TCONS_00000015 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000015
Unique NameTCONS_00000015
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1982

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000015 ID=TCONS_00000015|Name=TCONS_00000015|organism=Clytia hemisphaerica|type=transcript|length=1982bp
GCTGTTGAGTAGCATAAAGCAACTGCTGCTTTGTGTATCGTACCAGTGCT
TTCAGATCTTAATAAAACTGTTTATCATATACCTTTAACAGGTATATtat
acaacaaaatataatGTCATCGCACAAGGCAGTAGAGCATACAGCTGCAA
ATCTGGATGGTTTATGGACAGTAATAGCAAAAACGAGGAACTTTGATAAT
GAAGTTTCATCTTCCAAGAAAGCTATTGTTGTCATTCCTGGTAATCCTGG
TTTGGTTGAATTTTATGAATTGTTTATGGAATGTTTGTACAAGTTAAAGG
GGATTCCAATTATCGGTTTTTCACATGCAGGACATTCACCGATCCACCCA
TACACAGATGAACCAATGAGAACTCCTCCATTAACCTTGCAAGAACAAAT
TCAACACAAGAAGGACTGTGTCCGACAATTCATTCCTGACGACTGCAATA
TCATCTTTATCGGACATTCCATAGGAGCTTATATTATTCTACAGCTTATG
GACCATATACCAGAAAGATCGCTTCATGGTATATTACTCTTCCCCACCAT
CACGAACATGATTGGAACAGTTGACGGAAAATTCTGGAATCTGATAACTT
CATATCTCAAACTCCCTTTACTATGGACTGCATATTTTTCCTCTTATCTA
CCTTACGCCCTACAAGATGTTTTGATACGATGGCGTGCAAAATGGCGGCA
AATTGACGCCCCGATCGTACCAGTGTGCAGACGATGTGTCTCTTGGGACG
TTTTAAGTCAAGGTTTCCGTATGGTCGAATGTGAGTTAGTAGAAGTCAAA
ACTTTGAATCCGGAATTATCCCGGATTATACGACGATATTCCAATAAATT
GACGGTTTATTATGGTGACGGTGACGCATGGACgcctttttctttttatg
aggAATTTATACAGAAATTTCCTGAAGTGAAAACTTTCTACGGACGTGAT
GGTTTTAAACATGATTTTGTACTTGACTCTTCGGAAGGTGTAGCGAGGCT
ATGTAATAAGTTTATTGAGAAGTTATGATAGTTCATGATTATAAGcatct
tttacatttttatcataaCCTAGCTTTAACTTCAGATATCCTCTATGTAT
AAGACACAGATTTGCAGCCGTTATaagtttttttacaatatttggAGGAT
GTACCGTGTTTCAATCCCGACTTATGGAAGATTTCGAAAATCGTTAAAAC
TCATTTTCGGGTCAATAACTTTTTGCCCAAGGTGTAAAAATCGACTCTAC
CCCACATTCGAAAGcagataaaattatctttccaacggtgtctAGAAACC
TTCTATTCGaattttttctaggttgacTCTATTTTCGACAAAATTCTACA
GGACTAAAACTGTAAAAGTTGACATTccgttttataaaaatatacctTTT
CGACTACTAAAATCTATTgctagtttgagtaaagaaaattaATACTCAAA
GTTTTATGCCATTCTTTAGTAGTATACTCAAACTAGTATGAAGCTTGTCA
TTAATATTGATCACTGTTATTAGTTTTCGCTTACACAAGGAATGTATAGA
ATTTATTCTTGaattttaaatatctttttggGCGATATCGTGTAACCCTG
TATTAATGATTCAATACTCTGACCACTCTAGAACCATCTATGTAACATGG
TCAAAGGAATTTTTGTTTCTAGTTAATTTTTAAATTGTTATGAGAATTAT
TAGATGATGATGTTCATGTAAATAGATGAATTTGtctttaaaacttttat
ttCGCATTTTATGAGAGattttatttctgattttttaaattattgcTCGG
GTCTAACGGAAATCTTTAGGTCTCTAAAATGGCAATTTAATGCTTCGAAA
ATACTACCTTTTGACGTGagttttctcgaattttcaacCATTGGAGACCG
AAATAATCGCATGAAAACTCTTAAATTTGGTATCCCTTAGActctttaag
tgccaatgtcgagtATATTGGACATATGGGCT
Run BLAST on NCBI

transcript from alignment at sc0000001:328739..332443+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000015 ID=TCONS_00000015|Name=TCONS_00000015|organism=Clytia hemisphaerica|type=transcript|length=3705bp|location=Sequence derived from alignment at sc0000001:328739..332443+ (Clytia hemisphaerica)
