TCONS_00000020 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000020
Unique NameTCONS_00000020
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3407

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000020 ID=TCONS_00000020|Name=TCONS_00000020|organism=Clytia hemisphaerica|type=transcript|length=3407bp
TAATAGaggaaataaattaaataaaactacaTACAAGATGAAAGCAACAA
ATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAG
AAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAG
TTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAAC
GCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAA
CAAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATATC
AAAGAGCAGtcataaatATGATTTGTCTAAGTCATACCACAGTATCAGCT
ACTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGCACAA
CATTCCTTGAATGCTTCAtggcaattttttaattttatgggTGGATCAGC
TGAAATTGAGAACAACACCAATTCGCAGTATAAAAAACCTACTCAAGCTA
TAGTCACCATCAATGCAAGGACATCTCGTATTTTGATTACCAACGAGACA
GCATGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCACAT
GAAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGTTT
TGATTGAACAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAGGG
AAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCTGT
ATGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTA
TGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGA
ACAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAAGA
TCCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTTTC
AATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGC
GTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAAGT
CAGAATTCATGACCCGGAATTCCATCAGCTTTACATGGAACGAACAGCAG
AAAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGGTG
TTTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTGAC
GAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTG
AACTAATGGGAAAGGAAATCACAACGCTGATACCTTACTTTTACGAACAA
ATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCAAT
TAAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGAAT
GCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAGAT
CTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAATGA
CGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCGTT
TGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAGGC
ACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTGAA
AGACGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTGCA
CTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAA
CTCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAGAA
GAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGATTA
CCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTTTG
CGTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatggtgC
TGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTT
TGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCT
ATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGTAA
TGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTA
CAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactgtaaA
AAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCTGG
ACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGATTT
TGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACAAC
AACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAAAC
CGAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAACA
GTACAATGACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAATA
CAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAATT
TAACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTG
CAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTCATACgtaaa
gaaaaagttttgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGCAC
ACCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGTTA
AAGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATATGGTGATGGAG
AAACACGGTGACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCACT
CATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCA
CAGATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGACGAA
AACATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTC
AGCTGCACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCA
TCGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGACCA
GAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTTTATATTCGG
TGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCC
CACCTTTCAAAGTGTCTAACGGTAATGGATAAGactgttttctttttgtt
ttgaaaagtcatAGAAGATTTGTGAAATTGTCAAACACACTGATCTCTGA
CTGCTTAGCTGGATCAGGCTTCCCTTATAAAATGAAGCTTGTTTAGTTGA
AGAGCTGTCTAGTCAGCCAATTTGTATTCTATTCTGTGTGGTTGTTATAA
CAGTGAG
Run BLAST on NCBI

protein sequence of TCONS_00000020-protein

>TCONS_00000020-protein ID=TCONS_00000020-protein|Name=TCONS_00000020-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1076bp
NRGNKLNKTTYKMKATNLSNSINMSSPLHHFREKNDEKAVNMLSMMKDKS
FDQPLFEAEKVQEMEERARSRLSEYDPADSSLKQATTDSMSSKSNLSTIS
KSSHKYDLSKSYHSISYCASPCPGNISTNSPAQHSLNASWQFFNFMGGSA
EIENNTNSQYKKPTQAIVTINARTSRILITNETACDLFGYTDEELCGKHM
KVSQLFTMEDGVKQNVLIEQNIDKEGNIVMVSGKVLEATNKKGDIFMVSV
WMKRIQAGSDVRCVLIMEPVDVNKGSFLFDAAGTISDCDFTFALLHGYED
PQDLIGKNIDTFVPSFQLPSPGQVLSKDIKKQRVTSRTKDLVPFPSTIKV
RIHDPEFHQLYMERTAENKRQMSKFLYKGFLWVFSNVSGLMTIDNKGLVT
SCNENFLRIFLGYFESELMGKEITTLIPYFYEQIDMLHHGSIPQTPSSSI
KRNKHGSCKKDDLVIECLDGPPATTKCGLDDTDLEEGEIRSTKNDSGIND
ESESLNDQSTPLKDERLNNRGTPLQEEHLDSRGTPLRDEICLNNQDTPLK
DECLDNTGTPLNDEICTNKLNNCVSHQANKKDKLDGFSPHTISTPVSDEK
RETNIDRIEGKLTDQITEKQKLDFGQNDREESLRKTDIVFTDPVKIKDGA
VVKDAFVAKDTVSRDVLQHKQIKTSDYESLSSSIVDDVLSRLSKNTELCN
EQKTRVCASKATSQNFTASEQSGLSDLVFEDCKKEILEKDKGDLSKIYPG
QYYGQARHKDGSMLPILFEIKKWSSKSKNKDNNNGQLFCLWMSRDPDEET
ETYGTEKHKQLLASFNSTMTISTGNFQEMLKEIQDMKLEDPGSGLYNDKF
NTARCIGKGAFGFVNLAERKSDNEQVVVKFIRKEKVLKDSWIDDASIGRT
PYEVHLLSKLQHPNVVKVLEVYENDCYVHMVMEKHGDGIDLFEFIDRKPL
MDEALASYMFRQVLSATDYLHQNKILHRDIKDENIIVDRSFHLKLIDFGS
AAPLEKDKYFTTFCGTIEYCSPEVLLGNSYRGPELEMWSLGVTLYTFIFG
EHPFFEVEDSIRAELFPPFKVSNGNG
Run BLAST on NCBI

transcript from alignment at sc0000001:500943..520408+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000020 ID=TCONS_00000020|Name=TCONS_00000020|organism=Clytia hemisphaerica|type=transcript|length=19466bp|location=Sequence derived from alignment at sc0000001:500943..520408+ (Clytia hemisphaerica)
TAATAGaggaaataaattaaataaaactacaTACAAGATGAAAGCAACAA ATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAG AAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAG TTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAAC GCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAA CAAGGTAAGCGCGGCTGACTTTCTTTTTATGCAGTGTTAGAAGTTTTCTC CGCTCAGACAGATCTCTATCTCAGGGAAGTAAATAAAGAGGCTTGTATGT CTCAAAGTTTAATTCACTAAAGTTTCCAGAATATTTACTAACCTTGCTTT CACCAGTGCTCTTATTCATTATTCTTGTTTCTTCCTGTTAGCTTACCTCA AGAAGGTTGAGATAATGTGTTCtctttaaaattcttaaaaaaataaaagt taactgTTGTCTTCTATAGTCCGTTCAGTGTCATGCATTGTTTTTGATAg ttaataaaatgaaaagaatcACATCTGAAAGCCGTTAACAAATATCTAAC TGAAAATGAACAAACTATAATTTTAATCTTCATCTGTTATGAAAATGAca tcttaaaataaaaatttgaatttaattttactATCTAGACAAGTAATATG GTGGTCTCCTGCAGTGTTTGTTTGAATCCAGCTATACTAGAAAAAGAGAC TAACAACTgtgataataataacaataacaattACAGTACAGTTTTTTATA CAATCTTAACCCCGCAAGGATTGGATCAGCCATGTcatttttcaataata tttaAACAAGGTCTTTttactttaaagattttttaaaataattattgTAA TAGCTTGAtgtaatgtaatttaactaaactTTATTTTTCAGCTACCACTG ATTCAATGTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGtcat aaatgtaaacaaaatttatatataaatagtaaatttaaaaTGTATGTCAA AGTTGactattaaaatgaaaaatatctttaatccTATGAATATGTATCGT TTTGATTCAAACTTTAAACAGATTTGATTAATATCTTTGAGCCATTATGT TATGGCCTCCTTTTAATAATTAACATACAAATTGTACTTGGCTGGATTTG GTCCAGCTCCTTGTTTGAAAATACAGACTCTAAGTtgctttttaatcttt tttgcaGACTTTAAGGCCGGTCTTCACTTTTGCGCGATATGAGCAAAAAC TTTTGACCGAAATttgtaacggatgaaaaaaagtagaacttcctttaact tttttttttcgcgcaaaatttttttatgacgtaatcttttcttcaggcaa aaaaggtcaAGAAAAAAGCTGTCACCCATATCGCGCGGAAGTGGAGACCA gcattttgataaatatgataagATCCAAGAGCTAGTATCATTATTTACTA TATAGATTATCAAAAGttgatttgaaatcaatttcttcGCATTTTTTTCT AGATGATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCAT GTCCTGGTAATATATCAACAAACAGTCCTGCACAACATTCCTTGAATGCT TCAtggcaattttttaattttatgggTGGATCAGCTGAAATTGAGAACAA CACCAATTCGCAGTATAAAAAACCTGTAAGTATAATAATGCTCAGGGAGC ATAAGGTGCCATTGCATAAAAGTAGAGTATCTCTGGCTATGATGCACAAG TTTGTGGGTTTCAAACAACAAGAGTTTTTAGAACTATATTATAAtctttt ttctcaacttcagttgagctagaatctgacaaagACGTATGTGTATGTGG TATgtgtgtatgtatgtctgtctgaaaactttggggcaggatggagactt caaaaatgatcggatttggctgaaatttggcagacttgttccttgggtgt tcatctgggggcgttttttttcattttttgaaaattttaatttttaaggg cCTGGTCATGAGTTTTAgctccaaaacgaggctgaaactttggggGTAGg cttgagacttcaaaaatgattgagtttcggctgaaatttggcccaatagt tcattgggtgaatatcttagaatgttttttttcatattttgaaaattttt atttttgggacctggggacaagtttttcatcaaaacgAGGCTTTAGTTTA CATTGGACTTTTCTATCAATTTTACATTTGGGCCTATGCATGATTGAAAA ATACtaaagttgagcccagtgcggtttGCAAGTTCGTCATATGGGAATAT AATGAAACCTCTTGTCCCATCTGAGCTAATTCAATATTACTGTCTCATGT cccaaaagcaaaaaaaataatgatggtttatgaaaatctttttgaccaaa aaattaaTCATACCACATCAAACTTAATCATAATTTTTATCTCATCAAAA TTAAAGCCAGGTTGATGATATTTAAATTTCTGAGCTTGCAAGAACATTGC AGTTTTTAAAACGAATCATTAAAACAAAACAGTGCACACTACgtcatttg attttttatttgacaatgGAAGGTCTTCTTTCTGAAATACATAACACAGA CCATCAGTTTATAACACTTTGATGTTGGtcaacattttaatttttttttg cataatttgCTTTTACAATATCAGCAAGcaccttcaaaataaaatttaac tttCCCTTTAGACTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGT ATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGGTTACACAGATGA AGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGG ATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGA AATATTGTTATGGTTTCAGGGAAAGTGGTATGTGTTTCgaatcattattt tcaaaataaataaataaaattaagaagTCAGTATCTTTGTGTTCTATGAT AAATaaaggagcgatggccaagtggtcaaaggcgtcagcgtctcaaaTCA GGGATTCGCAGTTCGAATCCCCGCACCTTCCAATGTTCTGTTCaattcat agatagccgagccggctggccgtggaccccgtgaaaacaatcgaaagact gtctataagtcctagattactgggctatccacgtaaaatatcgactctat ctatctatctataggGTAAATTTCCACATAAGGTGATTATTGTGTTGTAT TTAAAAAAGGTTGTCAAAGTATAAAGGTTTTTGCAGGAgtattatgaaaa ttttcatatgtttttagttttgttgtttaaaataaatttcttgCAGTAAA GGTTCTATACATATTGTTCgaaccttttcaaattcaaatagaCGTCTGTC TCAGcaaagtataaaaaaattttgtgtttcataattcaacaaaattgaaa aaattcaacaaaatctgacATGAATTTGAGAAGTCTTTGGTACCCATTCT TTTGTATTGTTTTAGGTGAACCAAAGAGCAAAGAACACCGCTAAGGGTTG TTTTTCAgagagaaaataacaaaatattgttttcacTTTTCAGTTAGAAG CCACCAATAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAACGT ATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGTTGA TGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtgtaagattttgaaatt tcagtcaTAACTTCTGTGGACTTCTCCAGGTACCAGAAGATCAGCATTCT TGGATAATTGtctttgaaatttagaaaatattttcaaagtagTGCTTGTA AAGACCTTGAAAACAGTCAGAATTGTCTTAAATTTACGACATTGTTCCAT GTAGggagttttatttttcattttctgaaattATTCCTAGGGGATTCAGA GACTGCGTGAGATACAAGGCTTTTAATTCATTTCTTAAgcctggaaattt tgaaaaaataagagAGTGTCTTTAGTATGAGTTgtaaaaatttttgacaa aataacaATACAAATAATATACCAATTTCAAGCATAATAAAATTTATGCC TCATTATCTCATTGCTAGGGAACAATTTCAGATTGTGATTTCACTTTTGC ACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTG ACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCA AAGGTAGGTGAAAAAGctactttttatttataaacaagGGGTAATATACT TTTATCATCTCAAagtctgaaaattaaaacacGACACTGTCATACTTTCC TACGGGGTTGATACCCCACCCTTGAAAACAGCCCCCACCCTTTACCACCA ACCCCGCCCTAAATGTAGAAACTCTTTGAACCCTGCCCTTTCAGAAAAAC TCCGCCCTTGACCACCAAAATATCCATACCCCAcccttcaaaaaaaacaa aaaaatttccacgtGTTTCCAGACTCTTAGAACTTGTTCTCAGATAGGCC AGAGTAAGTccagtttttatatttatactaaaaataacagaaatgtttga atttttcattatcTTGCAGAATTACTTGAGGGGATAAAGCTCCTCTTTTT gagaagaatatttttatttgtggGCGCCCCCGCCACGTGCTGGGAAAAGA TTGATTTAATGATgattaaaaatcattaaaaacaaaacaaaacacaatat aaaaattgaaggaaaaagCCCCCCACCCTTTGCCACCAACCCCGCCATAA GTCAAGAAATCCCTGTAAACCCACCCTTTCtgacttttttgggaaaaccg TTTACCCCACCATCTAGCTAGGGTGGGGTGGAAAGTATGACTGTTCCTTG TTTGACAAAAAGTTGAAGACCAGAAAACTAGGGAAATATGGTTATATACT TTCTACCTTCTCTCACATATTCTTAAAgaataatcttaaaaaaaaataca gctAACTCCTTTTATAGGACATCAAAAAGCAACGCGTCACAAGCCGTACA AAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCC GGAATTCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAA TGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGT GGTTTAATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAA TTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGG TAACTGTTAATACTTTGTTCAttcaatctttcattttatttcattaaCTC CAAgctctttagatttttttttagcCCAAAGGGTGGGCATACAATATGAG GTCAtacatgaaaattttttcacgATTTCAAAATGTAGATTGTTAGTACC TATAAAGTCATGTTTCATAAAACCTGTTCTAGACGACCTATGACCCCAAA AATTTGCACATGCAGGAGAGATTAAGATTTATTAAACgtcagaaaatttt aaatcgTTTCTAAAACTTTTCGTTGATATAAAAGAAGATCaacgtggtag attctacccctcTAGCAAATAgggttcgttcgttcgttcgttcgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttcgttcattcaTTGGGTAAATAACTATCCTCATTTTTTTGTACCTGTAT TATGCGTACCCCACTTTGCAATACAACATGATAAGAACGATGTTAGACGA TATTACAGTAGATGTCAACTCAGAGGAAAGAAGAATCTGTGAAATAATGA CTATTTTCTTTTCCAGGAAATCACAACGCTGATACCTTACTTTTACGAAC AAATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCA ATTAAGCGTAATAAACATGGTATGTTTTTCATCTTGAGCagaaatgcaat taaaaggctccaattttgatgatatttttataACTATTATAGCCCTTAAC CCATAACCCTTTACAACCCTTTAACGTCGACTCTTACTACGCTAAAGCTC AATTATGCTCCATTTTTGAGCCTCGCCCTAATTTATTTCTGATCCCTTac ccggtgtaaaaagggctgaTTAGGTAGTTGGATACTTTCACAtaaatttc acattttaaaggttttgttttcaagtaagagtgatatcgtttgcttactc gtcaattttaatgcacaagctttttcacattggattgacatggatgtgga gcaagattggtcagaaagaggaaaagaaaaacatttttttgcttatatca gcatgatATAACAATATGCAGAcactgatatgaaatatgtgtctgatatg aaacgggaacacttctGCCAACATAAAACCTTTAACTCCCTTTAGTTTTC GTCAATTCAAAAAATTCACTTTCGGTAGTTTAAAAGGGTACAGGGGATTA AAAAAGGACTTGCATAGACTTCCATGCTAGTGATCTTTATTCTTTGTCTG GATTATGGACATCCCCTAAAACGCAAAATTTGTCTTGGTTTTACGACAAC TAATCcaccattttttgttttgatttttggttaACAACTACGGGATTCGC GTTTTTACGCTCGAGAATCCATCTTTTACGCTCGAAGATCCGCCTTTTAC ACTCGAAAATCCACCGTTTACGCTCTAAAATTCACCTTTTACACTCAAAA ATCCACCGTTTATGCTCGAAAATCCATGCAACAGAAAGCAACATGCGGAT TTTAGTGGTCGAAAacttttgtgagtattttgcgAGAAAGTTACCTTTGT ATCGAATGCTTTTTTTCAGGTTCATGTAAAAAGGATGATCTGGTTATCGA ATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAG ATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAAT GACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCG TTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAG GCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTG AAAGACGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTG CACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACA AACTCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAG AAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGAT TACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTT TGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatggt gCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGT TTTGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGT CTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGT AATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTT TACAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactgta aAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCT GGACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGAT TTTGTTTGAGGTAAGTAAAAAGTCATGATAATGTAGATTGTTACAGCTTT TGTAACACTTTTCCTTTTTTGTTAAAGCGAAGCTAACGATATtgaaatta gagcctttaggctgttggtttgccgtcacccgatcCTAGGTTTTGGAGTT GGGTGGGTcggtatttaaaaaaataaaatctgaaaagctAAAAGGGAATT CATTCTATTGTTATAAACTTTAAATAGAACGAGACAGACACAATAGACGt tctgatttgaaaaaaaaaatgttctttaaaattggcaataaaTTTTTTGG TATGTTTCGAGTTGGAGTCGATTGGATCGGATGACGGCACaccaacattt ttttaattgcAGCCTTTTATCGCTTTTTAAAATGACGAgcttgcaaaaaa tattgcagtttttttttaaacaaattatcaTAAAAGATTTAACACCTATT TCTAAAATCGCGTGATGCACACCATTAATTTTAAGATGCACTGACGTTTT GTGCCAGATATTCAAAAAAGGTAGCATGGATAGAAGGGATTATTTTTCTA AAGGGACCTCAAATTGTTTGGGCGATAAAAATTGTTTGGGCGATAAAAAT TGTTTGGGCGATAAAAATTGTTTGGGCGATAAAAATTCGAGTTATTGAGG ATCAACTTTAATATATTGAATGCCCAGCTGgcccacaacgttgtttcgac gtttttctaacgttcacaacgtccatataacgttagaaaaacgttgaaac aacgttgtgtgccagctgggtgtgTTCAAATAAATTTCTAGCGACTTGGT TTCGTACAtagaatacagttgacgctctctctaattcgacgttctacttc TACTATTCAACACACTCCATCATTCGatagtcaccgtcaacaagaaactc tcataaacaacgttctactattcgatatgctCCATTATCcaatattcaat gaaaatccgattccccttgaaaatcgaattagagagtgtcatcTTTACTG TTCGATATTAAAGTTCATTTATCACACTTTTTTAGATCAAGAAATGGTCA AGTAAAAGCAAGAACAAAGACAACAACAACGGACAACTCTTTTGTCTTTG GATGTCACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCGAAAAGC ACAAACAATTGTTAGCAAGTTTCAACAGTACAATGACTATATCGACGGGT AATTTCCAGGAGGTTCGTTTTTTACAAATTTATCTGTACTGAAAGCTTTC CCTGGAGTCTATTAGACCCTGGAACTCGTAAGAAAAGTAAACTTTTTAGC TGAGATTGACAATAAAATTCGggacaaagaaaaatttgaattgcttcaaa aaaagatttgtaaTGTATACTACATACATAagattttgtttggttttatc CAGGGTAGTGGTGATAGAGATACTTTTTCTGTACTTTCAGGTGCTTTACG GGGGACGAGTCATGAGGTCCGGGTGGttgggaaaaaattaattaaacatT TTACTTACCGAGTTTGTCAATAATTCGAcgttaagtaagtaagtaagtat attcatctggtggttcattccccttttctatttgcgctagacctgggaaa TTGAaggctgaggtggagcgccacacctactctcagctcccagtaactta ccgcttAGGTCAGAtcacccaatctaagctactcatccgctgagttggcg gtgaccggggatcgaacccacaacccttagattgtaaagcgaatgctcta ccgactgagctacccggccacAAAAGGAGAATAAGTAAACTGTTTGTAGT GTCTGTGTGAGAGTCTTCGGGTTATCTGTGAAAATTCCATTGCTATATTT CCCAGATGCTGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTCT GGTCTTTATAACGATAAATTTAACACCGCACGATGTATTGGAAAAGGCGC TTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGtaa tatggaaatatgaaaatatcGACTCCGACTATCAGCCTCTGAAAACTTAT AAGAATACGTATGGTGAAATCGGCCACAAAATTAAGACTATGGTAAGAAT ACTGGCATCATGGATTTTGGCAACTGAACCCAAGAATgcccatttttaga gcattttaccaTTAAATTGCTAATTATTCCCCAGCAatgccaattttttt tgctccATGTATGTATTTCATGCTAGATTTTGGAtccaaacctaagaata ccttaagaatattttcagaatgattttccccaaaaaagttaagaatattc atgatggaTTGAAAAAACACCTATCCTATAagaagaaaaagcgtgtatcc aaaagatatttctattCAATCGAAAGGTTGTGGTCAAATTCATTAGGGAC GCGTGCGCCTAGCAGACTTAAGGCcagggcaaaccgatccaaNctccccc ccccccccccttcagcCCTTTAAAAAGCCgatcttacatttttttataag aatatactttattagaatatttatggtgaaattgaacaaaaaatttaaga atatggtaagaataccgGCATCAgggaatttggcaactgaacctaagaat gccatttttagatcATCTTACCATTATGTAAGATGCCGATTATTACCCAG CAATGCTAAAGGCTtccacaaaaatgccaaattttttttctggaggtatg tattacatgctAAATTTTGGCTAGATTTTCTATCCAAACCTAacaatacc gtaagaatattttcatgACACCTATCTTATAAgaagaaaaagcgtgtaat caTGATATTTCTGTTCATCAAAAGGTTGTGGTCATTTTCATTAGGGACGC GTGCGCCTAACAGACTTAGTctgccatcttgttttcaattctggttGTCA ACAGCtcatttcgaatgttttgaaattcgaacgttcgaaaatttaaaaaa acttcaaaacgaAACACACTCCCACGGGATATCGGTTAAGTGTATAAAGG AATATGATGATATATGTGCTCATACCTATAAACCATTTAGCAAGGTGTTC TATTCATCAATAGGTTGTGGTCAAATTCATACgtaaagaaaaagttttga aagacaGTTGGATTGATGATGCAAGCATTGGTCGCACACCTTACGAAGTT CATTTACTAAGCAAACTACAGCATCCTAATGTCGTTAAAGTAAGTGATTG AGTTGTTTTACATTTAATCTTTTGACATTATGGTGTTTTGCCACAGAGGA CCTAAAGCTTAACTGCTATTATTTGAGTTTTGAGTATTAAACCTGAAATC CTGGTttcaaaatattcgaaaaaaaagtCGAAAGGAAGACGAATAACCAA GCGCAGAAAAAAGcatgacgtctagtataggctagtaTTGTAATGATTGC CAACAATTGAGATTTCTAGACGTTACGATATTCCAGCCTGTCACCATGAT TACTAGTAAAATTAAACTTGCAGTTTCTTTTCCGTTCACAAATTGAGTAA TTCTTGAAAAGTGTTCGCAGTTCTTCCGTCTCGACGGGTTTCCGTCTCTT CGAAGTATGAAAAGAGACTTTTGCGCCGTagaatttagcaaaatcaagCG AAATATTGAAAACCTGGGCTAATTTTTCGTGTTGAGTCCATTTTCCGTCT CCGAGGAAAAACTTTGCTTTGAAGCTGGAAATCAGGTTGTTTTATATTCT GACATTCGCTTATCAGACTTCTCTGGTCTAAACAAAAATTCTATgaaccc tttccgtgcccatGTCAAGTATATTTATATTTAAAGGAGgtgactctaag ctatccaacgagctatgaacgagcttctaactccttctagatccggagat atttAAGCTTTTAaatttgaactagcgattttcttaaaaaaactgaaaaa aagggTTAAGGTATATGATACTTATATCAAAAtagcaaaatctgaaaatt ctactcatttttttgtttttgacagGTGCTTGAAGTATACGAGAACGATT GTTACGTTCATATGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTC GAATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACAT GTTTCGGCAGGTTGGTAGAATGATTgcccatttttgttttttttctgtta cGGAGACAGTTagcttctgattggtttagTTCCTGAATGACAGACAACGA CGTTAAAAAAGTGCTTTTACAAGTTTTtgcaaatcgcttcagtcaccact ccaccgtcctcaaaagttcAGATACATAAACTGGCTAATAAGAAATTTCG AGTAGCTCaataaaaacctttttaaattctTTCGGTTGTTTTCGTTTTAC GATGACCACCAGAAGGCTGGGAGGATTGAACAAAACATCGAAATGACTTG TGTATCAAactcacagatatcttatataaaacactatatAGAGCCTCTTT TCCCTAAGCCTtggcaggtgaagcaaaataatgcgctaTCTTTGCTATAA CCTCAGTAGAAACCTTGGTTTTCACTAACGACTTCAAAATTTCCAGGCTC GCGCAAGCGAAATTGTGAcgttattttatttaatattatGGTGGAATGAC TGACTACGGAGTGACTGTAACAGTTGGGAACAACCCGCACGTCCCCGCAC CCAATTTTGGCTAAGTGCCTCTACCGGGCCTCCTTAGTCTGTCAGCATCT TCTAGACAAAACAGAAACTAACCGGCTCCGTCGCAGATAAACGCCATAta aaccacagatctgtaaggctcgaagggctagataagcgacttttatcgaa aagtgaagcctaggtttggaaggatttcctactaaagtcacgtgactaaa atatgcaatttcaccggtttgagagatgtgaaatagcgtttgccgcctac tttttttgatctcgcgctccaaaaacaattaaaatgctagatcctatccg cgggcacgaaatttaaaaagtcaattttttgtttcattttttttttgctg gagaaagcttgaATTGCATATCTAgcacttcgggctttacagatctgtga taTAAACTCGCTAACTTTGCTTGGTTtgaccatggaggtataaagaaaga caggagaagtatgctattgtaaccaagctcgccctacgattaaaaaagtt acgatgtatgcatgctcataatctcgtATATCGTCAGGGGGGGGTACagc cgcagggtactaacccatagggtactaacctgatttttaagaaaaattgt ctcaggtaccaccaccccctttttagtaccgggtacttactttttcttaa ggaaaaagggacccccacccccCTTTTAGTACTgggtacttacttttttt ttaaggaaaaagggacccccaccccctttttagtacTGGGTACCGGCTTT AAAATTAccaaggaaaataagagacaccACCCTTAAAACTTGCCAAGCAT GGTCCCAATCTTTCAAAAGCCAGCAAAAGCAGCTCTTTGTTGTTATTATG ACTTGCATATACCATGTTTTTAACTCAGATCCTCTTAAAGGTTCTTTAAA TCAAACATACCTTTTAATTACAAAGGTAAAACAAGGAAATTCCttggcaa aagtaaaatattatatagctgTAATAACGgcaataaaagtatatatatct atcagaagaagtaaaaatcaagttgataaaaattgaagaatagtATGAAA GCTTGGATTGGATGGATTTCGTTATGTTTTTCTTCAATAGAAGGGTGATT TATTCAAATTGTTCAAAGCTGTGTCAATTTTATGAAAGAagttgaaatag aaaaaagttgcattGTTGGCTCTGGTTGGCTTTGCTTAGTTGACCTGCCT CCGTCTTAATTGCCATaaacagacaaacaaacaaacaaacaaaaataaac agaaataaGCTAAATCATCAGTTTGGATAAGAACTTTATTGTTTAAAAGA CAGATTGTATCACTTTGGATGCAACAGCTTGTAATTCTTTTCATCAGAAG GCAATGACAAACATATACCACGTTCTAACGAACTATCCTTCTCACTAATT AAAACAATACTGATTTTGAACAATAGCTTTCTTTACATTAGCTATTTCAA TATTTGTATAACTTAGTGGTCATAAAATTCNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcattttctggcttgag aaaatatcttttcaaaacaaaattgaacggatagcgaaatggaacataaa tttgtttcgtggacgaagttttatctaattttcggatattaaaaggctag aatcttcaatactgattattagaatgttcagagcaaacttgagttctaat aaaaagtcttatttcatcgggcgagcttagaatttcttttgatacatttt ataaaagaaatcaaaagactttaacgaccaattaccgacacattcaactc ctgttttctttatacctctatggtttGACCAAACACTAGAAAGAAAACTA CTACTTCTCTACTCCTTCTCTTAATATAAAGTTTTTGAGGGGTCATTATT TGAAAGTCgttaaataattttattttgcgTTTTCCAGGTGTTATCAGCCA CAGATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGTAGGT TATGCTTATTCGCCATTATTATCAACataaaaaatatgagcaatctgatt ggctaaaaacgcgtacataaatgctATATTTCATATTGTACTTTACAAAT ACAAGACCGCGTTCAAAAAAGGGGTCCGGTAAGTGAGCGTTCATATATTA TACAATTTTTCTGATTATTCTCTTCGCTTCCAATGCACAACAACTTATca aaagagtttatgaaaaaaatgttttgatctttttaatgaccatTCGATTC TTTTTTCGAAGGTTTTGATGTTTATTAATCtaattaaaagtaaaagaata aaatattggggaaaaaatcaaaacaaagaaaactgaATAGacataatatt tttcaagttgatgataaaccagttatcacacttttactcgtacaataagt tgttttaaagttttatttgGGGAACTTATTAAAGACTATTTCTCGTAAAT TAGGCTGTTGAATAAAAACTTGAAGTTAATGTTGAGAGTGATGCTTACAc tgcatttttaaacaaataaaaaacactttttctccACCTTCGGCACCGCG CgagcacaaattttgagaaGTTCGTTCgtttattctgctttgtcagcata gaggcgcGCCTCCTTTCTATATCGTGAAAataatacagtggagtctctat gATTTGAACGCGTACGGGGAAAGCAAatctgttcgagttatggagtaagg tttacaaggcattgttaactgaagggaccagaaaaagtgttcgagttaag aagactATCGAgttagaggttcgagttaaagagtatCTACTCAGGGTTGC TACGTCGAAGGAGATAGTTCTCAATGAAGTCTCGTAAACTTTGCGGAATT AGGAAACTTTTATCCTAGCATTtgaaattcccaaaaatttctGCTTGCTT TTATACTCGGAACCAAATCTTTATATTTATGTTCAAGCTGATATTTCTTA CTTCGTTATATTCCTCCCTTTTCAAATGACTGTTAAAGGAAAAGCTGAAA AACTTCGTAATGGATAAAATGTCTGGAAAATATTGGGTATTTTGccaaaa tctggaaattttttgacaaaaatctggaaaatatGGCTTTTGAGAATAAA AGTTTTCAAACTGGCAAACGTGTAGCAACTCTGTACAGTATCTTTCATGC GTCTAAACTaatttattatgtttttttctatCTCACAGGACGAAAACATT ATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGC ACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCATCGAAT ATTGCTCACCCGAAGTACTGCTCGGAAATTCGTAAGTCAAACTATCATAC AGAACTTGGAAAAAAAGGGACCcgggtttttggacctaccccggttgagg tcctataaattaacctctgttcgtccgttcgtccgttagttaccaacttt tctcgagattggctcattagttttttctgattttggcacaaagatgcaaa atggcaatggccaaaatgtgacggagcccgattttcNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNatggagggcaagattctctaaagaatggctgaagtg gtttttcccggaaaattcttattcgccttaaaaaacggattttcgtattg ggggaaattccctttaaccaaataagaaaatatagcttttctcaatgttg acttattattttttaaaaatttttttcacaatgatgaaaaatggcaatgc ctaaactgtgacggagcctgattttcaaaagacatttttttacggccgaa aatgccggaaatatgccggaaaaactggttttttggcattttctcgggAT TCTATCAttggttttttctgattttttgctcaaagatgcgtattaacaat gcccaaaacatggccgagttcgatttttgagaaaatttttttcccggttg aaaatgccggaaatcgccgtgtttgcagattttcagtggattttttcctt atattcatttctatgttttttacacaaaaacattattgataacaatgctc accatcaagcatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNcccccatcaacaatcaatgatgaattttttgcgttatgcattttc gctaaacgctatattttctgactgattttttttcatttttctcctcgcat tgctatctattcagcatctagcttgtttttcaTGATCTTTCTGGAAGGAA TCAGTTTATTTCCTTCCAATCAATTCATAAAGAGCCATGCCCAAAATTTA AGACCCGGGGGGGGATACTTGAGCAAAATGAGTGCAGgatatgtgcgagc cataaggatcCCTTTTCACACCCTAGAAAGTCTCTcaaccattaaaaagc aattgggtctctgtaagggttccaaaaattacgaaaataaaaaattgact ccTTGTACGGTCTAATTGTGTAAAAATTGTGCACAAAGGCGTACAAGCAT GAGACTTCCCACAATTGAAGTTTAGGGGtcaaattttcagatatgggttg taatgtttttctaaacgaGCATGAatgaaaaatgctttccaacggtatgt aaTATGGcatactttggagaaaaaaaattcattttagcctgggaacctgt tctggtctgtaaaatacacaaacaggtgccaatttattgggtctgagatt taaatcaatttttgacccctaaactacaaTTGTGCAAAGTCTCATGCTTG TACGCCTTTTTGCACAATGTTAATGACTTTTGGCACATTTAGACTGCACT ATCCCTTAAAGGGTCACAGCTTCTTGAAATTTGTAGTACATATCCCCCCT GGGAAAAGGGATAATCagagatggtttgagatattgtGCTTGTAGATTCC TACCATATAGTCCTGAGAGAAACCTCTGAATCTTTTTGTCTTAAGTGTTT TCCAAAGTTGAGAGAAAACAAGTTTCTTTagtatctttttgttttgtatt taATCAAGATATTGCCTTTTCTTTTCTTAGGTTTCATTGTTCCATTTGAT CCACTACTATTTaaatttacaacatttttttaaattttgactaCAGATAC CGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTT TATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGG AGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAAGactgtttt ctttttgttttgaaaagtcatAGAAGATTTGTGAAATTGTCAAACACACT GATCTCTGACTGCTTAGCTGGATCAGGCTTCCCTTATAAAATGAAGCTTG TTTAGTTGAAGAGCTGTCTAGTCAGCCAATTTGTATTCTATTCTGTGTGG TTGTTATAACAGTGAG

