCACGC
TCTTACCACGAGACAAAAAGGATGAAGAACAAGAACATGTGATCATTCAA
AGCAGCCAAGTGCCTTATGGAATTTCAATGCATGTTATTACTCAAGAAAA
TATGGACTATGAGCACAGAGATCGAAAACATTTAGCCTCGACTATCAATA
AACCGCAACCTTACCACTAGATGGGAGAAAATGGGAGCGTAAATGGTGAT
AAAGTTGGGGGAAGAAATGTAAACGGTGTTGATTGGAATCAGTATGGTTT
GGCCAGCGATACAAACCACCCAGCCGCCTTGAATGATAACGGAAGTAAAG
GCTTTTTATCATCCTATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCAT
GAACAAGAGAATGGATCAGAAACAGATCAAGAACCTTGGTGGAAATCCAA
TTTCTTTGTAACAAAGAAAGTACTCTTTGGAACATGGGACGGTGTGTTCA
CATCCTGTGTTATGAACATCGTGGGTGTGGTGGTCTTCCTTCGAACGGGA
TGGATGGTTGGGTTTGCTGGTACTGGATTGTCACTCCTCATTCTATTGAT
CTCATTCCTCGTTGCCTTGGTAACATTGATGTCAGCAGTGGGCGTGTCTG
ACCGATGTGATCTAGGTCATGGTGGCGTGTATTTTATACTCACCCATGTG
TTGGGCGGCAAAGTGGGCGGTACTGTTGGTCTAATGTACTGTGTGGGACA
TtgCATCGCAACATCTCTTTACTGTACCGGGTTTTCCGAATCAATGGTCG
GTCTGATGAATTGGGATCATCCTTGGGCTATTCGTCTTGTATCTATCATT
ACGCTGGTCGTTTTAGTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGT
TCGGTTTCAATTAGTGTTGATCATAATACTGGCCATTGCTATGTGTGATT
TCATACTTGGAACGTTGGCCCAAGAGAAACCAGaatcTGGCTTCAGCGGG
TTCAAGAATGCTAACTTCGTCGAGAATTTGAAATCGGATTTTAATAAAGA
CATTTCATTTTTCGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCG
TTTTGGCTGGCGTCAATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAAT
ATCCCGGAAGGCTCAGTTGCAGCTCTTGCTTTATGTGGTTTCATTTACAC
CATATTGGTGTTATTCTTGGGTTCAACATGCACTCGTGAAGCGTTGCAAA
CAGATTCCCTCATAATGGAAAAGATTTCACTCGTTGGCGCCCTTCTTATA
TTTGGATTGTTTGTGGCGGCACTTTCATCCATTCTGGGCGGCTTAGTTGG
TCCACCCCGTGTCCTTCAACGTATCGCAGAGGATAACGTGCTGCCTATTC
TCAAACCATTCGCTGAGTTGaGCGGTGGCAACAAGGAGCCACGCAATGCG
ACCCTTCTATGTGCTTCAATAGCtctcatcttcatttttgtcGGTAATTT
GAATCAATTGGCCCCAATCGTCACCATGCCTTTCTTAATGACGTATACAA
TCATAAATTATGCGTATTTCGCCATGGCAATGTCATACGACGTCAAGTTG
AAACAAACGGCCCGTGTAGAGGGCCGTTATAATAGCCCGaccaaaaataa
taacaaatctGTTGAAATGTGTGATTACGGATCTACGACGGTCACCAAAC
GACGTACGTGGGAAAACGGGAACGAATATCACGAGTTAACGTCAGACGAC
GGCGGTGACGTAGTAGCGGAAGAAGAAACCGTCATAGACAATTCTAAAAC
GTTAGAAGTGAAAGAGCCACCAGACTATGATACGTCACAACGTGAATCAG
GGCTAGCCGTCTCCGACCATGACGAGGAATTGAATGTAGAAAGTAATAGA
GTTTCTTCTGAAGATACAACGAGTTACCAACGACAACGGAGTTTGAATGA
GGGACAATATTTAGAATTTATTCACGAGCGAAACACCAACACTTTATATG
GTCGACTTTGTAATCGCTGGGTTTCATTATTTACTagtTTTGTTTGTTTA
GTTTTGTCATTTTGTGTGAGCTGGGCTTACGCACTCGCTAACCTGAGTAT
AACGCTCATCCTGTTCATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGC
CTGGCGTGGCTAGTGACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTA
CCACGAGACAAAAAGGATGAAGAACAAGAACATGTGATCATTCAAAGCAG
CCAAGTGCCTTATGGAATTTCAATGCATGTTATTACTCAAGAAAATATGG
ACTATGAGCACAGAGATCGAAAACATTTAGCCTCGACTATCAATAAACCG
CAACCTTACCACTAGATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGT
TGGGGGAAGAAATGTAAACGGTGTTGATTGGAATCAGTATGGTTTGGCCA
GCGATACAAACCACCCAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTT
TTATCATCCTATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCATGAACA
AGAGAATGGATCAGAAACAGATCAAGAACCTTGGTGGAAATCCAATTTCT
TTGTAACAAAGAAAGTACTCTTTGGAACATGGGACGGTGTGTTCACATCC
TGTGTTATGAACATCGTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGAT
GGTTGGGTTTGCTGGTACTGGATTGTCACTCCTCATTCTATTGATCTCAT
TCCTCGTTGCCTTGGTAACATTGATGTCAGCAGTGGGCGTGTCTGACCGA
TGTGATCTAGGTCATGGTGGCGTGTATTTTATACTCACCCATGTGTTGGG
CGGCAAAGTGGGCGGTACTGTTGGTCTAATGTACTGTGTGGGACATtgCA
TCGCAACATCTCTTTACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTG
ATGAATTGGGATCATCCTTGGGCTATTCGTCTTGTATCTATCATTACGCT
GGTCGTTTTAGTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGT
TTCAATTAGTGTTGATCATAATACTGGCCATTGCTATGTGTGATTTCATA
CTTGGAACGTTGGCCCAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAA
GAATGCTAACTTCGTCGAGAATTTGAAATCGGATTTTAATAAAGACATTT
CATTTTTCGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTG
GCTGGCGTCAATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCC
GGAAGGCTCAGTTGCAGCTCTTGCTTTATGTGGTTTCATTTACACCATAT
TGGTGTTATTCTTGGGTTCAACATGCACTCGTGAAGCGTTGCAAACAGAT
TCCCTCATAATGGAAAAGATTTCACTCGTTGGCGCCCTTCTTATATTTGG
ATTGTTTGTGGCGGCACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCAC
CCCGTGTCCTTCAACGTATCGCAGAGGATAACGTGCTGCCTATTCTCAAA
CCATTCGCTGAGTTGaGCGGTGGCAACAAGGAGCCACGCAATGCGACCCT
TCTATGTGCTTCAATAGCtctcatcttcatttttgtcGGTAATTTGAATC
AATTGGCCCCAATCGTCACCATGCCTTTCTTAATGACGTATACAATCATA
AATTATGCGTATTTCGCCATGGCAATGTCATACGACGTCAAGTTGAAACA
AACGGCCCGTGTAGAGGGCCGTTATAATAGCCCGaccaaaaataataaca
aatctGTTGAAATGTGTGATTACGGATCTACGACGGTCACCAAACGACGT
ACGTGGGAAAACGGGAACGAATATCACGAGTTAACGTCAGACGACGGCGG
TGACGTAGTAGCGGAAGAAGAAACCGTCATAGACAATTCTAAAACGTTAG
AAGTGAAAGAGCCACCAGACTATGATACGTCACAACGTGAATCAGGGCTA
GCCGTCTCCGACCATGACGAGGAATTGAATGTAGAAAGTAATAGAGTTTC
TTCTGAAGATACAACGAGTTACCAACGACAACGGAGTTTGAATGAGGGAC
AATATTTAGAATTTATTCACGAGCGAAACACCAACACTTTATATGGTCGA
CTTTGTAATCGCTGGGTTTCATTATTTACTagtTTTGTTTGTTTAGTTTT
GTCATTTTGTGTGAGCTGGGCTTACGCACTCGCTAACCTGAGTATAACGC
TCATCCTGTTCATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGC
GTGGCTAGTGACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTACCACG
AGACAAAAAGGATGAAGAACAAGAACATGTGATCATTCAAAGCAGCCAAG
TGCCTTATGGAATTTCAATGCATGTTATTACTCAAGAAAATATGGACTAT
GAGCACAGAGATCGAAAACATTTAGCCTCGACTATCAATAAACCGCAACC
TTACCACTAGATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGG
GAAGAAATGTAAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGAT
ACAAACCACCCAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATC
ATCCTATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGA
ATGGATCAGAAACAGATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTA
ACAAAGAAAGTACTCTTTGGAACATGGGACGGTGTGTTCACATCCTGTGT
TATGAACATCGTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTG
GGTTTGCTGGTACTGGATTGTCACTCCTCATTCTATTGATCTCATTCCTC
GTTGCCTTGGTAACATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGA
TCTAGGTCATGGTGGCGTGTATTTTATACTCACCCATGTGTTGGGCGGCA
AAGTGGGCGGTACTGTTGGTCTAATGTACTGTGTGGGACATtgCATCGCA
ACATCTCTTTACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAA
TTGGGATCATCCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCG
TTTTAGTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAA
TTAGTGTTGATCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGG
AACGTTGGCCCAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATG
CTAACTTCGTCGAGAATTTGAAATCGGATTTTAATAAAGACATTTCATTT
TTCGTTGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGG
CGTCAATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAG
GCTCAGTTGCAGCTCTTGCTTTATGTGGTTTCATTTACACCATATTGGTG
TTATTCTTGGGTTCAACATGCACTCGTGAAGCGTTGCAAACAGATTCCCT
CATAATGGAAAAGATTTCACTCGTTGGCGCCCTTCTTATATTTGGATTGT
TTGTGGCGGCACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGT
GTCCTTCAACGTATCGCAGAGGATAACGTGCTGCCTATTCTCAAACCATT
CGCTGAGTTGaGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTAT
GTGCTTCAATAGCtctcatcttcatttttgtcGGTAATTTGAATCAATTG
GCCCCAATCGTCACCATGCCTTTCTTAATGACGTATACAATCATAAATTA
TGCGTATTTCGCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGG
CCCGTGTAGAGGGCCGTTATAATAGCCCGaccaaaaataataacaaatct
GTTGAAATGTGTGATTACGGATCTACGACGGTCACCAAACGACGTACGTG
GGAAAACGGGAACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACG
TAGTAGCGGAAGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTG
AAAGAGCCACCAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGT
CTCCGACCATGACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTG
AAGATACAACGAGTTACCAACGACAACGGAGTTTGAATGAGGGACAATAT
TTAGAATTTATTCACGAGCGAAACACCAACACTTTATATGGTCGACTTTG
TAATCGCTGGGTTTCATTATTTACTagtTTTGTTTGTTTAGTTTTGTCAT
TTTGTGTGAGCTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATC
CTGTTCATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGC
TAGTGACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACA
AAAAGGATGAAGAACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCT
TATGGAATTTCAATGCATGTTATTACTCAAGAAAATATGGACTATGAGCA
CAGAGATCGAAAACATTTAGCCTCGACTATCAATAAACCGCAACCTTACC
ACTAGATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGA
AATGTAAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATACAAA
CCACCCAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCATCCT
ATCCTAAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAATGGA
TCAGAAACAGATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAACAAA
GAAAGTACTCTTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTATGA
ACATCGTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTT
GCTGGTACTGGATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGC
CTTGGTAACATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAG
GTCATGGTGGCGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTG
GGCGGTACTGTTGGTCTAATGTACTGTGTGGGACATtgCATCGCAACATC
TCTTTACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATTGGG
ATCATCCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTTTTA
GTCGGAATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGT
GTTGATCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGGAACGT
TGGCCCAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAAC
TTCGTCGAGAATTTGAAATCGGATTTTAATAAAGACATTTCATTTTTCGT
TGTGTTTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCA
ATATGAGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCA
GTTGCAGCTCTTGCTTTATGTGGTTTCATTTACACCATATTGGTGTTATT
CTTGGGTTCAACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCATAA
TGGAAAAGATTTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTG
GCGGCACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCT
TCAACGTATCGCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTG
AGTTGaGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGTGCT
TCAATAGCtctcatcttcatttttgtcGGTAATTTGAATCAATTGGCCCC
AATCGTCACCATGCCTTTCTTAATGACGTATACAATCATAAATTATGCGT
ATTTCGCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGGCCCGT
GTAGAGGGCCGTTATAATAGCCCGaccaaaaataataacaaatctGTTGA
AATGTGTGATTACGGATCTACGACGGTCACCAAACGACGTACGTGGGAAA
ACGGGAACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACGTAGTA
GCGGAAGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAAAGA
GCCACCAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGTCTCCG
ACCATGACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGAT
ACAACGAGTTACCAACGACAACGGAGTTTGAATGAGGGACAATATTTAGA
ATTTATTCACGAGCGAAACACCAACACTTTATATGGTCGACTTTGTAATC
GCTGGGTTTCATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGT
GTGAGCTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGTT
CATTTTTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTG
ACTTTAACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAAG
GATGAAGAACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGG
AATTTCAATGCATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAG
ATCGAAAACATTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAG
ATGGGAGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGT
AAACGGTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATACAAACCACC
CAGCCGCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCATCCTATCCT
AAAGAAGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAATGGATCAGA
AACAGATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAG
TACTCTTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTATGAACATC
GTGGGTGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGG
TACTGGATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGG
TAACATTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCAT
GGTGGCGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGG
TACTGTTGGTCTAATGTACTGTGTGGGACATtgCATCGCAACATCTCTTT
ACTGTACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATTGGGATCAT
CCTTGGGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTTTTAGTCGG
AATCGCCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGA
TCATAATACTGGCCATTGCTATGTGTGATTTCATACTTGGAACGTTGGCC
CAAGAGAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGT
CGAGAATTTGAAATCGGATTTTAATAAAGACATTTCATTTTTCGTTGTGT
TTGGTGTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATG
AGTGGCGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGC
AGCTCTTGCTTTATGTGGTTTCATTTACACCATATTGGTGTTATTCTTGG
GTTCAACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCATAATGGAA
AAGATTTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGC
ACTTTCATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAAC
GTATCGCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTG
aGCGGTGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGTGCTTCAAT
AGCtctcatcttcatttttgtcGGTAATTTGAATCAATTGGCCCCAATCG
TCACCATGCCTTTCTTAATGACGTATACAATCATAAATTATGCGTATTTC
GCCATGGCAATGTCATACGACGTCAAGTTGAAACAAACGGCCCGTGTAGA
GGGCCGTTATAATAGCCCGaccaaaaataataacaaatctGTTGAAATGT
GTGATTACGGATCTACGACGGTCACCAAACGACGTACGTGGGAAAACGGG
AACGAATATCACGAGTTAACGTCAGACGACGGCGGTGACGTAGTAGCGGA
AGAAGAAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAAAGAGCCAC
CAGACTATGATACGTCACAACGTGAATCAGGGCTAGCCGTCTCCGACCAT
GACGAGGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGATACAAC
GAGTTACCAACGACAACGGAGTTTGAATGAGGGACAATATTTAGAATTTA
TTCACGAGCGAAACACCAACACTTTATATGGTCGACTTTGTAATCGCTGG
GTTTCATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAG
CTGGGCTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGTTCATTT
TTGTCAGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTT
AACTTTGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAAGGATGA
AGAACAAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTT
CAATGCATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGA
AAACATTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAGATGGG
AGAAAATGGGAGCGTAAATGGTGATAAAGTTGGGGGAAGAAATGTAAACG
GTGTTGATTGGAATCAGTATGGTTTGGCCAGCGATACAAACCACCCAGCC
GCCTTGAATGATAACGGAAGTAAAGGCTTTTTATCATCCTATCCTAAAGA
AGAAGTTAAAGAACTATTTGAGCATGAACAAGAGAATGGATCAGAAACAG
