TCONS_00000020-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000020-protein
Unique NameTCONS_00000020-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1076

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000020-protein ID=TCONS_00000020-protein|Name=TCONS_00000020-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1076bp
NRGNKLNKTTYKMKATNLSNSINMSSPLHHFREKNDEKAVNMLSMMKDKS
FDQPLFEAEKVQEMEERARSRLSEYDPADSSLKQATTDSMSSKSNLSTIS
KSSHKYDLSKSYHSISYCASPCPGNISTNSPAQHSLNASWQFFNFMGGSA
EIENNTNSQYKKPTQAIVTINARTSRILITNETACDLFGYTDEELCGKHM
KVSQLFTMEDGVKQNVLIEQNIDKEGNIVMVSGKVLEATNKKGDIFMVSV
WMKRIQAGSDVRCVLIMEPVDVNKGSFLFDAAGTISDCDFTFALLHGYED
PQDLIGKNIDTFVPSFQLPSPGQVLSKDIKKQRVTSRTKDLVPFPSTIKV
RIHDPEFHQLYMERTAENKRQMSKFLYKGFLWVFSNVSGLMTIDNKGLVT
SCNENFLRIFLGYFESELMGKEITTLIPYFYEQIDMLHHGSIPQTPSSSI
KRNKHGSCKKDDLVIECLDGPPATTKCGLDDTDLEEGEIRSTKNDSGIND
ESESLNDQSTPLKDERLNNRGTPLQEEHLDSRGTPLRDEICLNNQDTPLK
DECLDNTGTPLNDEICTNKLNNCVSHQANKKDKLDGFSPHTISTPVSDEK
RETNIDRIEGKLTDQITEKQKLDFGQNDREESLRKTDIVFTDPVKIKDGA
VVKDAFVAKDTVSRDVLQHKQIKTSDYESLSSSIVDDVLSRLSKNTELCN
EQKTRVCASKATSQNFTASEQSGLSDLVFEDCKKEILEKDKGDLSKIYPG
QYYGQARHKDGSMLPILFEIKKWSSKSKNKDNNNGQLFCLWMSRDPDEET
ETYGTEKHKQLLASFNSTMTISTGNFQEMLKEIQDMKLEDPGSGLYNDKF
NTARCIGKGAFGFVNLAERKSDNEQVVVKFIRKEKVLKDSWIDDASIGRT
PYEVHLLSKLQHPNVVKVLEVYENDCYVHMVMEKHGDGIDLFEFIDRKPL
MDEALASYMFRQVLSATDYLHQNKILHRDIKDENIIVDRSFHLKLIDFGS
AAPLEKDKYFTTFCGTIEYCSPEVLLGNSYRGPELEMWSLGVTLYTFIFG
EHPFFEVEDSIRAELFPPFKVSNGNG
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000020TCONS_00000020Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000014PAS
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 850..1069
e-value: 6.5E-46
score: 168.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 851..1059
e-value: 2.7E-54
score: 184.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 850..1076
score: 40.244
IPR000014PAS domainSMARTSM00091pas_2coord: 154..223
e-value: 0.22
score: 20.6
coord: 377..444
e-value: 6.2
score: 12.9
IPR000014PAS domainPFAMPF13426PAS_9coord: 167..267
e-value: 1.6E-4
score: 21.8
coord: 390..435
e-value: 0.0063
score: 16.7
IPR000014PAS domainTIGRFAMTIGR00229TIGR00229coord: 172..266
e-value: 1.7E-8
score: 32.6
IPR000014PAS domainPROSITEPS50112PAScoord: 167..225
score: 10.361
IPR000014PAS domainCDDcd00130PAScoord: 166..270
e-value: 7.05886E-6
score: 44.5463
IPR000014PAS domainCDDcd00130PAScoord: 389..445
e-value: 3.85803E-4
score: 39.1535
IPR000014PAS domainSUPERFAMILY55785PYP-like sensor domain (PAS domain)coord: 165..265
NoneNo IPR availableGENE3D3.30.450.20coord: 381..802
e-value: 2.7E-5
score: 23.4
coord: 272..342
e-value: 0.0047
score: 16.2
NoneNo IPR availableGENE3D1.10.510.10coord: 923..1065
e-value: 2.9E-48
score: 164.0
NoneNo IPR availableGENE3D3.30.450.20coord: 80..271
e-value: 6.4E-6
score: 25.8
NoneNo IPR availableGENE3D3.30.200.20coord: 823..922
e-value: 1.9E-18
score: 65.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 476..532
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..97
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 856..883
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 975..987
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 846..1057

