TCONS_00000009 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000009
Unique NameTCONS_00000009
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2308

Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
50.5714 49.5953 23.233 19.6593 53.9752 44.0568 39.0496 39.0397 27.9593 32.7268 26.8679 25.3597 20.8939 19.4373 28.5818 32.0794 47.8331 41.7078 17.5542 20.9228 20.8034 20.5893 32.3836 33.0473 38.4901 36.295 24.3583 19.4907 25.889 22.8599
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:144882..172204 +
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
molecular_function GO:0070008 serine-type exopeptidase activity
molecular_function GO:0008236 serine-type peptidase activity
Analyses
This transcript is derived from or has results from the following analyses
Analysis NameDate Performed
blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)2017-10-03
Transcript Expression Analysis of Clytia hemisphaerica tissues & stages2017-06-27
Analysis pipeline of Clytia hemisphaerica2016-05-30
Homology
BLAST of TCONS_00000009 vs. Swiss-Prot (Human)
Match: PPCE (Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 SV=2)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 420/708 (59.32%), Postives = 531/708 (75.00%), Query Frame = 1
Query:   58 MTKLTYPEVCRDNEAIDDFHGNKIPNPYLWLEDPDSAETKEFVEKQNDLTKSVLETCETRDKFNKRMTKLYDYPKHGCPFRRGNRYFYYHNTGLQNQSPLYVQEKLGGDSKVFLDANAMDSKGLIAISRVSFSEDGELCAYSISKKGSDWNTIKFMKVGDQQELPDILENVKFSCITWTHDHKGVFYNKYDKDESKQDGTEVNSNLNQKLYYHKLGTEQNEDILVAEAPDNPKWMIHAEISDEGRYVILTASEGCDPVNRLYICDLQKLDYQITGLLPYEKIVDNFDASYEFIANDENIFTFQTNLNAPRYRLIRIDINKPQQENWESLVAEHELDVLEWCTVVNKNILVMCYLHDVKHEIYLHRLDSGERYKRIDLDVGAIGGFSGRREHTEMFYTFASFLVPGVIYRYDFKTN--EPEVYYETKIEGFDASLYETKQIFFDSKDGTRIPMFIFYKKGITLDGNNPCILYGYGGFNISETPRFSITRTIFVSNYDGVYAVANIRGGGEYGEKWHKDGSLSKKQNCFDDFISAGEYLIQEKYTSKDKLCITGGSNGGLLVTSVANQRPDLFKCVVAHVSVCDMLKFHKFTIGHAWITDFGCADKKEDFEYLIKYSPLHTIK--SHDNTQYPCMMLLTADHDDRVVPLHSLKYMAQLQYTVGKNEHQTNPLLLRIDTESGHGAGKPTSKIISENADVFGFIGKMMNAKW 2169
            M  L YP+V RD  A+ D+HG+KI +PY WLEDPDS +TK FVE QN +T   LE C  R  + +RMT+LYDYPK+ C F++G RYFY++NTGLQNQ  LYVQ+ L G+++VFLD N +   G +A+   +FSEDGE  AY +S  GSDW TIKFMKV   +ELPD+LE VKFSC+ WTHD KG+FYN Y + + K DGTE ++NL+QKLYYH LGT+Q+EDIL AE PD PKWM  AE+SD+GRYV+L+  EGCDPVNRL+ CDLQ+    I G+L + K++DNF+  Y+++ N+  +FTF+TN  +P YR+I ID   P++  W+ LV EHE DVLEW   V  N LV+CYLHDVK+ + LH L +G   K   LDVG+I G+SG+++ TE+FY F SFL PG+IY  D      EP V+ E  ++G DAS Y+T QIF+ SKDGT+IPMFI +KKGI LDG++P  LYGYGGFNIS TP +S++R IFV +  G+ AVANIRGGGEYGE WHK G L+ KQNCFDDF  A EYLI+E YTS  +L I GGSNGGLLV + ANQRPDLF CV+A V V DMLKFHK+TIGHAW TD+GC+D K+ FE+L+KYSPLH +K    D+ QYP M+LLTADHDDRVVPLHSLK++A LQY VG++  Q+NPLL+ +DT++GHGAGKPT+K+I E +D+F FI + +N  W
Sbjct:    1 MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDW 708          
The following BLAST results are available for this feature:
BLAST of TCONS_00000009 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PPCE0.000e+059.32Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 ... [more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>TCONS_00000009 ID=TCONS_00000009|Name=TCONS_00000009|organism=Clytia hemisphaerica|type=transcript|length=2308bp
CTTAGAGAttcattaaatcaaatattaagaaatctaaaaataatctgaaa
atcAGAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGG
CTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTTG
GAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGA
CTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATA
AAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGTCCGTTTCGC
AGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCAAAACCAAAG
CCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAG
ATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCT
TTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTC
GGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTGC
CAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGCACGAT
CATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAGTAAACAAGA
CGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACTACCACAAAC
TGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAAT
CCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTAT
TCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTG
ATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCCTACGAGAAA
ATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAACGATGAGAA
TATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATCGTTTAATCC
GGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCA
GAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATAT
TCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATATACCTTCATC
GACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGATGTGGGTGCG
ATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTACACTTT
TGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatttcaaaacaa
atgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTCGATGCATCA
CTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGGAACGCGAAT
ACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATGGTAACAACC
CTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCGT
TTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATACGC
TGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAG
ACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTCATTTCTGCC
GGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAAACTTTGTAT
TACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAATCAGC
GTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGACATG
TTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCACGGATTTCGG
ATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaTACTCTCCCC
TGCACACGATCAAATCGCACGATAACACACAATATCCTTGCATGATGTTG
CTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTCCTTGAAATA
CATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATCAGaccAATC
CATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACCA
ACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAAA
GATGATGAACGCTAAATGGAAAGAAATTTAATCATGTTGAAGTTGAGTTT
TTCCAAAAAGAATCGGTTACTCTCTTTTGAGAAGATGTTTCATACCCAAC
CAATCCACTAGGAATTCAAGACACTTTTAGCTTCAAAAACCCCTTCAGAC
TTCTGATT
Run BLAST on NCBI

protein sequence of TCONS_00000009-protein

>TCONS_00000009-protein ID=TCONS_00000009-protein|Name=TCONS_00000009-protein|organism=Clytia hemisphaerica|type=polypeptide|length=707bp
MTKLTYPEVCRDNEAIDDFHGNKIPNPYLWLEDPDSAETKEFVEKQNDLT
KSVLETCETRDKFNKRMTKLYDYPKHGCPFRRGNRYFYYHNTGLQNQSPL
YVQEKLGGDSKVFLDANAMDSKGLIAISRVSFSEDGELCAYSISKKGSDW
NTIKFMKVGDQQELPDILENVKFSCITWTHDHKGVFYNKYDKDESKQDGT
EVNSNLNQKLYYHKLGTEQNEDILVAEAPDNPKWMIHAEISDEGRYVILT
ASEGCDPVNRLYICDLQKLDYQITGLLPYEKIVDNFDASYEFIANDENIF
TFQTNLNAPRYRLIRIDINKPQQENWESLVAEHELDVLEWCTVVNKNILV
MCYLHDVKHEIYLHRLDSGERYKRIDLDVGAIGGFSGRREHTEMFYTFAS
FLVPGVIYRYDFKTNEPEVYYETKIEGFDASLYETKQIFFDSKDGTRIPM
FIFYKKGITLDGNNPCILYGYGGFNISETPRFSITRTIFVSNYDGVYAVA
NIRGGGEYGEKWHKDGSLSKKQNCFDDFISAGEYLIQEKYTSKDKLCITG
GSNGGLLVTSVANQRPDLFKCVVAHVSVCDMLKFHKFTIGHAWITDFGCA
DKKEDFEYLIKYSPLHTIKSHDNTQYPCMMLLTADHDDRVVPLHSLKYMA
QLQYTVGKNEHQTNPLLLRIDTESGHGAGKPTSKIISENADVFGFIGKMM
NAKWKEI
Run BLAST on NCBI