ATCAAGAACCTTGGTGGAAATCCAATTTCTTTGTAACAAAGAAAGTACTC
TTTGGAACATGGGACGGTGTGTTCACATCCTGTGTTATGAACATCGTGGG
TGTGGTGGTCTTCCTTCGAACGGGATGGATGGTTGGGTTTGCTGGTACTG
GATTGTCACTCCTCATTCTATTGATCTCATTCCTCGTTGCCTTGGTAACA
TTGATGTCAGCAGTGGGCGTGTCTGACCGATGTGATCTAGGTCATGGTGG
CGTGTATTTTATACTCACCCATGTGTTGGGCGGCAAAGTGGGCGGTACTG
TTGGTCTAATGTACTGTGTGGGACATtgCATCGCAACATCTCTTTACTGT
ACCGGGTTTTCCGAATCAATGGTCGGTCTGATGAATTGGGATCATCCTTG
GGCTATTCGTCTTGTATCTATCATTACGCTGGTCGTTTTAGTCGGAATCG
CCTTGTCCGGAGTCAAATGGATTGTTCGGTTTCAATTAGTGTTGATCATA
ATACTGGCCATTGCTATGTGTGATTTCATACTTGGAACGTTGGCCCAAGA
GAAACCAGaatcTGGCTTCAGCGGGTTCAAGAATGCTAACTTCGTCGAGA
ATTTGAAATCGGATTTTAATAAAGACATTTCATTTTTCGTTGTGTTTGGT
GTGTTCTTTCCCACGGCTTGTGGCGTTTTGGCTGGCGTCAATATGAGTGG
CGACTTGAAAGAGCCAGGCCAAAATATCCCGGAAGGCTCAGTTGCAGCTC
TTGCTTTATGTGGTTTCATTTACACCATATTGGTGTTATTCTTGGGTTCA
ACATGCACTCGTGAAGCGTTGCAAACAGATTCCCTCATAATGGAAAAGAT
TTCACTCGTTGGCGCCCTTCTTATATTTGGATTGTTTGTGGCGGCACTTT
CATCCATTCTGGGCGGCTTAGTTGGTCCACCCCGTGTCCTTCAACGTATC
GCAGAGGATAACGTGCTGCCTATTCTCAAACCATTCGCTGAGTTGaGCGG
TGGCAACAAGGAGCCACGCAATGCGACCCTTCTATGTGCTTCAATAGCtc
tcatcttcatttttgtcGGTAATTTGAATCAATTGGCCCCAATCGTCACC
ATGCCTTTCTTAATGACGTATACAATCATAAATTATGCGTATTTCGCCAT
GGCAATGTCATACGACGTCAAGTTGAAACAAACGGCCCGTGTAGAGGGCC
GTTATAATAGCCCGaccaaaaataataacaaatctGTTGAAATGTGTGAT
TACGGATCTACGACGGTCACCAAACGACGTACGTGGGAAAACGGGAACGA
ATATCACGAGTTAACGTCAGACGACGGCGGTGACGTAGTAGCGGAAGAAG
AAACCGTCATAGACAATTCTAAAACGTTAGAAGTGAAAGAGCCACCAGAC
TATGATACGTCACAACGTGAATCAGGGCTAGCCGTCTCCGACCATGACGA
GGAATTGAATGTAGAAAGTAATAGAGTTTCTTCTGAAGATACAACGAGTT
ACCAACGACAACGGAGTTTGAATGAGGGACAATATTTAGAATTTATTCAC
GAGCGAAACACCAACACTTTATATGGTCGACTTTGTAATCGCTGGGTTTC
ATTATTTACTagtTTTGTTTGTTTAGTTTTGTCATTTTGTGTGAGCTGGG
CTTACGCACTCGCTAACCTGAGTATAACGCTCATCCTGTTCATTTTTGTC
AGTCAAGCGCGGCCTGGTCTGTCGCCTGGCGTGGCTAGTGACTTTAACTT
TGGTGTTTGGTTGTGCACGCTCTTACCACGAGACAAAAAGGATGAAGAAC
AAGAACATGTGATCATTCAAAGCAGCCAAGTGCCTTATGGAATTTCAATG
CATGTTATTACTCAAGAAAATATGGACTATGAGCACAGAGATCGAAAACA
TTTAGCCTCGACTATCAATAAACCGCAACCTTACCACTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000019XLOC_000019Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000030-proteinTCONS_00000030-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000030-exon-sc0000001-1491911889:779125..779671TCONS_00000030-exon-sc0000001-1491911889:779125..779671Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:779125..779671TCONS_00000030-exon-sc0000001-1510915933:779125..779671Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:779125..779671TCONS_00000030-exon-sc0000001-1575043694:779125..779671Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:787901..787982TCONS_00000030-exon-sc0000001-1491911889:787901..787982Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:787901..787982TCONS_00000030-exon-sc0000001-1510915933:787901..787982Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:787901..787982TCONS_00000030-exon-sc0000001-1575043694:787901..787982Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:788578..788645TCONS_00000030-exon-sc0000001-1491911889:788578..788645Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:788578..788645TCONS_00000030-exon-sc0000001-1510915933:788578..788645Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:788578..788645TCONS_00000030-exon-sc0000001-1575043694:788578..788645Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:789710..789901TCONS_00000030-exon-sc0000001-1491911889:789710..789901Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:789710..789901TCONS_00000030-exon-sc0000001-1510915933:789710..789901Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:789710..789901TCONS_00000030-exon-sc0000001-1575043694:789710..789901Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:791614..791845TCONS_00000030-exon-sc0000001-1491911889:791614..791845Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:791614..791845TCONS_00000030-exon-sc0000001-1510915933:791614..791845Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:791614..791845TCONS_00000030-exon-sc0000001-1575043694:791614..791845Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:792351..792552TCONS_00000030-exon-sc0000001-1491911889:792351..792552Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:792351..792552TCONS_00000030-exon-sc0000001-1510915933:792351..792552Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:792351..792552TCONS_00000030-exon-sc0000001-1575043694:792351..792552Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:793463..793550TCONS_00000030-exon-sc0000001-1491911889:793463..793550Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:793463..793550TCONS_00000030-exon-sc0000001-1510915933:793463..793550Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:793463..793550TCONS_00000030-exon-sc0000001-1575043694:793463..793550Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:796572..796718TCONS_00000030-exon-sc0000001-1491911889:796572..796718Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:796572..796718TCONS_00000030-exon-sc0000001-1510915933:796572..796718Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:796572..796718TCONS_00000030-exon-sc0000001-1575043694:796572..796718Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:797283..797784TCONS_00000030-exon-sc0000001-1491911889:797283..797784Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:797283..797784TCONS_00000030-exon-sc0000001-1510915933:797283..797784Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:797283..797784TCONS_00000030-exon-sc0000001-1575043694:797283..797784Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:798842..798954TCONS_00000030-exon-sc0000001-1491911889:798842..798954Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:798842..798954TCONS_00000030-exon-sc0000001-1510915933:798842..798954Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:798842..798954TCONS_00000030-exon-sc0000001-1575043694:798842..798954Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:802046..802224TCONS_00000030-exon-sc0000001-1491911889:802046..802224Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:802046..802224TCONS_00000030-exon-sc0000001-1510915933:802046..802224Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:802046..802224TCONS_00000030-exon-sc0000001-1575043694:802046..802224Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1491911889:803817..805026TCONS_00000030-exon-sc0000001-1491911889:803817..805026Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1510915933:803817..805026TCONS_00000030-exon-sc0000001-1510915933:803817..805026Clytia hemisphaericaexon