GCTGTTGAGTAGCATAAAGCAACTGCTGCTTTGTGTATCGTACCAGTGCT TTCAGATCTTAATAAAACTGTTTATCATATACCTTTAACAGGTATATtat acaacaaaatataatGTCATCGCACAAGGCAGTAGAGCATACAGCTGCAA ATCTGGATGGTTTATGGACAGTAATAGCAAAAACGAGGAACTTTGATAAT GAAGTTTCATCTTCCAAGAAAGCTATTGTTGTCATTCCTGGTAATCCTGG TTTGGTTGAATTTTATGAATTGTTTATGGAATGTTTGTACAAGTTAAAGG GGATTCCAATTATCGGTTTTTCACATGCAGGTATAAATggatttctcttt tttataagaaccattcAATTTTTATTAAGGGTCAGTTACTTTTTTGGATG TACTTTGAGTCacaaattgtaaattttcaaaaactctcTGCGATTCCAGT CTTTTTCGTAATGTATGGTATTTTTAAGCCTGCCTTACTGTTCTTATATA AAGTGTGAATactctttttcttaaaattaacATGAAGAGAAAAAGTAAAT CCAATTCTGCTCATCATGTTGTTTCGATGTGATCCTGATGTGAACATCGA AAATCTAAAAGCTAACTAAGCAAGTTTCACCCATTCTCtatcaaatacac gtttttttataataacatccATAATATTTTTAGCCTTTGGGTGTTCTTCt aagctttttgagtttttaagctgaaaaaaaacgttattaaaatgttctga attttaaaccattttgtgagtgtttttttcACACTTCCTAACTTGTTCAT AATATCTTGGCCATCAAACCCTTTTgttcatatagtttgttcttatgtga aacaatgaaacagaaaaaacaaaaacagtttttttgtaCTAATAGTTTCA CAACCTTCTTCTGGGTTGATCATCAGCAAactctttttgtttgtttgctg ATGATCAACCCAGAAAAGGATTGCGAAAATATCAgtacaaaaaactgttt ttgtttttttctgtttgacTTAAAAATTTCTACTATGAATAAGAAGATTC TCCacaagtttgttcttataaaaaacgtgttttcCACATCTCAGGACATT CACCGATCCACCCATACACAGATGAACCAATGAGAACTCCTCCATTAACC TTGCAAGAACAAATTCAACACAAGAAGGACTGTGTCCGACAATTCATTCC TGACGACTGCAATATCATCTTTATCGGACATTCCATAGGAGCTTATATTA TTCTACAGCTTATGGACCATATACCAGAAAGGTGAATACACTCTTCTCAA AATAATAAGGGGCAAGGCTTCGGATCCGTAGAATCTTTCGTAGGANattg tacttaacaacatatccaaaaatgaaaaaaatctaagtttcaaactattg gaactgccccaaactgccccattcttaaaaaaactggctcttaaaaattt ctactatgtatggaGCACTCTANtctttttgtttgtttgctgATGATCAA CCCAGAAAAGGATTGCGAAAATATCAgtacaaaaaactgtttttgttttt ttctgtttgacTTAAAAATTTCTACTATGAATAAGAAGATTCTCCacaag tttgttcttataaaaaacgtgttttcCACATCTCAGGACATTCACCGATC CACCCATACACAGATGAACCAATGAGAACTCCTCCATTAACCTTGCAAGA ACAAATTCAACACAAGAAGGACTGTGTCCGACAATTCATTCCTGACGACT GCAATATCATCTTTATCGGACATTCCATAGGAGCTTATATTATTCTACAG CTTATGGACCATATACCAGAAAGGTGAATACACTCTTCTCAAAATAATAA GGGGCAAGGCTTCGGATCCGTAGAATCTTTCGTAGGACACATTCGCGTGT GATTGGTTTGAAAGTAGATAGAATTTCGAGACTTTTTTGAGAAGGGGCAT AAAAGGCTTGGCAACCAAAAGTTTTTAGGGCGATTTTTTATCCCCCGCCA AATAGTAAAATTTGAcgattttttaatgtttttactGAGTTTTGATTCTC CTACttggatttttaaaagttaaaaccctttgttgataattttaaaaaat actttgactTTGAAATAGTTTGTTTGACCTGAAAATATGAAAGATAATGA AGGAAAAGTGTTTGCTCAAAACTTGTTAACGATTATTCCTAAGATGATAG TGGAGAGACTATAATACATTTTAACACCTATCTTTTATAGATCGCTTCAT GGTATATTACTCTTCCCCACCATCACGAACATGATTGGAACAGTTGACGG AAAATTCTGGAATCTGATAACTTCATATCTCAAACTCCCTTTACTATGGA CTGCATATTTTTCCTCTTATCTACCTTACGCCCTACAAGATGTTTTGATA CGATGGCGTGCAAAATGGCGGCAAATTGACGCCCCGATCGTACCAGTGTG CAGACGATGTGTCTCTTGGGACGTTTTAAGTCAAGGTTTCCGTATGGTCG AATGTGAGTTAGTAGAAGTCAAAACTTTGAATCCGGAATTATCCCGGATT ATACGACGATATTCCAATAAATTGACGGTTTATTATGGTGACGGTGACGC ATGGACgcctttttctttttatgaggAATTTATACAGAAATTTCCTGAAG TGAAAACTTTCTACGGACGTGATGGTTTTAAACATGATTTTGTACTTGAC TCTTCGGAAGGTGTAGCGAGGCTATGTAATAAGTTTATTGAGAAGTTATG ATAGTTCATGATTATAAGcatcttttacatttttatcataaCCTAGCTTT AACTTCAGATATCCTCTATGTATAAGACACAGATTTGCAGCCGTTATaag tttttttacaatatttggAGGATGTACCGTGTTTCAATCCCGACTTATGG AAGATTTCGAAAATCGTTAAAACTCATTTTCGGGTCAATAACTTTTTGCC CAAGGTGTAAAAATCGACTCTACCCCACATTCGAAAGcagataaaattat ctttccaacggtgtctAGAAACCTTCTATTCGaattttttctaggttgac TCTATTTTCGACAAAATTCTACAGGACTAAAACTGTAAAAGTTGACATTc cgttttataaaaatatacctTTTCGACTACTAAAATCTATTgctagtttg agtaaagaaaattaATACTCAAAGTTTTATGCCATTCTTTAGTAGTATAC TCAAACTAGTATGAAGCTTGTCATTAATATTGATCACTGTTATTAGTTTT CGCTTACACAAGGAATGTATAGAATTTATTCTTGaattttaaatatcttt ttggGCGATATCGTGTAACCCTGTATTAATGATTCAATACTCTGACCACT CTAGAACCATCTATGTAACATGGTCAAAGGAATTTTTGTTTCTAGTTAAT TTTTAAATTGTTATGAGAATTATTAGATGATGATGTTCATGTAAATAGAT GAATTTGtctttaaaacttttatttCGCATTTTATGAGAGattttatttc tgattttttaaattattgcTCGGGTCTAACGGAAATCTTTAGGTCTCTAA AATGGCAATTTAATGCTTCGAAAATACTACCTTTTGACGTGagttttctc gaattttcaacCATTGGAGACCGAAATAATCGCATGAAAACTCTTAAATT TGGTATCCCTTAGActctttaagtgccaatgtcgagtATATTGGACATAT GGGCT