Coding sequence (CDS) from alignment at sc0000001:500943..520408+

>TCONS_00000020 ID=TCONS_00000020|Name=TCONS_00000020|organism=Clytia hemisphaerica|type=CDS|length=51696bp|location=Sequence derived from alignment at sc0000001:500943..520408+ (Clytia hemisphaerica)
AATAGaggaaataaattaaataaaactacaTACAAGATGAAAGCAACAAA
TTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAGA
AAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAGT
TTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACG
CGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAAC
AAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATATCA
AAGAGCAGtcataaatATGATTTGTCTAAGTCATACCACAGTATCAGCTA
CTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGCACAAC
ATTCCTTGAATGCTTCAtggcaattttttaattttatgggTGGATCAGCT
GAAATTGAGAACAACACCAATTCGCAGTATAAAAAACCTACTCAAGCTAT
AGTCACCATCAATGCAAGGACATCTCGTATTTTGATTACCAACGAGACAG
CATGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCACATG
AAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGTTTT
GATTGAACAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAGGGA
AAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCTGTA
TGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTAT
GGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAA
CAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAAGAT
CCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTTTCA
ATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGCG
TCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTC
AGAATTCATGACCCGGAATTCCATCAGCTTTACATGGAACGAACAGCAGA
AAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGT
TTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTGACG
AGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGA
ACTAATGGGAAAGGAAATCACAACGCTGATACCTTACTTTTACGAACAAA
TCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCAATT
AAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGAATG
CCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAGATC
TTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAATGAC
GAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCGTTT
GAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAGGCA
CGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTGAAA
GACGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTGCAC
TAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAAC
TCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAGAAG
AGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGATTAC
CGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTTTGC
GTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatggtgCT
GTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTTT
GCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCTA
TTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGTAAT
GAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTAC
AGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactgtaaAA
AAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCTGGA
CAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGATTTT
GTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACAACA
ACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAAACC
GAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAACAG
TACAATGACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAATAC
AAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAATTT
AACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGC
AGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTCATACgtaaag
aaaaagttttgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGCACA
CCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGTTAA
AGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATATGGTGATGGAGA
AACACGGTGACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCACTC
ATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCAC
AGATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGACGAAA
ACATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTCA
GCTGCACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCAT
CGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGACCAG
AACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTTTATATTCGGT
GAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCC
ACCTTTCAAAGTGTCTAACGGTAATGGATAAAATAGaggaaataaattaa
ataaaactacaTACAAGATGAAAGCAACAAATTTATCAAACTCCATCAAC
ATGTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAAGCTGT
CAACATGTTGAGTATGATGAAAGATAAAAGTTTTGATCAACCATTGTTTG
AAGCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGATTGAGT
GAATACGATCCAGCAGATTCCTCTTTGAAACAAGCTACCACTGATTCAAT
GTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGtcataaatATG
ATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCATGTCCT
GGTAATATATCAACAAACAGTCCTGCACAACATTCCTTGAATGCTTCAtg
gcaattttttaattttatgggTGGATCAGCTGAAATTGAGAACAACACCA
ATTCGCAGTATAAAAAACCTACTCAAGCTATAGTCACCATCAATGCAAGG
ACATCTCGTATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGGTTA
CACAGATGAAGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGTTCA
CAATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATTGAT
AAAGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAA
TAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAACGTATACAAG
CAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGTTGATGTCAAC
AAAGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGTGATTT
CACTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTGGCA
AAAACATTGACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAA
GTGCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAGCCGTACAAAAGA
CTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCCGGAAT
TCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAATGTCT
AAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTT
AATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAATTTCT
TGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGGAAATC
ACAACGCTGATACCTTACTTTTACGAACAAATCGACATGCTTCATCATGG
TTCCATCCCTCAAACACCATCATCTTCAATTAAGCGTAATAAACATGGTT
CATGTAAAAAGGATGATCTGGTTATCGAATGCCTCGATGGTCCGCCTGCT
ACAACAAAATGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAAATAAG
AAGCACGAAGAACGACAGTGGAATAAATGACGAATCGGAAAGCCTGAACG
ATCAAAGCACACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCACACCG
TTGCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCTTAGAGATGAGAT
ATGTTTGAATAATCAAGACACGCCTTTGAAAGACGAATGTTTGGATAACA
CAGGAACACCTCTTAATGATGAGATTTGCACTAATAAGTTGAATAATTGC
GTCAGCCATCAGGCGAATAAGAAGGACAAACTCGATGGATTTTCACCTCA
TACCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAACGAACATTGATA
GAATTGAGGGGAAATTAACTGACCAGATTACCGAAAAACAAAAACTGGAC
TTTGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGACAGATATTGTTTT
TACGGATCCTgttaaaattaaagatggtgCTGTTGTTAAGGACGCTTTTG
TTGCCAAGGATACTGTTTCTAGGGACGTTTTGCAacacaaacaaatcaaa
acgAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTTTTGTC
TCGGTTATCCAAAAATACTGAATTATGTAATGAACAGAAAACACGAGTTT
GTGCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCAGAACAGAGTGGA
CTCTCTGAtcttgtttttgaggactgtaaAAAAGAGATTTTAGAGAAAGA
TAAAGGTGATTTGAGTAAAATTTACCCTGGACAATATTACGGGCAAGCGA
GACACAAAGATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGAAATGG
TCAAGTAAAAGCAAGAACAAAGACAACAACAACGGACAACTCTTTTGTCT
TTGGATGTCACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCGAAA
AGCACAAACAATTGTTAGCAAGTTTCAACAGTACAATGACTATATCGACG
GGTAATTTCCAGGAGATGCTGAAAGAAATACAAGATATGAAACTAGAAGA
TCCTGGGTCTGGTCTTTATAACGATAAATTTAACACCGCACGATGTATTG
GAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAAC
GAACAGGTTGTGGTCAAATTCATACgtaaagaaaaagttttgaaagacaG
TTGGATTGATGATGCAAGCATTGGTCGCACACCTTACGAAGTTCATTTAC
TAAGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTATACGAG
AACGATTGTTACGTTCATATGGTGATGGAGAAACACGGTGACGGAATTGA
TCTGTTCGAATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGGCTA
GTTACATGTTTCGGCAGGTGTTATCAGCCACAGATTAtcttcatcaaaac
aaaatcttACATCGTGATATTAAGGACGAAAACATTATAGTTGATCGATC
GTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGCACCATTAGAAAAAG
ATAAATATTTCACGACCTTCTGCGGTACCATCGAATATTGCTCACCCGAA
GTACTGCTCGGAAATTCATACCGTGGACCAGAACTTGAAATGTGGTCATT
GGGAGTCACACTGTATACGTTTATATTCGGTGAACATCCATTCTTTGAAG
TTGAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAAC
GGTAATGGATAAAATAGaggaaataaattaaataaaactacaTACAAGAT
GAAAGCAACAAATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATC
ATTTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATG
AAAGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGA
AATGGAAGAACGCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATT
CCTCTTTGAAACAAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTC
TCTACAATATCAAAGAGCAGtcataaatATGATTTGTCTAAGTCATACCA
CAGTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACA
GTCCTGCACAACATTCCTTGAATGCTTCAtggcaattttttaattttatg
ggTGGATCAGCTGAAATTGAGAACAACACCAATTCGCAGTATAAAAAACC
TACTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGTATTTTGATTA
CCAACGAGACAGCATGTGACCTGTTTGGTTACACAGATGAAGAATTATGT
GGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAA
ACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGAAATATTGTTA
TGGTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTC
ATGGTGTCTGTATGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATG
TGTGCTCATTATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTG
ATGCTGCtGGAACAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCAT
GGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGT
CCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCA
AAAAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCA
ACAATCAAAGTCAGAATTCATGACCCGGAATTCCATCAGCTTTACATGGA
ACGAACAGCAGAAAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCT
TCTTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAA
GGTCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATA
TTTTGAAAGTGAACTAATGGGAAAGGAAATCACAACGCTGATACCTTACT
TTTACGAACAAATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCA
TCATCTTCAATTAAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCT
GGTTATCGAATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCG
ATGATACAGATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGT
GGAATAAATGACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAA
AGACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCG
ATAGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGAC
ACGCCTTTGAAAGACGAATGTTTGGATAACACAGGAACACCTCTTAATGA
TGAGATTTGCACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATA
AGAAGGACAAACTCGATGGATTTTCACCTCATACCATAAGTACACCTGTC
TCAGATGAGAAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAAC
TGACCAGATTACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCG
AAGAATCTTTGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaaatt
aaagatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTC
TAGGGACGTTTTGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTT
TGAGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACT
GAATTATGTAATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTC
TCAGAATTTTACAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttg
aggactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAA
ATTTACCCTGGACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAAT
GTTACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACA
AAGACAACAACAACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCC
GATGAAGAAACCGAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGC
AAGTTTCAACAGTACAATGACTATATCGACGGGTAATTTCCAGGAGATGC
TGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTAT
AACGATAAATTTAACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTT
TGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAAT
TCATACgtaaagaaaaagttttgaaagacaGTTGGATTGATGATGCAAGC
ATTGGTCGCACACCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCC
TAATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATA
TGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTCGAATTCATCGAT
CGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGT
GTTATCAGCCACAGATTAtcttcatcaaaacaaaatcttACATCGTGATA
TTAAGGACGAAAACATTATAGTTGATCGATCGTTTCATTTGAAACTCATC
GACTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATATTTCACGACCTT
CTGCGGTACCATCGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCAT
ACCGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACG
TTTATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGC
GGAGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAAAATAGag
gaaataaattaaataaaactacaTACAAGATGAAAGCAACAAATTTATCA
AACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGA
CGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAGTTTTGATC
AACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGA
TCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAACAAGCTAC
CACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCA
GtcataaatATGATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCA
AGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGCACAACATTCCTT
GAATGCTTCAtggcaattttttaattttatgggTGGATCAGCTGAAATTG
AGAACAACACCAATTCGCAGTATAAAAAACCTACTCAAGCTATAGTCACC
ATCAATGCAAGGACATCTCGTATTTTGATTACCAACGAGACAGCATGTGA
CCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCACATGAAAGTAT
CTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAA
CAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTT
AGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGA
AACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCT
GTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTC
AGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAG
ATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTTTCAATTACCA
TCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAG
CCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTC
ATGACCCGGAATTCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAA
CGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAA
CGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTA
ATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATG
GGAAAGGAAATCACAACGCTGATACCTTACTTTTACGAACAAATCGACAT
GCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCAATTAAGCGTA
ATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGAATGCCTCGAT
GGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAGATCTTGAAGA
AGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAATGACGAATCGG
AAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCGTTTGAATAAC
AGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCT
TAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTGAAAGACGAAT
GTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTGCACTAATAAG
TTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAACTCGATGG
ATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAA
CGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGATTACCGAAAAA
CAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGAC
AGATATTGTTTTTACGGATCCTgttaaaattaaagatggtgCTGTTGTTA
AGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTTTGCAacac
aaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGA
CGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGTAATGAACAGA
AAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCA
GAACAGAGTGGACTCTCTGAtcttgtttttgaggactgtaaAAAAGAGAT
TTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCTGGACAATATT
ACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGATTTTGTTTGAG
ATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACAACAACGGACA
ACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAAACCGAAACTT
ACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAACAGTACAATG
ACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAATACAAGATAT
GAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAATTTAACACCG
CACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGA
AAATCTGATAACGAACAGGTTGTGGTCAAATTCATACgtaaagaaaaagt
tttgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGCACACCTTACG
AAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTT
GAAGTATACGAGAACGATTGTTACGTTCATATGGTGATGGAGAAACACGG
TGACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCACTCATGGATG
AAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCACAGATTAt
cttcatcaaaacaaaatcttACATCGTGATATTAAGGACGAAAACATTAT
AGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGCAC
CATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCATCGAATAT
TGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGACCAGAACTTGA
AATGTGGTCATTGGGAGTCACACTGTATACGTTTATATTCGGTGAACATC
CATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTC
AAAGTGTCTAACGGTAATGGATAAAATAGaggaaataaattaaataaaac
tacaTACAAGATGAAAGCAACAAATTTATCAAACTCCATCAACATGTCAT
CGCCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATG
TTGAGTATGATGAAAGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGA
GAAAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGATTGAGTGAATACG
ATCCAGCAGATTCCTCTTTGAAACAAGCTACCACTGATTCAATGTCTTCT
AAATCTAACCTCTCTACAATATCAAAGAGCAGtcataaatATGATTTGTC
TAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATA
TATCAACAAACAGTCCTGCACAACATTCCTTGAATGCTTCAtggcaattt
tttaattttatgggTGGATCAGCTGAAATTGAGAACAACACCAATTCGCA
GTATAAAAAACCTACTCAAGCTATAGTCACCATCAATGCAAGGACATCTC
GTATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGGTTACACAGAT
GAAGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGA
GGATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAG
GAAATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAA
GGAGACATATTCATGGTGTCTGTATGGATGAAACGTATACAAGCAGGGAG
TGATGTTCGATGTGTGCTCATTATGGAACCTGTTGATGTCAACAAAGGAA
GCTTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGTGATTTCACTTTT
GCACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACAT
TGACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTT
CAAAGGACATCAAAAAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTT
CCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCCGGAATTCCATCA
GCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAATGTCTAAATTCT
TATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACC
ATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAAT
CTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGGAAATCACAACGC
TGATACCTTACTTTTACGAACAAATCGACATGCTTCATCATGGTTCCATC
CCTCAAACACCATCATCTTCAATTAAGCGTAATAAACATGGTTCATGTAA
AAAGGATGATCTGGTTATCGAATGCCTCGATGGTCCGCCTGCTACAACAA
AATGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAAATAAGAAGCACG
AAGAACGACAGTGGAATAAATGACGAATCGGAAAGCCTGAACGATCAAAG
CACACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAG
AAGAACATCTCGATAGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTG
AATAATCAAGACACGCCTTTGAAAGACGAATGTTTGGATAACACAGGAAC
ACCTCTTAATGATGAGATTTGCACTAATAAGTTGAATAATTGCGTCAGCC
ATCAGGCGAATAAGAAGGACAAACTCGATGGATTTTCACCTCATACCATA
AGTACACCTGTCTCAGATGAGAAGAGAGAAACGAACATTGATAGAATTGA
GGGGAAATTAACTGACCAGATTACCGAAAAACAAAAACTGGACTTTGGTC
AAAATGATCGCGAAGAATCTTTGCGTAAGACAGATATTGTTTTTACGGAT
CCTgttaaaattaaagatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAA
GGATACTGTTTCTAGGGACGTTTTGCAacacaaacaaatcaaaacgAGTG
ACTATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTA
TCCAAAAATACTGAATTATGTAATGAACAGAAAACACGAGTTTGTGCCAG
CAAGGCAACGTCTCAGAATTTTACAGCATCAGAACAGAGTGGACTCTCTG
AtcttgtttttgaggactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGT
GATTTGAGTAAAATTTACCCTGGACAATATTACGGGCAAGCGAGACACAA
AGATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTA
AAAGCAAGAACAAAGACAACAACAACGGACAACTCTTTTGTCTTTGGATG
TCACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCGAAAAGCACAA
ACAATTGTTAGCAAGTTTCAACAGTACAATGACTATATCGACGGGTAATT
TCCAGGAGATGCTGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGG
TCTGGTCTTTATAACGATAAATTTAACACCGCACGATGTATTGGAAAAGG
CGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGG
TTGTGGTCAAATTCATACgtaaagaaaaagttttgaaagacaGTTGGATT
GATGATGCAAGCATTGGTCGCACACCTTACGAAGTTCATTTACTAAGCAA
ACTACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATT
GTTACGTTCATATGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTC
GAATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACAT
GTTTCGGCAGGTGTTATCAGCCACAGATTAtcttcatcaaaacaaaatct
tACATCGTGATATTAAGGACGAAAACATTATAGTTGATCGATCGTTTCAT
TTGAAACTCATCGACTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATA
TTTCACGACCTTCTGCGGTACCATCGAATATTGCTCACCCGAAGTACTGC
TCGGAAATTCATACCGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTC
ACACTGTATACGTTTATATTCGGTGAACATCCATTCTTTGAAGTTGAAGA
TTCCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATG
GATAAAATAGaggaaataaattaaataaaactacaTACAAGATGAAAGCA
ACAAATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCG
AGAGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATA
AAAGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAA
GAACGCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTT
GAAACAAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAA
TATCAAAGAGCAGtcataaatATGATTTGTCTAAGTCATACCACAGTATC
AGCTACTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGC
ACAACATTCCTTGAATGCTTCAtggcaattttttaattttatgggTGGAT
CAGCTGAAATTGAGAACAACACCAATTCGCAGTATAAAAAACCTACTCAA
GCTATAGTCACCATCAATGCAAGGACATCTCGTATTTTGATTACCAACGA
GACAGCATGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGC
ACATGAAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAAT
GTTTTGATTGAACAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTC
AGGGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGT
CTGTATGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTC
ATTATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGC
tGGAACAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATG
AAGATCCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCC
TTTCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCA
ACGCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCA
AAGTCAGAATTCATGACCCGGAATTCCATCAGCTTTACATGGAACGAACA
GCAGAAAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATG
GGTGTTTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGG
TGACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAA
AGTGAACTAATGGGAAAGGAAATCACAACGCTGATACCTTACTTTTACGA
ACAAATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTT
CAATTAAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATC
GAATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATAC
AGATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAA
ATGACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAG
CGTTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAG
AGGCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTT
TGAAAGACGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATT
TGCACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGA
CAAACTCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATG
AGAAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAG
ATTACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATC
TTTGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatg
gtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGAC
GTTTTGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTC
GTCTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTAT
GTAATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAAT
TTTACAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactg
taaAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACC
CTGGACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCG
ATTTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAA
CAACAACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAG
AAACCGAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTC
AACAGTACAATGACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGA
AATACAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATA
AATTTAACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAAC
CTTGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTCATACg
taaagaaaaagttttgaaagacaGTTGGATTGATGATGCAAGCATTGGTC
GCACACCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTC
GTTAAAGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATATGGTGAT
GGAGAAACACGGTGACGGAATTGATCTGTTCGAATTCATCGATCGAAAAC
CACTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCA
GCCACAGATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGA
CGAAAACATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCG
GTTCAGCTGCACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGT
ACCATCGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGG
ACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTTTATAT
TCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTG
TTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAAAATAGaggaaataa
attaaataaaactacaTACAAGATGAAAGCAACAAATTTATCAAACTCCA
TCAACATGTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAA
GCTGTCAACATGTTGAGTATGATGAAAGATAAAAGTTTTGATCAACCATT
GTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGAT
TGAGTGAATACGATCCAGCAGATTCCTCTTTGAAACAAGCTACCACTGAT
TCAATGTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGtcataa
atATGATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCAT
GTCCTGGTAATATATCAACAAACAGTCCTGCACAACATTCCTTGAATGCT
TCAtggcaattttttaattttatgggTGGATCAGCTGAAATTGAGAACAA
CACCAATTCGCAGTATAAAAAACCTACTCAAGCTATAGTCACCATCAATG
CAAGGACATCTCGTATTTTGATTACCAACGAGACAGCATGTGACCTGTTT
GGTTACACAGATGAAGAATTATGTGGCAAGCACATGAAAGTATCTCAACT
GTTCACAATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAACAGAATA
TTGATAAAGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCC
ACCAATAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAACGTAT
ACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGTTGATG
TCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGT
GATTTCACTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAGATCTGAT
TGGCAAAAACATTGACACGTTTGTCCCTTCCTTTCAATTACCATCACCTG
GTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAGCCGTACA
AAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCC
GGAATTCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAA
TGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGT
GGTTTAATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAA
TTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGG
AAATCACAACGCTGATACCTTACTTTTACGAACAAATCGACATGCTTCAT
CATGGTTCCATCCCTCAAACACCATCATCTTCAATTAAGCGTAATAAACA
TGGTTCATGTAAAAAGGATGATCTGGTTATCGAATGCCTCGATGGTCCGC
CTGCTACAACAAAATGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAA
ATAAGAAGCACGAAGAACGACAGTGGAATAAATGACGAATCGGAAAGCCT
GAACGATCAAAGCACACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCA
CACCGTTGCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCTTAGAGAT
GAGATATGTTTGAATAATCAAGACACGCCTTTGAAAGACGAATGTTTGGA
TAACACAGGAACACCTCTTAATGATGAGATTTGCACTAATAAGTTGAATA
ATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAACTCGATGGATTTTCA
CCTCATACCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAACGAACAT
TGATAGAATTGAGGGGAAATTAACTGACCAGATTACCGAAAAACAAAAAC
TGGACTTTGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGACAGATATT
GTTTTTACGGATCCTgttaaaattaaagatggtgCTGTTGTTAAGGACGC
TTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTTTGCAacacaaacaaa
tcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTT
TTGTCTCGGTTATCCAAAAATACTGAATTATGTAATGAACAGAAAACACG
AGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCAGAACAGA
GTGGACTCTCTGAtcttgtttttgaggactgtaaAAAAGAGATTTTAGAG
AAAGATAAAGGTGATTTGAGTAAAATTTACCCTGGACAATATTACGGGCA
AGCGAGACACAAAGATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGA
AATGGTCAAGTAAAAGCAAGAACAAAGACAACAACAACGGACAACTCTTT
TGTCTTTGGATGTCACGTGATCCCGATGAAGAAACCGAAACTTACGGTAC
CGAAAAGCACAAACAATTGTTAGCAAGTTTCAACAGTACAATGACTATAT
CGACGGGTAATTTCCAGGAGATGCTGAAAGAAATACAAGATATGAAACTA
GAAGATCCTGGGTCTGGTCTTTATAACGATAAATTTAACACCGCACGATG
TATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTG
ATAACGAACAGGTTGTGGTCAAATTCATACgtaaagaaaaagttttgaaa
gacaGTTGGATTGATGATGCAAGCATTGGTCGCACACCTTACGAAGTTCA
TTTACTAAGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTAT
ACGAGAACGATTGTTACGTTCATATGGTGATGGAGAAACACGGTGACGGA
ATTGATCTGTTCGAATTCATCGATCGAAAACCACTCATGGATGAAGCTTT
GGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCACAGATTAtcttcatc
aaaacaaaatcttACATCGTGATATTAAGGACGAAAACATTATAGTTGAT
CGATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGCACCATTAGA
AAAAGATAAATATTTCACGACCTTCTGCGGTACCATCGAATATTGCTCAC
CCGAAGTACTGCTCGGAAATTCATACCGTGGACCAGAACTTGAAATGTGG
TCATTGGGAGTCACACTGTATACGTTTATATTCGGTGAACATCCATTCTT
TGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGT
CTAACGGTAATGGATAAAATAGaggaaataaattaaataaaactacaTAC
AAGATGAAAGCAACAAATTTATCAAACTCCATCAACATGTCATCGCCTTT
GCATCATTTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTA
TGATGAAAGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTC
CAAGAAATGGAAGAACGCGCAAGATCAAGATTGAGTGAATACGATCCAGC
AGATTCCTCTTTGAAACAAGCTACCACTGATTCAATGTCTTCTAAATCTA
ACCTCTCTACAATATCAAAGAGCAGtcataaatATGATTTGTCTAAGTCA
TACCACAGTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATATATCAAC
AAACAGTCCTGCACAACATTCCTTGAATGCTTCAtggcaattttttaatt
ttatgggTGGATCAGCTGAAATTGAGAACAACACCAATTCGCAGTATAAA
AAACCTACTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGTATTTT
GATTACCAACGAGACAGCATGTGACCTGTTTGGTTACACAGATGAAGAAT
TATGTGGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGGATGGT
GTGAAACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGAAATAT
TGTTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACA
TATTCATGGTGTCTGTATGGATGAAACGTATACAAGCAGGGAGTGATGTT
CGATGTGTGCTCATTATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTT
GTTTGATGCTGCtGGAACAATTTCAGATTGTGATTTCACTTTTGCACTTT
TGCATGGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTGACACG
TTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGA
CATCAAAAAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCC
CCTCAACAATCAAAGTCAGAATTCATGACCCGGAATTCCATCAGCTTTAC
ATGGAACGAACAGCAGAAAACAAACGTCAAATGTCTAAATTCTTATACAA
AGGCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACCATCGATA
ATAAAGGTCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTG
GGATATTTTGAAAGTGAACTAATGGGAAAGGAAATCACAACGCTGATACC
TTACTTTTACGAACAAATCGACATGCTTCATCATGGTTCCATCCCTCAAA
CACCATCATCTTCAATTAAGCGTAATAAACATGGTTCATGTAAAAAGGAT
GATCTGGTTATCGAATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGG
TCTCGATGATACAGATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACG
ACAGTGGAATAAATGACGAATCGGAAAGCCTGAACGATCAAAGCACACCT
CTTAAAGACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAGAAGAACA
TCTCGATAGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTGAATAATC
AAGACACGCCTTTGAAAGACGAATGTTTGGATAACACAGGAACACCTCTT
AATGATGAGATTTGCACTAATAAGTTGAATAATTGCGTCAGCCATCAGGC
GAATAAGAAGGACAAACTCGATGGATTTTCACCTCATACCATAAGTACAC
CTGTCTCAGATGAGAAGAGAGAAACGAACATTGATAGAATTGAGGGGAAA
TTAACTGACCAGATTACCGAAAAACAAAAACTGGACTTTGGTCAAAATGA
TCGCGAAGAATCTTTGCGTAAGACAGATATTGTTTTTACGGATCCTgtta
aaattaaagatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACT
GTTTCTAGGGACGTTTTGCAacacaaacaaatcaaaacgAGTGACTATGA
GTCTTTGAGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAA
ATACTGAATTATGTAATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCA
ACGTCTCAGAATTTTACAGCATCAGAACAGAGTGGACTCTCTGAtcttgt
ttttgaggactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGA
GTAAAATTTACCCTGGACAATATTACGGGCAAGCGAGACACAAAGATGGT
TCAATGTTACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAA
GAACAAAGACAACAACAACGGACAACTCTTTTGTCTTTGGATGTCACGTG
ATCCCGATGAAGAAACCGAAACTTACGGTACCGAAAAGCACAAACAATTG
TTAGCAAGTTTCAACAGTACAATGACTATATCGACGGGTAATTTCCAGGA
GATGCTGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTCTGGTC
TTTATAACGATAAATTTAACACCGCACGATGTATTGGAAAAGGCGCTTTC
GGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGT
CAAATTCATACgtaaagaaaaagttttgaaagacaGTTGGATTGATGATG
CAAGCATTGGTCGCACACCTTACGAAGTTCATTTACTAAGCAAACTACAG
CATCCTAATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATTGTTACGT
TCATATGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTCGAATTCA
TCGATCGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGG
CAGGTGTTATCAGCCACAGATTAtcttcatcaaaacaaaatcttACATCG
TGATATTAAGGACGAAAACATTATAGTTGATCGATCGTTTCATTTGAAAC
TCATCGACTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATATTTCACG
ACCTTCTGCGGTACCATCGAATATTGCTCACCCGAAGTACTGCTCGGAAA
TTCATACCGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGT
ATACGTTTATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATC
AGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAAAA
TAGaggaaataaattaaataaaactacaTACAAGATGAAAGCAACAAATT
TATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAGAAA
AATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAGTTT
TGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACGCG
CAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAACAA
GCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATATCAAA
GAGCAGtcataaatATGATTTGTCTAAGTCATACCACAGTATCAGCTACT
GCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGCACAACAT
TCCTTGAATGCTTCAtggcaattttttaattttatgggTGGATCAGCTGA
AATTGAGAACAACACCAATTCGCAGTATAAAAAACCTACTCAAGCTATAG
TCACCATCAATGCAAGGACATCTCGTATTTTGATTACCAACGAGACAGCA
TGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCACATGAA
AGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGTTTTGA
TTGAACAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAGGGAAA
GTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCTGTATG
GATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGG
AACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAACA
ATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAAGATCC
TCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTTTCAAT
TACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGCGTC
ACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAG
AATTCATGACCCGGAATTCCATCAGCTTTACATGGAACGAACAGCAGAAA
ACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTT
TCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTGACGAG
TTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAAC
TAATGGGAAAGGAAATCACAACGCTGATACCTTACTTTTACGAACAAATC
GACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCAATTAA
GCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGAATGCC
TCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAGATCTT
GAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAATGACGA
ATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCGTTTGA
ATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAGGCACG
CCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTGAAAGA
CGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTGCACTA
ATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAACTC
GATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAGAAGAG
AGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGATTACCG
AAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTTTGCGT
AAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatggtgCTGT
TGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTTTGC
AacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCTATT
GTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGTAATGA
ACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTACAG
CATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactgtaaAAAA
GAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCTGGACA
ATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGATTTTGT
TTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACAACAAC
GGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAAACCGA
AACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAACAGTA
CAATGACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAATACAA
GATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAATTTAA
CACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAG
AAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTCATACgtaaagaa
aaagttttgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGCACACC
TTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGTTAAAG
TGCTTGAAGTATACGAGAACGATTGTTACGTTCATATGGTGATGGAGAAA
CACGGTGACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCACTCAT
GGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCACAG
ATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGACGAAAAC
ATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGC
TGCACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCATCG
AATATTGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGACCAGAA
CTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTTTATATTCGGTGA
ACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCCAC
CTTTCAAAGTGTCTAACGGTAATGGATAAAATAGaggaaataaattaaat
aaaactacaTACAAGATGAAAGCAACAAATTTATCAAACTCCATCAACAT
GTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAAGCTGTCA
ACATGTTGAGTATGATGAAAGATAAAAGTTTTGATCAACCATTGTTTGAA
GCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGATTGAGTGA
ATACGATCCAGCAGATTCCTCTTTGAAACAAGCTACCACTGATTCAATGT
CTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGtcataaatATGAT
TTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCATGTCCTGG
TAATATATCAACAAACAGTCCTGCACAACATTCCTTGAATGCTTCAtggc
aattttttaattttatgggTGGATCAGCTGAAATTGAGAACAACACCAAT
TCGCAGTATAAAAAACCTACTCAAGCTATAGTCACCATCAATGCAAGGAC
ATCTCGTATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGGTTACA
CAGATGAAGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGTTCACA
ATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATTGATAA
AGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAATA
AGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAACGTATACAAGCA
GGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGTTGATGTCAACAA
AGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGTGATTTCA
CTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTGGCAAA
AACATTGACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGT
GCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAGCCGTACAAAAGACT
TGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCCGGAATTC
CATCAGCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAATGTCTAA
ATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTTAA
TGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAATTTCTTG
AGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGGAAATCAC
AACGCTGATACCTTACTTTTACGAACAAATCGACATGCTTCATCATGGTT
CCATCCCTCAAACACCATCATCTTCAATTAAGCGTAATAAACATGGTTCA
TGTAAAAAGGATGATCTGGTTATCGAATGCCTCGATGGTCCGCCTGCTAC
AACAAAATGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAAATAAGAA
GCACGAAGAACGACAGTGGAATAAATGACGAATCGGAAAGCCTGAACGAT
CAAAGCACACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCACACCGTT
GCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCTTAGAGATGAGATAT
GTTTGAATAATCAAGACACGCCTTTGAAAGACGAATGTTTGGATAACACA
GGAACACCTCTTAATGATGAGATTTGCACTAATAAGTTGAATAATTGCGT
CAGCCATCAGGCGAATAAGAAGGACAAACTCGATGGATTTTCACCTCATA
CCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAACGAACATTGATAGA
ATTGAGGGGAAATTAACTGACCAGATTACCGAAAAACAAAAACTGGACTT
TGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGACAGATATTGTTTTTA
CGGATCCTgttaaaattaaagatggtgCTGTTGTTAAGGACGCTTTTGTT
GCCAAGGATACTGTTTCTAGGGACGTTTTGCAacacaaacaaatcaaaac
gAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTTTTGTCTC
GGTTATCCAAAAATACTGAATTATGTAATGAACAGAAAACACGAGTTTGT
GCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCAGAACAGAGTGGACT
CTCTGAtcttgtttttgaggactgtaaAAAAGAGATTTTAGAGAAAGATA
AAGGTGATTTGAGTAAAATTTACCCTGGACAATATTACGGGCAAGCGAGA
CACAAAGATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGAAATGGTC
AAGTAAAAGCAAGAACAAAGACAACAACAACGGACAACTCTTTTGTCTTT
GGATGTCACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCGAAAAG
CACAAACAATTGTTAGCAAGTTTCAACAGTACAATGACTATATCGACGGG
TAATTTCCAGGAGATGCTGAAAGAAATACAAGATATGAAACTAGAAGATC
CTGGGTCTGGTCTTTATAACGATAAATTTAACACCGCACGATGTATTGGA
AAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGA
ACAGGTTGTGGTCAAATTCATACgtaaagaaaaagttttgaaagacaGTT
GGATTGATGATGCAAGCATTGGTCGCACACCTTACGAAGTTCATTTACTA
AGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTATACGAGAA
CGATTGTTACGTTCATATGGTGATGGAGAAACACGGTGACGGAATTGATC
TGTTCGAATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGGCTAGT
TACATGTTTCGGCAGGTGTTATCAGCCACAGATTAtcttcatcaaaacaa
aatcttACATCGTGATATTAAGGACGAAAACATTATAGTTGATCGATCGT
TTCATTTGAAACTCATCGACTTCGGTTCAGCTGCACCATTAGAAAAAGAT
AAATATTTCACGACCTTCTGCGGTACCATCGAATATTGCTCACCCGAAGT
ACTGCTCGGAAATTCATACCGTGGACCAGAACTTGAAATGTGGTCATTGG
GAGTCACACTGTATACGTTTATATTCGGTGAACATCCATTCTTTGAAGTT
GAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAACGG
TAATGGATAAAATAGaggaaataaattaaataaaactacaTACAAGATGA
AAGCAACAAATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCAT
TTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAA
AGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAA
TGGAAGAACGCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCC
TCTTTGAAACAAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTC
TACAATATCAAAGAGCAGtcataaatATGATTTGTCTAAGTCATACCACA
GTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGT
CCTGCACAACATTCCTTGAATGCTTCAtggcaattttttaattttatggg
TGGATCAGCTGAAATTGAGAACAACACCAATTCGCAGTATAAAAAACCTA
CTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGTATTTTGATTACC
AACGAGACAGCATGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGG
CAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAAC
AGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGAAATATTGTTATG
GTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCAT
GGTGTCTGTATGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTG
TGCTCATTATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGAT
GCTGCtGGAACAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGG
TTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCC
CTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAA
AAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAAC
AATCAAAGTCAGAATTCATGACCCGGAATTCCATCAGCTTTACATGGAAC
GAACAGCAGAAAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTC
TTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGG
TCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATT
TTGAAAGTGAACTAATGGGAAAGGAAATCACAACGCTGATACCTTACTTT
TACGAACAAATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATC
ATCTTCAATTAAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGG
TTATCGAATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGAT
GATACAGATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGG
AATAAATGACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAG
ACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGAT
AGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACAC
GCCTTTGAAAGACGAATGTTTGGATAACACAGGAACACCTCTTAATGATG
AGATTTGCACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAG
AAGGACAAACTCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTC
AGATGAGAAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTG
ACCAGATTACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAA
GAATCTTTGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaa
agatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTA
GGGACGTTTTGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTG
AGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGA
ATTATGTAATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTC
AGAATTTTACAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgag
gactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAAT
TTACCCTGGACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGT
TACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAA
GACAACAACAACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGA
TGAAGAAACCGAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAA
GTTTCAACAGTACAATGACTATATCGACGGGTAATTTCCAGGAGATGCTG
AAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAA
CGATAAATTTAACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTG
TTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTC
ATACgtaaagaaaaagttttgaaagacaGTTGGATTGATGATGCAAGCAT
TGGTCGCACACCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTA
ATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATATG
GTGATGGAGAAACACGGTGACGGAATTGATCTGTTCGAATTCATCGATCG
AAAACCACTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGT
TATCAGCCACAGATTAtcttcatcaaaacaaaatcttACATCGTGATATT
AAGGACGAAAACATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGA
CTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATATTTCACGACCTTCT
GCGGTACCATCGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCATAC
CGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTT
TATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGG
AGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAAAATAGagga
aataaattaaataaaactacaTACAAGATGAAAGCAACAAATTTATCAAA
CTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGACG
AGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAAAGTTTTGATCAA
CCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGATC
AAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGAAACAAGCTACCA
CTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGt
cataaatATGATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAG
TCCATGTCCTGGTAATATATCAACAAACAGTCCTGCACAACATTCCTTGA
ATGCTTCAtggcaattttttaattttatgggTGGATCAGCTGAAATTGAG
AACAACACCAATTCGCAGTATAAAAAACCTACTCAAGCTATAGTCACCAT
CAATGCAAGGACATCTCGTATTTTGATTACCAACGAGACAGCATGTGACC
TGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCACATGAAAGTATCT
CAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAACA
GAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTTAG
AAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAA
CGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGT
TGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTCAG
ATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAGAT
CTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTTTCAATTACCATC
ACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAGCC
GTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCAT
GACCCGGAATTCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAACG
TCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACG
TTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAAT
GAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGG
AAAGGAAATCACAACGCTGATACCTTACTTTTACGAACAAATCGACATGC
TTCATCATGGTTCCATCCCTCAAACACCATCATCTTCAATTAAGCGTAAT
AAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGAATGCCTCGATGG
TCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAGATCTTGAAGAAG
GCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAATGACGAATCGGAA
AGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCGTTTGAATAACAG
AGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCTTA
GAGATGAGATATGTTTGAATAATCAAGACACGCCTTTGAAAGACGAATGT
TTGGATAACACAGGAACACCTCTTAATGATGAGATTTGCACTAATAAGTT
GAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACAAACTCGATGGAT
TTTCACCTCATACCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAACG
AACATTGATAGAATTGAGGGGAAATTAACTGACCAGATTACCGAAAAACA
AAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGACAG
ATATTGTTTTTACGGATCCTgttaaaattaaagatggtgCTGTTGTTAAG
GACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGTTTTGCAacacaa
acaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGACG
ATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGTAATGAACAGAAA
ACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCAGA
ACAGAGTGGACTCTCTGAtcttgtttttgaggactgtaaAAAAGAGATTT
TAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCTGGACAATATTAC
GGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGATTTTGTTTGAGAT
CAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACAACAACGGACAAC
TCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAAACCGAAACTTAC
GGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAACAGTACAATGAC
TATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAATACAAGATATGA
AACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAATTTAACACCGCA
CGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAA
ATCTGATAACGAACAGGTTGTGGTCAAATTCATACgtaaagaaaaagttt
tgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGCACACCTTACGAA
GTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTTGA
AGTATACGAGAACGATTGTTACGTTCATATGGTGATGGAGAAACACGGTG
ACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCACTCATGGATGAA
GCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGCCACAGATTAtct
tcatcaaaacaaaatcttACATCGTGATATTAAGGACGAAAACATTATAG
TTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGCACCA
TTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTACCATCGAATATTG
CTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGACCAGAACTTGAAA
TGTGGTCATTGGGAGTCACACTGTATACGTTTATATTCGGTGAACATCCA
TTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTCAA
AGTGTCTAACGGTAATGGATAAAATAGaggaaataaattaaataaaacta
caTACAAGATGAAAGCAACAAATTTATCAAACTCCATCAACATGTCATCG
CCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATGTT
GAGTATGATGAAAGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGAGA
AAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGATTGAGTGAATACGAT
CCAGCAGATTCCTCTTTGAAACAAGCTACCACTGATTCAATGTCTTCTAA
ATCTAACCTCTCTACAATATCAAAGAGCAGtcataaatATGATTTGTCTA
AGTCATACCACAGTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATATA
TCAACAAACAGTCCTGCACAACATTCCTTGAATGCTTCAtggcaattttt
taattttatgggTGGATCAGCTGAAATTGAGAACAACACCAATTCGCAGT
ATAAAAAACCTACTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGT
ATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGGTTACACAGATGA
AGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGG
ATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGA
AATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAAGG
AGACATATTCATGGTGTCTGTATGGATGAAACGTATACAAGCAGGGAGTG
ATGTTCGATGTGTGCTCATTATGGAACCTGTTGATGTCAACAAAGGAAGC
TTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGTGATTTCACTTTTGC
ACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTG
ACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCA
AAGGACATCAAAAAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTTCC
ATTCCCCTCAACAATCAAAGTCAGAATTCATGACCCGGAATTCCATCAGC
TTTACATGGAACGAACAGCAGAAAACAAACGTCAAATGTCTAAATTCTTA
TACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACCAT
CGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAATCT
TTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGGAAATCACAACGCTG
ATACCTTACTTTTACGAACAAATCGACATGCTTCATCATGGTTCCATCCC
TCAAACACCATCATCTTCAATTAAGCGTAATAAACATGGTTCATGTAAAA
AGGATGATCTGGTTATCGAATGCCTCGATGGTCCGCCTGCTACAACAAAA
TGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAAATAAGAAGCACGAA
GAACGACAGTGGAATAAATGACGAATCGGAAAGCCTGAACGATCAAAGCA
CACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAGAA
GAACATCTCGATAGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTGAA
TAATCAAGACACGCCTTTGAAAGACGAATGTTTGGATAACACAGGAACAC
CTCTTAATGATGAGATTTGCACTAATAAGTTGAATAATTGCGTCAGCCAT
CAGGCGAATAAGAAGGACAAACTCGATGGATTTTCACCTCATACCATAAG
TACACCTGTCTCAGATGAGAAGAGAGAAACGAACATTGATAGAATTGAGG
GGAAATTAACTGACCAGATTACCGAAAAACAAAAACTGGACTTTGGTCAA
AATGATCGCGAAGAATCTTTGCGTAAGACAGATATTGTTTTTACGGATCC
TgttaaaattaaagatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGG
ATACTGTTTCTAGGGACGTTTTGCAacacaaacaaatcaaaacgAGTGAC
TATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTATC
CAAAAATACTGAATTATGTAATGAACAGAAAACACGAGTTTGTGCCAGCA
AGGCAACGTCTCAGAATTTTACAGCATCAGAACAGAGTGGACTCTCTGAt
cttgtttttgaggactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGTGA
TTTGAGTAAAATTTACCCTGGACAATATTACGGGCAAGCGAGACACAAAG
ATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTAAA
AGCAAGAACAAAGACAACAACAACGGACAACTCTTTTGTCTTTGGATGTC
ACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCGAAAAGCACAAAC
AATTGTTAGCAAGTTTCAACAGTACAATGACTATATCGACGGGTAATTTC
CAGGAGATGCTGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTC
TGGTCTTTATAACGATAAATTTAACACCGCACGATGTATTGGAAAAGGCG
CTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGTT
GTGGTCAAATTCATACgtaaagaaaaagttttgaaagacaGTTGGATTGA
TGATGCAAGCATTGGTCGCACACCTTACGAAGTTCATTTACTAAGCAAAC
TACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATTGT
TACGTTCATATGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTCGA
ATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACATGT
TTCGGCAGGTGTTATCAGCCACAGATTAtcttcatcaaaacaaaatcttA
CATCGTGATATTAAGGACGAAAACATTATAGTTGATCGATCGTTTCATTT
GAAACTCATCGACTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATATT
TCACGACCTTCTGCGGTACCATCGAATATTGCTCACCCGAAGTACTGCTC
GGAAATTCATACCGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCAC
ACTGTATACGTTTATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATT
CCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGA
TAAAATAGaggaaataaattaaataaaactacaTACAAGATGAAAGCAAC
AAATTTATCAAACTCCATCAACATGTCATCGCCTTTGCATCATTTTCGAG
AGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTATGATGAAAGATAAA
AGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCAAGAAATGGAAGA
ACGCGCAAGATCAAGATTGAGTGAATACGATCCAGCAGATTCCTCTTTGA
AACAAGCTACCACTGATTCAATGTCTTCTAAATCTAACCTCTCTACAATA
TCAAAGAGCAGtcataaatATGATTTGTCTAAGTCATACCACAGTATCAG
CTACTGCGCAAGTCCATGTCCTGGTAATATATCAACAAACAGTCCTGCAC
AACATTCCTTGAATGCTTCAtggcaattttttaattttatgggTGGATCA
GCTGAAATTGAGAACAACACCAATTCGCAGTATAAAAAACCTACTCAAGC
TATAGTCACCATCAATGCAAGGACATCTCGTATTTTGATTACCAACGAGA
CAGCATGTGACCTGTTTGGTTACACAGATGAAGAATTATGTGGCAAGCAC
ATGAAAGTATCTCAACTGTTCACAATGGAGGATGGTGTGAAACAGAATGT
TTTGATTGAACAGAATATTGATAAAGAAGGAAATATTGTTATGGTTTCAG
GGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATATTCATGGTGTCT
GTATGGATGAAACGTATACAAGCAGGGAGTGATGTTCGATGTGTGCTCAT
TATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGTTTGATGCTGCtG
GAACAATTTCAGATTGTGATTTCACTTTTGCACTTTTGCATGGTTATGAA
GATCCTCAAGATCTGATTGGCAAAAACATTGACACGTTTGTCCCTTCCTT
TCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGACATCAAAAAGCAAC
GCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCCTCAACAATCAAA
GTCAGAATTCATGACCCGGAATTCCATCAGCTTTACATGGAACGAACAGC
AGAAAACAAACGTCAAATGTCTAAATTCTTATACAAAGGCTTCTTATGGG
TGTTTTCTAACGTTAGTGGTTTAATGACCATCGATAATAAAGGTCTGGTG
ACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGGATATTTTGAAAG
TGAACTAATGGGAAAGGAAATCACAACGCTGATACCTTACTTTTACGAAC
AAATCGACATGCTTCATCATGGTTCCATCCCTCAAACACCATCATCTTCA
ATTAAGCGTAATAAACATGGTTCATGTAAAAAGGATGATCTGGTTATCGA
ATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTCTCGATGATACAG
ATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGACAGTGGAATAAAT
GACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCTTAAAGACGAGCG
TTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATCTCGATAGTAGAG
GCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAAGACACGCCTTTG
AAAGACGAATGTTTGGATAACACAGGAACACCTCTTAATGATGAGATTTG
CACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGAATAAGAAGGACA
AACTCGATGGATTTTCACCTCATACCATAAGTACACCTGTCTCAGATGAG
AAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATTAACTGACCAGAT
TACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATCGCGAAGAATCTT
TGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaaattaaagatggt
gCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGTTTCTAGGGACGT
TTTGCAacacaaacaaatcaaaacgAGTGACTATGAGTCTTTGAGCTCGT
CTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAATACTGAATTATGT
AATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAACGTCTCAGAATTT
TACAGCATCAGAACAGAGTGGACTCTCTGAtcttgtttttgaggactgta
aAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGTAAAATTTACCCT
GGACAATATTACGGGCAAGCGAGACACAAAGATGGTTCAATGTTACCGAT
TTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGAACAAAGACAACA
ACAACGGACAACTCTTTTGTCTTTGGATGTCACGTGATCCCGATGAAGAA
ACCGAAACTTACGGTACCGAAAAGCACAAACAATTGTTAGCAAGTTTCAA
CAGTACAATGACTATATCGACGGGTAATTTCCAGGAGATGCTGAAAGAAA
TACAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTTTATAACGATAAA
TTTAACACCGCACGATGTATTGGAAAAGGCGCTTTCGGTTTTGTTAACCT
TGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCAAATTCATACgta
aagaaaaagttttgaaagacaGTTGGATTGATGATGCAAGCATTGGTCGC
ACACCTTACGAAGTTCATTTACTAAGCAAACTACAGCATCCTAATGTCGT
TAAAGTGCTTGAAGTATACGAGAACGATTGTTACGTTCATATGGTGATGG
AGAAACACGGTGACGGAATTGATCTGTTCGAATTCATCGATCGAAAACCA
CTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCAGGTGTTATCAGC
CACAGATTAtcttcatcaaaacaaaatcttACATCGTGATATTAAGGACG
AAAACATTATAGTTGATCGATCGTTTCATTTGAAACTCATCGACTTCGGT
TCAGCTGCACCATTAGAAAAAGATAAATATTTCACGACCTTCTGCGGTAC
CATCGAATATTGCTCACCCGAAGTACTGCTCGGAAATTCATACCGTGGAC
CAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTATACGTTTATATTC
GGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAGAGCGGAGTTGTT
CCCACCTTTCAAAGTGTCTAACGGTAATGGATAAAATAGaggaaataaat
taaataaaactacaTACAAGATGAAAGCAACAAATTTATCAAACTCCATC
AACATGTCATCGCCTTTGCATCATTTTCGAGAGAAAAATGACGAGAAAGC
TGTCAACATGTTGAGTATGATGAAAGATAAAAGTTTTGATCAACCATTGT
TTGAAGCAGAGAAAGTCCAAGAAATGGAAGAACGCGCAAGATCAAGATTG
AGTGAATACGATCCAGCAGATTCCTCTTTGAAACAAGCTACCACTGATTC
AATGTCTTCTAAATCTAACCTCTCTACAATATCAAAGAGCAGtcataaat
ATGATTTGTCTAAGTCATACCACAGTATCAGCTACTGCGCAAGTCCATGT
CCTGGTAATATATCAACAAACAGTCCTGCACAACATTCCTTGAATGCTTC
AtggcaattttttaattttatgggTGGATCAGCTGAAATTGAGAACAACA
CCAATTCGCAGTATAAAAAACCTACTCAAGCTATAGTCACCATCAATGCA
AGGACATCTCGTATTTTGATTACCAACGAGACAGCATGTGACCTGTTTGG
TTACACAGATGAAGAATTATGTGGCAAGCACATGAAAGTATCTCAACTGT
TCACAATGGAGGATGGTGTGAAACAGAATGTTTTGATTGAACAGAATATT
GATAAAGAAGGAAATATTGTTATGGTTTCAGGGAAAGTGTTAGAAGCCAC
CAATAAGAAAGGAGACATATTCATGGTGTCTGTATGGATGAAACGTATAC
AAGCAGGGAGTGATGTTCGATGTGTGCTCATTATGGAACCTGTTGATGTC
AACAAAGGAAGCTTCTTGTTTGATGCTGCtGGAACAATTTCAGATTGTGA
TTTCACTTTTGCACTTTTGCATGGTTATGAAGATCCTCAAGATCTGATTG
GCAAAAACATTGACACGTTTGTCCCTTCCTTTCAATTACCATCACCTGGT
CAAGTGCTTTCAAAGGACATCAAAAAGCAACGCGTCACAAGCCGTACAAA
AGACTTGGTTCCATTCCCCTCAACAATCAAAGTCAGAATTCATGACCCGG
AATTCCATCAGCTTTACATGGAACGAACAGCAGAAAACAAACGTCAAATG
TCTAAATTCTTATACAAAGGCTTCTTATGGGTGTTTTCTAACGTTAGTGG
TTTAATGACCATCGATAATAAAGGTCTGGTGACGAGTTGTAATGAGAATT
TCTTGAGAATCTTTTTGGGATATTTTGAAAGTGAACTAATGGGAAAGGAA
ATCACAACGCTGATACCTTACTTTTACGAACAAATCGACATGCTTCATCA
TGGTTCCATCCCTCAAACACCATCATCTTCAATTAAGCGTAATAAACATG
GTTCATGTAAAAAGGATGATCTGGTTATCGAATGCCTCGATGGTCCGCCT
GCTACAACAAAATGTGGTCTCGATGATACAGATCTTGAAGAAGGCGAAAT
AAGAAGCACGAAGAACGACAGTGGAATAAATGACGAATCGGAAAGCCTGA
ACGATCAAAGCACACCTCTTAAAGACGAGCGTTTGAATAACAGAGGCACA
CCGTTGCAAGAAGAACATCTCGATAGTAGAGGCACGCCTCTTAGAGATGA
GATATGTTTGAATAATCAAGACACGCCTTTGAAAGACGAATGTTTGGATA
ACACAGGAACACCTCTTAATGATGAGATTTGCACTAATAAGTTGAATAAT
TGCGTCAGCCATCAGGCGAATAAGAAGGACAAACTCGATGGATTTTCACC
TCATACCATAAGTACACCTGTCTCAGATGAGAAGAGAGAAACGAACATTG