Blast
BLAST of TCONS_00000020-protein vs. Swiss-Prot (Human)
Match: PASK (PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3)

HSP 1 Score: 323.553 bits (828), Expect = 8.702e-93
Identity = 163/352 (46.31%), Postives = 224/352 (63.64%), Query Frame = 0
Query:  736 ILEKDKGDLSKIYPGQYYGQARHKDGSMLPILFEIKKWSSKSKNKDNNNGQLFCLWMSRDPDEETETYGTEKHKQLLASF----NSTMTISTGN-----------FQEMLKEIQDMKLEDPGSGLYNDKFNTARCIGKGAFGFVNLAERKSDNEQVVVKFIRKEKVLKDSWIDDASIGRTPYEVHLLSKLQHPNVVKVLEVYENDCYVHMVMEKHGDGIDLFEFIDRKPLMDEALASYMFRQVLSATDYLHQNKILHRDIKDENIIVDRSFHLKLIDFGSAAPLEKDKYFTTFCGTIEYCSPEVLLGNSYRGPELEMWSLGVTLYTFIFGEHPFFEVEDSIRAELFPPFKVS 1072
            ++    G   +I  G Y G   H+DG  L I FE+++   +          LFC W+ +D    ++     + +  LAS     +ST    TG            F+E  K ++   L     G Y+ K++T   +G GAFGFV  A  K  N++VVVKFI+KEKVL+D WI+D  +G+   E+ +LS+++H N++KVL+++EN  +  +VMEKHG G+DLF FIDR P +DE LASY+FRQ++SA  YL    I+HRDIKDENI++   F +KLIDFGSAA LE+ K F TFCGTIEYC+PEVL+GN YRGPELEMWSLGVTLYT +F E+PF E+E+++ A + PP+ VS
Sbjct:  878 VMRGAAGLQREIQEGAYSGSCYHRDGLRLSIQFEVRRVELQGPTP------LFCCWLVKD-LLHSQRDSAARTRLFLASLPGSTHSTAAELTGPSLVEVLRARPWFEEPPKAVELEGLAA-CEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVS 1221          

HSP 2 Score: 192.2 bits (487), Expect = 1.238e-49
Identity = 99/280 (35.36%), Postives = 163/280 (58.21%), Query Frame = 0
Query:  163 PTQAIVTINARTSRILITNETACDLFGYTDEELCGKHMKVSQLFTMEDGVKQNVLIEQNIDKEGNIVMVSGKVLEATNKKGDIFMVSVWMKRIQAGSDVRCVLIMEPVDVNKGSFLFDAAGTISDCDFTFALLHGYEDPQDLIGKNIDTFVPSFQLPSPGQVLSKDIKKQRVTSRTKDLVPFPSTIKVRIHDPEFHQLYMERTAENKRQMSKFLYKGFLWVFSNVSGLMTIDNKGLVTSCNENFLRIFLGYFESELMGKEITTLIPYFYEQIDMLHHGSI 442
            P +AI T++A+T+ IL+ N+ AC L GY+ ++L G+  K++Q F   D      L E++++ +G+  +V G V++  ++ G+   VSVWMKR++    + CV+++EPV+       F + GT++ CD  FA LHGY   +D+ G++I   +PS QLP  GQ + K++K QR   R +D   FP ++K++   P       E T      +S   Y+  +WVF  +SGL+T+   G +   N +F     GY ++EL+GK IT LIP FY  +D+ ++ S+
Sbjct:  130 PNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQ--KLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSVGRARDGTTFPLSLKLK-SQPSSE----EATTGEAAPVSG--YRASVWVFCTISGLITLLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSL 400          
The following BLAST results are available for this feature:
BLAST of TCONS_00000020-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PASK8.702e-9346.31PAS domain-containing serine/threonine-protein kin... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php