Related Sequences
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000008XLOC_000008Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000015-exon-sc0000001-1491911889:328739..329068TCONS_00000015-exon-sc0000001-1491911889:328739..329068Clytia hemisphaericaexon
TCONS_00000015-exon-sc0000001-1510915933:328739..329068TCONS_00000015-exon-sc0000001-1510915933:328739..329068Clytia hemisphaericaexon
TCONS_00000015-exon-sc0000001-1491911889:329833..330019TCONS_00000015-exon-sc0000001-1491911889:329833..330019Clytia hemisphaericaexon
TCONS_00000015-exon-sc0000001-1510915933:329833..330019TCONS_00000015-exon-sc0000001-1510915933:329833..330019Clytia hemisphaericaexon
TCONS_00000015-exon-sc0000001-1491911889:330979..332443TCONS_00000015-exon-sc0000001-1491911889:330979..332443Clytia hemisphaericaexon
TCONS_00000015-exon-sc0000001-1510915933:330979..332443TCONS_00000015-exon-sc0000001-1510915933:330979..332443Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:328739..332443 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.995158 0 0 0.912756 0.497604 0.870182 6.64889e-05 2.29837 2.1127 0.0944688 1.19927 0.994558 1.05309 1.43108 0.39251 1.70428 1.1142 0 1.36117 1.01192 6.92172e-05 1.07049 0 1.797e-06 0.603704 0 0 0.99943 0.00961485
Blast
BLAST of TCONS_00000015 vs. Swiss-Prot (Human)
Match: LDAH (Lipid droplet-associated hydrolase OS=Homo sapiens GN=LDAH PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.281e-26
Identity = 82/283 (28.98%), Postives = 130/283 (45.94%), Query Frame = 3
Query:  195 DNEVSSSKKAIVVIPGNPGLVEFYELFMECLYKL--KGIPIIGFSHAGHSPIHPYTDEPMRTPPLT----------LQEQIQHKKDCVRQFIPDDCNIIFIGHSIGAYIILQLMDHIPERS-LHGILLFPTITNMIGTVDGKFWNLITSYLKLPLLWTAY-FSSYLPYALQDVLIRWRAKWRQIDAPIVPVCRRCVSWDVLSQGFRMVECELVEVKTLNPELSRIIRRYSNKLTVYYGDGDAWTPFSFYEEFIQKFPEVKTFYGRDGFKHDFVLDSSEGVARL 1001
            D  V   K  I +IPGNPG   FY  F + LY L  +  P+   SHAGH+ + P   + + T   +          L  QI+HK   +R  +P D  ++ IGHSIG+Y  LQ++  +PE   +   LLFPTI  M  + +G+    +  + +  L  T Y      P  ++ +LIR   +   ++    P+    +    L+    +   E++EV   + E    I+ +  KLT YYG  D W P  +YE+  + FPE           H F+   ++ +A +
Sbjct:   37 DQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHA-LAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPL--NILEPFCLANAAYLGGQEMMEVVKRDDE---TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADM 313          
The following BLAST results are available for this feature:
BLAST of TCONS_00000015 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LDAH1.281e-2628.98Lipid droplet-associated hydrolase OS=Homo sapiens... [more]
back to top