ATAGAATTGAGGGGAAATTAACTGACCAGATTACCGAAAAACAAAAACTG
GACTTTGGTCAAAATGATCGCGAAGAATCTTTGCGTAAGACAGATATTGT
TTTTACGGATCCTgttaaaattaaagatggtgCTGTTGTTAAGGACGCTT
TTGTTGCCAAGGATACTGTTTCTAGGGACGTTTTGCAacacaaacaaatc
aaaacgAGTGACTATGAGTCTTTGAGCTCGTCTATTGTGGACGATGTTTT
GTCTCGGTTATCCAAAAATACTGAATTATGTAATGAACAGAAAACACGAG
TTTGTGCCAGCAAGGCAACGTCTCAGAATTTTACAGCATCAGAACAGAGT
GGACTCTCTGAtcttgtttttgaggactgtaaAAAAGAGATTTTAGAGAA
AGATAAAGGTGATTTGAGTAAAATTTACCCTGGACAATATTACGGGCAAG
CGAGACACAAAGATGGTTCAATGTTACCGATTTTGTTTGAGATCAAGAAA
TGGTCAAGTAAAAGCAAGAACAAAGACAACAACAACGGACAACTCTTTTG
TCTTTGGATGTCACGTGATCCCGATGAAGAAACCGAAACTTACGGTACCG
AAAAGCACAAACAATTGTTAGCAAGTTTCAACAGTACAATGACTATATCG
ACGGGTAATTTCCAGGAGATGCTGAAAGAAATACAAGATATGAAACTAGA
AGATCCTGGGTCTGGTCTTTATAACGATAAATTTAACACCGCACGATGTA
TTGGAAAAGGCGCTTTCGGTTTTGTTAACCTTGCAGAAAGAAAATCTGAT
AACGAACAGGTTGTGGTCAAATTCATACgtaaagaaaaagttttgaaaga
caGTTGGATTGATGATGCAAGCATTGGTCGCACACCTTACGAAGTTCATT
TACTAAGCAAACTACAGCATCCTAATGTCGTTAAAGTGCTTGAAGTATAC
GAGAACGATTGTTACGTTCATATGGTGATGGAGAAACACGGTGACGGAAT
TGATCTGTTCGAATTCATCGATCGAAAACCACTCATGGATGAAGCTTTGG
CTAGTTACATGTTTCGGCAGGTGTTATCAGCCACAGATTAtcttcatcaa
aacaaaatcttACATCGTGATATTAAGGACGAAAACATTATAGTTGATCG
ATCGTTTCATTTGAAACTCATCGACTTCGGTTCAGCTGCACCATTAGAAA
AAGATAAATATTTCACGACCTTCTGCGGTACCATCGAATATTGCTCACCC
GAAGTACTGCTCGGAAATTCATACCGTGGACCAGAACTTGAAATGTGGTC
ATTGGGAGTCACACTGTATACGTTTATATTCGGTGAACATCCATTCTTTG
AAGTTGAAGATTCCATCAGAGCGGAGTTGTTCCCACCTTTCAAAGTGTCT
AACGGTAATGGATAAAATAGaggaaataaattaaataaaactacaTACAA
GATGAAAGCAACAAATTTATCAAACTCCATCAACATGTCATCGCCTTTGC
ATCATTTTCGAGAGAAAAATGACGAGAAAGCTGTCAACATGTTGAGTATG
ATGAAAGATAAAAGTTTTGATCAACCATTGTTTGAAGCAGAGAAAGTCCA
AGAAATGGAAGAACGCGCAAGATCAAGATTGAGTGAATACGATCCAGCAG
ATTCCTCTTTGAAACAAGCTACCACTGATTCAATGTCTTCTAAATCTAAC
CTCTCTACAATATCAAAGAGCAGtcataaatATGATTTGTCTAAGTCATA
CCACAGTATCAGCTACTGCGCAAGTCCATGTCCTGGTAATATATCAACAA
ACAGTCCTGCACAACATTCCTTGAATGCTTCAtggcaattttttaatttt
atgggTGGATCAGCTGAAATTGAGAACAACACCAATTCGCAGTATAAAAA
ACCTACTCAAGCTATAGTCACCATCAATGCAAGGACATCTCGTATTTTGA
TTACCAACGAGACAGCATGTGACCTGTTTGGTTACACAGATGAAGAATTA
TGTGGCAAGCACATGAAAGTATCTCAACTGTTCACAATGGAGGATGGTGT
GAAACAGAATGTTTTGATTGAACAGAATATTGATAAAGAAGGAAATATTG
TTATGGTTTCAGGGAAAGTGTTAGAAGCCACCAATAAGAAAGGAGACATA
TTCATGGTGTCTGTATGGATGAAACGTATACAAGCAGGGAGTGATGTTCG
ATGTGTGCTCATTATGGAACCTGTTGATGTCAACAAAGGAAGCTTCTTGT
TTGATGCTGCtGGAACAATTTCAGATTGTGATTTCACTTTTGCACTTTTG
CATGGTTATGAAGATCCTCAAGATCTGATTGGCAAAAACATTGACACGTT
TGTCCCTTCCTTTCAATTACCATCACCTGGTCAAGTGCTTTCAAAGGACA
TCAAAAAGCAACGCGTCACAAGCCGTACAAAAGACTTGGTTCCATTCCCC
TCAACAATCAAAGTCAGAATTCATGACCCGGAATTCCATCAGCTTTACAT
GGAACGAACAGCAGAAAACAAACGTCAAATGTCTAAATTCTTATACAAAG
GCTTCTTATGGGTGTTTTCTAACGTTAGTGGTTTAATGACCATCGATAAT
AAAGGTCTGGTGACGAGTTGTAATGAGAATTTCTTGAGAATCTTTTTGGG
ATATTTTGAAAGTGAACTAATGGGAAAGGAAATCACAACGCTGATACCTT
ACTTTTACGAACAAATCGACATGCTTCATCATGGTTCCATCCCTCAAACA
CCATCATCTTCAATTAAGCGTAATAAACATGGTTCATGTAAAAAGGATGA
TCTGGTTATCGAATGCCTCGATGGTCCGCCTGCTACAACAAAATGTGGTC
TCGATGATACAGATCTTGAAGAAGGCGAAATAAGAAGCACGAAGAACGAC
AGTGGAATAAATGACGAATCGGAAAGCCTGAACGATCAAAGCACACCTCT
TAAAGACGAGCGTTTGAATAACAGAGGCACACCGTTGCAAGAAGAACATC
TCGATAGTAGAGGCACGCCTCTTAGAGATGAGATATGTTTGAATAATCAA
GACACGCCTTTGAAAGACGAATGTTTGGATAACACAGGAACACCTCTTAA
TGATGAGATTTGCACTAATAAGTTGAATAATTGCGTCAGCCATCAGGCGA
ATAAGAAGGACAAACTCGATGGATTTTCACCTCATACCATAAGTACACCT
GTCTCAGATGAGAAGAGAGAAACGAACATTGATAGAATTGAGGGGAAATT
AACTGACCAGATTACCGAAAAACAAAAACTGGACTTTGGTCAAAATGATC
GCGAAGAATCTTTGCGTAAGACAGATATTGTTTTTACGGATCCTgttaaa
attaaagatggtgCTGTTGTTAAGGACGCTTTTGTTGCCAAGGATACTGT
TTCTAGGGACGTTTTGCAacacaaacaaatcaaaacgAGTGACTATGAGT
CTTTGAGCTCGTCTATTGTGGACGATGTTTTGTCTCGGTTATCCAAAAAT
ACTGAATTATGTAATGAACAGAAAACACGAGTTTGTGCCAGCAAGGCAAC
GTCTCAGAATTTTACAGCATCAGAACAGAGTGGACTCTCTGAtcttgttt
ttgaggactgtaaAAAAGAGATTTTAGAGAAAGATAAAGGTGATTTGAGT
AAAATTTACCCTGGACAATATTACGGGCAAGCGAGACACAAAGATGGTTC
AATGTTACCGATTTTGTTTGAGATCAAGAAATGGTCAAGTAAAAGCAAGA
ACAAAGACAACAACAACGGACAACTCTTTTGTCTTTGGATGTCACGTGAT
CCCGATGAAGAAACCGAAACTTACGGTACCGAAAAGCACAAACAATTGTT
AGCAAGTTTCAACAGTACAATGACTATATCGACGGGTAATTTCCAGGAGA
TGCTGAAAGAAATACAAGATATGAAACTAGAAGATCCTGGGTCTGGTCTT
TATAACGATAAATTTAACACCGCACGATGTATTGGAAAAGGCGCTTTCGG
TTTTGTTAACCTTGCAGAAAGAAAATCTGATAACGAACAGGTTGTGGTCA
AATTCATACgtaaagaaaaagttttgaaagacaGTTGGATTGATGATGCA
AGCATTGGTCGCACACCTTACGAAGTTCATTTACTAAGCAAACTACAGCA
TCCTAATGTCGTTAAAGTGCTTGAAGTATACGAGAACGATTGTTACGTTC
ATATGGTGATGGAGAAACACGGTGACGGAATTGATCTGTTCGAATTCATC
GATCGAAAACCACTCATGGATGAAGCTTTGGCTAGTTACATGTTTCGGCA
GGTGTTATCAGCCACAGATTAtcttcatcaaaacaaaatcttACATCGTG
ATATTAAGGACGAAAACATTATAGTTGATCGATCGTTTCATTTGAAACTC
ATCGACTTCGGTTCAGCTGCACCATTAGAAAAAGATAAATATTTCACGAC
CTTCTGCGGTACCATCGAATATTGCTCACCCGAAGTACTGCTCGGAAATT
CATACCGTGGACCAGAACTTGAAATGTGGTCATTGGGAGTCACACTGTAT
ACGTTTATATTCGGTGAACATCCATTCTTTGAAGTTGAAGATTCCATCAG
AGCGGAGTTGTTCCCACCTTTCAAAGTGTCTAACGGTAATGGATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000011XLOC_000011Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000020-exon-sc0000001-1491911889:500943..501196TCONS_00000020-exon-sc0000001-1491911889:500943..501196Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:500943..501196TCONS_00000020-exon-sc0000001-1510915933:500943..501196Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:501884..501946TCONS_00000020-exon-sc0000001-1491911889:501884..501946Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:501884..501946TCONS_00000020-exon-sc0000001-1510915933:501884..501946Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:502495..502667TCONS_00000020-exon-sc0000001-1491911889:502495..502667Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:502495..502667TCONS_00000020-exon-sc0000001-1510915933:502495..502667Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:503704..503919TCONS_00000020-exon-sc0000001-1491911889:503704..503919Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:503704..503919TCONS_00000020-exon-sc0000001-1510915933:503704..503919Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:504586..504726TCONS_00000020-exon-sc0000001-1491911889:504586..504726Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:504586..504726TCONS_00000020-exon-sc0000001-1510915933:504586..504726Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:505111..505245TCONS_00000020-exon-sc0000001-1491911889:505111..505245Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:505111..505245TCONS_00000020-exon-sc0000001-1510915933:505111..505245Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:506010..506291TCONS_00000020-exon-sc0000001-1491911889:506010..506291Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:506010..506291TCONS_00000020-exon-sc0000001-1510915933:506010..506291Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:506859..506961TCONS_00000020-exon-sc0000001-1491911889:506859..506961Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:506859..506961TCONS_00000020-exon-sc0000001-1510915933:506859..506961Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:507862..508802TCONS_00000020-exon-sc0000001-1491911889:507862..508802Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:507862..508802TCONS_00000020-exon-sc0000001-1510915933:507862..508802Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:509828..510004TCONS_00000020-exon-sc0000001-1491911889:509828..510004Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:509828..510004TCONS_00000020-exon-sc0000001-1510915933:509828..510004Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:510648..510788TCONS_00000020-exon-sc0000001-1491911889:510648..510788Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:510648..510788TCONS_00000020-exon-sc0000001-1510915933:510648..510788Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:511856..511981TCONS_00000020-exon-sc0000001-1491911889:511856..511981Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:511856..511981TCONS_00000020-exon-sc0000001-1510915933:511856..511981Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:512768..512902TCONS_00000020-exon-sc0000001-1491911889:512768..512902Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:512768..512902TCONS_00000020-exon-sc0000001-1510915933:512768..512902Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:516330..516386TCONS_00000020-exon-sc0000001-1491911889:516330..516386Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:516330..516386TCONS_00000020-exon-sc0000001-1510915933:516330..516386Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:517581..517723TCONS_00000020-exon-sc0000001-1491911889:517581..517723Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:517581..517723TCONS_00000020-exon-sc0000001-1510915933:517581..517723Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1491911889:520089..520408TCONS_00000020-exon-sc0000001-1491911889:520089..520408Clytia hemisphaericaexon
TCONS_00000020-exon-sc0000001-1510915933:520089..520408TCONS_00000020-exon-sc0000001-1510915933:520089..520408Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000020-proteinTCONS_00000020-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:500943..520408 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.680766 1.1475e-06 0 0 0 1.4898e-10 0 0 1.50551 7.44059e-05 0.0934787 0 0.838315 0.829081 0.496337 0.602272 0 0.000482583 0 0 0.522597 0.00768 2.82215e-07 0 0.933558 2.63412 0.00169189 0 0.488399 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000014PAS
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00000020 vs. Swiss-Prot (Human)
Match: PASK (PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3)

HSP 1 Score: 318.931 bits (816), Expect = 1.820e-90
Identity = 163/351 (46.44%), Postives = 228/351 (64.96%), Query Frame = 2
Query: 2207 ILEKDKGDLSKIYPGQYYGQARHKDGSMLPILFEIXXXXXXXXXXXXXXGQLFCLWMSRDPDEETETYGTEKHKQLLASF----NSTMTISTG-NFQEMLKE-------IQDMKLEDPGS--GLYNDKFNTARCIGKGAFGFVNLAERKSDNEQVVVKFIRKEKVLKDSWIDDASIGRTPYEVHLLSKLQHPNVVKVLEVYENDCYVHMVMEKHGDGIDLFEFIDRKPLMDEALASYMFRQVLSATDYLHQNKILHRDIKDENIIVDRSFHLKLIDFGSAAPLEKDKYFTTFCGTIEYCSPEVLLGNSYRGPELEMWSLGVTLYTFIFGEHPFFEVEDSIRAELFPPFKVS 3217
            ++    G   +I  G Y G   H+DG  L I FE+++   +          LFC W+ +D    ++     + +  LAS     +ST    TG +  E+L+         + ++LE   +  G Y+ K++T   +G GAFGFV  A  K  N++VVVKFI+KEKVL+D WI+D  +G+   E+ +LS+++H N++KVL+++EN  +  +VMEKHG G+DLF FIDR P +DE LASY+FRQ++SA  YL    I+HRDIKDENI++   F +KLIDFGSAA LE+ K F TFCGTIEYC+PEVL+GN YRGPELEMWSLGVTLYT +F E+PF E+E+++ A + PP+ VS
Sbjct:  878 VMRGAAGLQREIQEGAYSGSCYHRDGLRLSIQFEVRRVELQGPT------PLFCCWLVKD-LLHSQRDSAARTRLFLASLPGSTHSTAAELTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVS 1221          

HSP 2 Score: 192.2 bits (487), Expect = 1.507e-49
Identity = 99/280 (35.36%), Postives = 163/280 (58.21%), Query Frame = 2
Query:  488 PTQAIVTINARTSRILITNETACDLFGYTDEELCGKHMKVSQLFTMEDGVKQNVLIEQNIDKEGNIVMVSGKVLEATNKKGDIFMVSVWMKRIQAGSDVRCVLIMEPVDVNKGSFLFDAAGTISDCDFTFALLHGYEDPQDLIGKNIDTFVPSFQLPSPGQVLSKDIKKQRVTSRTKDLVPFPSTIKVRIHDPEFHQLYMERTAENKRQMSKFLYKGFLWVFSNVSGLMTIDNKGLVTSCNENFLRIFLGYFESELMGKEITTLIPYFYEQIDMLHHGSI 1327
            P +AI T++A+T+ IL+ N+ AC L GY+ ++L G+  K++Q F   D      L E++++ +G+  +V G V++  ++ G+   VSVWMKR++    + CV+++EPV+       F + GT++ CD  FA LHGY   +D+ G++I   +PS QLP  GQ + K++K QR   R +D   FP ++K++   P       E T      +S   Y+  +WVF  +SGL+T+   G +   N +F     GY ++EL+GK IT LIP FY  +D+ ++ S+
Sbjct:  130 PNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQ--KLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSVGRARDGTTFPLSLKLK-SQPSSE----EATTGEAAPVSG--YRASVWVFCTISGLITLLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSL 400          
The following BLAST results are available for this feature:
BLAST of TCONS_00000020 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PASK1.820e-9046.44PAS domain-containing serine/threonine-protein kin... [more]
back to top