TCONS_00000030-exon-sc0000001-1575043694:803817..805026TCONS_00000030-exon-sc0000001-1575043694:803817..805026Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:779125..805026 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.32942 3.79285 5.15558 5.69412 19.2452 13.4324 28.7984 31.6304 19.2446 23.5285 18.124 17.889 15.6992 13.0436 7.09645 7.95361 9.8191 10.1854 13.5985 20.058 8.23634 8.497 3.83821 5.68816 10.6559 11.2443 6.0727 5.46327 6.28555 6.4898
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004841AA-permease/SLC12A_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
biological_process GO:0006810 transport
cellular_component GO:0016020 membrane
Blast
BLAST of TCONS_00000030 vs. Swiss-Prot (Human)
Match: S12A8 (Solute carrier family 12 member 8 OS=Homo sapiens GN=SLC12A8 PE=2 SV=4)

HSP 1 Score: 417.927 bits (1073), Expect = 6.230e-130
Identity = 266/710 (37.46%), Postives = 405/710 (57.04%), Query Frame = 2
Query:  515 EVKELFEHEQENGSETDQEPWWKSNFFVTKKVLFGTWDGVFTSCVMNIVGVVVFLRTGWMVGXXXXXXXXXXXXXXXXXXXXTLMSAVGVSDRCDLGHGGVYFIXXXXXXXXXXXXXXXMYCVGHCIATSLYCTGFSESMVGLMNWDHPWAIRLVSIITLVVLVGIALSGVKWIVRFQLVLIIILAIAMCDFILGTLAQEKPESGFSGFKNANFVENLKSDFNKDISFFVVFGVFFPTACGVLAGVNMSGDLKEPGQNIPEGSVAALALCGFIYTILVLFLGSTCTREALQTDSLIMEKISLVGALLIFGLFVAALSSILGGLVGPPRVLQRIAEDNVLPILKPFAELSGGNKEPRNATLLCASIALIFIFVGNLNQLAPIVTMPFLMTYTIINYAYFAMAM--------------------------------SYDVKLKQTARVEGRYNSPTKNNNKSVEMCDYGSTTVTKRRTWENGNEYHELTSDDGGDVVAEEETVIDNSKTLEVKEPPDYDTSQRESGLAVSDHDEELNVESNRVSSEDTT---SYQRQ---------RSLNEGQYLE-FIHE----RNTNTLYGRLCNRWVSLFTSFVCLVLSFCVSWAYALANLSITLILFIFVSQARPGLSPGVASDFNFGVWLCTLLPRDKKD--EEQEHVIIQSSQVPYGISMHVITQENMDYEHRDRKHLASTINKPQ 2491
            +V+ELF    +  +    +PWWK+  F+ + VLFGTWDGVFTSC++NI GVV+FLRTGW+VG  G  L + ++    LVALVT++S +GV +R  +G GGVY +++ VLGG+ GGT+GL+Y  G C+A ++Y TGF+ES+  L+   + WA+R +S+  L+ L+GI L+GVKWI+R QL+L+ +LA++  DF++G+     PE GF G+       N   D++   SFF VFGVFFP A GV+AG NM GDL+EP  +IP GS+AA+ +  F+Y I V  LG+ CTREAL+ D LI EK+SL+G L + GL++++L+S +GGL G PR+LQ IA++ V+P L    +  G NK P  A  L + + + F+FVG +N LAPIVT+ F++TY  ++Y+YF+++M                                SY  +      +EG     TK+ ++ +++     ++  ++     GN   E  S       A ++T+ D S  L++K PP +     +   A S   +E         SE T    +Y  Q          S  E  +L+  + E    R + + Y  +CN WVSL  +   L++ F + W Y L N+ +  I++ ++ +A PGL  G AS+F+F  W+ +LL    +     QE +I+  S     + M  +TQEN D+  RDR H +S +N+ Q
Sbjct:    6 QVQELFHEAAQQDALAQPQPWWKTQLFMWEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGMFLVSFVILVALVTVLSGIGVGERSSIGSGGVYSMISSVLGGQTGGTIGLLYVFGQCVAGAMYITGFAESISDLLGLGNIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAASIPLGSLAAVGISWFLYIIFVFLLGAICTREALRYDFLIAEKVSLMGFLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIPALACLGQGKGPNKTPVAAICLTSLVTMAFVFVGQVNVLAPIVTINFMLTYVAVDYSYFSLSMCSCSLTPVPEPVLREGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQ---GEGNRTPE--SQKRKSKKATKQTLQD-SFLLDLKSPPSFPVEISDRLPAASWEGQESCWNKQTSKSEGTQPEGTYGEQLVPELCNQSESSGEDFFLKSRLQEQDVWRRSTSFYTHMCNPWVSLLGAVGSLLIMFVIQWVYTLVNMGVAAIVYFYIGRASPGLHLGSASNFSFFRWMRSLLLPSCRSLRSPQEQIILAPSLAKVDMEMTQLTQENADFATRDRYHHSSLVNREQ 709          
The following BLAST results are available for this feature:
BLAST of TCONS_00000030 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S12A86.230e-13037.46Solute carrier family 12 member 8 OS=Homo sapiens ... [more]
back to top