transcript from alignment at sc0000001:144882..172204+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000009 ID=TCONS_00000009|Name=TCONS_00000009|organism=Clytia hemisphaerica|type=transcript|length=27323bp|location=Sequence derived from alignment at sc0000001:144882..172204+ (Clytia hemisphaerica)
CTTAGAGAttcattaaatcaaatattaagaaatctaaaaataatctgaaa atcAGAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGG CTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTTG GAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGA CTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATA AAAGGTAATAAGTTTGTTTACGATTTGATTCTTTAGCCTCACTGATTCCA ATCAATCTGCAAGGGATAAAGTTCTTTTTTATTCGATACATGTGACGTCA TAAGACACTATGGTTATAAACCTATATAAATTAGTTAGAGCTACTCTATC TTTCTCAAGCCAAGAAAAATGATGCGCCATCttcagccaattcgattgac ttccaaatttgccatactcaccaactttgccaaatctacaatttcaaagt caaaagatcacagctgcatggcaaatttgtacatcgctactctgccatta tgatttccgttttgtgatgcttagtCAGCAGTTTTCTTTCGGTGTTTGTA AAGCGaacgattttttaaccaatcaaattgccgatcggaattgttttact ttagcattggaaggtcttctatttttcaaaatctttggcaaaagtggcaa aattggagcaAAAAGAACACAGGCctcgtgggaacagtgttttgtatgga gacgtatggaggtaagttccaaaaatgccaagaatgccagattcaccaca tcttttttatttggcatttatggcactcaaattttgccacattttgccaa atttttgtcaatcgaatgcaaaataattagcaatcagggcaaaaatggca tattttgaagtcaatcgaattggctgctTGTCTGAAAGTATTTTACATTA GAAAGCTTGATTTTCACAGTTGAAGTATTTTGACACTGCagtgatttcaa aattttaaggctCACGCAAGAAAGATTGTAACGTCAATAAAAGTAATGAA TCTTTCTCAATAAAAATCTGtaaaagtttttataagaataaactttaATA TAGGAACATAAGTCTTCCATCGTGTCCATGATGTTAAGAGGAAGTTAAGA ACGTTAAAAGGCTTTGCTGACTCTATAACAgctgatttcttagaaaaatg gtaaaaatactcacaaaatgatgaaattagaacaattttaggtttaaaac tcaaaggAGTTATGAACACCCGAAGTCTCCaagaattttgaatgttctta taaaaaagtgtttattttttcttcaaataggATGACAAAGTTATACGATT ATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTAC CACAACACTGGATTGCAAAACCAAAGGTAAATTCTTCATTAGTAGACTGT TAGACCAGAGGCCGAGGCAgtggattgtgtcacttcgtagggcacccctt agatcagggcaaatttttgatattattctcctaataaggtgtagaattga caaaaaaaaattgcccttcgaatctcctgcagttttcgagtgaatcgatt tttagttaatcgatagaacttattactagcggttttttcgaagtctgaaa atcaaatatctgagactaccaacggattcagcgtgaaaagtagataaaga aattggggttatttgttatttgttatttgttaagtttgaCCACCTGGTAC TGAGAAATGGcattttaaggcgaaaaatcgtcgtttttggcggtttccga tgacgtcagcattttcctaggagcattttcagaaaaaatcattcccacaa ctggatagccctgaattagtagtatccaaaagtggtatggtttgttaact ttcgatgtttagatctcgagatattttggtttaaatattgaaaattatcg atattttttgctgagtcagcagtttttcagcatatttatccACCTTAAAA ATGCAACACataatttgccctgatctaaggggtgccctacgaaaaccatt tttaaggccttttttgaatctcggacgctggtctatcTCATTGATTTTCT TGAGATATACAAGCAATAGACAATggttttccttgagaaatacaagcAAT AGACAatgattttccttgagaaatacaagcAATAGACAATGATTTTCCTT AAgaaatacatgaaaatgaaaagtttttcaataaagcaAAAACGGTTTTC CTAGTGAAAATGACAAGTATGATTTCCCTAATAAATAAAGATAAATGAAA AAGggattttccttgagaaatacaaaagataaaagtgaaaacccaCTCAA ATGGTACTCAATATTCTTATATCcctgaaattttgcaaatatCCAAGAGC AAATtgagaaaaattagaaatttccaagaaattgattttactgattttag cATTAGTGcaattccttttttgttttcttgtttctaGCCCCCTTTACGTG CAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAAT GGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATG GGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACT ATTAAGGTGAGTTTGATTGTAAAGGGAGAGCATTCGGCTATGGCTCGCAA GGTTGTGAGTTCAATCCCTGGTCGGATCTATTCAGACTCAAACCNAAGCA TTCGGCTATGGTTCGCAAGATTGTGAGTTCAATCCCTGGTCGGATCATTT CAAAGACTCAAACCGGTACTTAACACCTTTCTGCCTAATGATCAGCAATA CAAAAGAAGGCGAGGGTAGGTGGAATAAACCAGAGAGAAAAAGGCAGAGG AGTACCATAGTTTATAAAAGTAGAGCAATCGGCTATGGTGTgtaaggttg tgggttcaatccctggTCGGGTTATACCATAGAATCAATTATAGAATTTG AAAACCCCCACTTATTAAAAACAAGAGAATAAAGAAATCTTAAACAATCA AAAAGAAGTATCATGGGTAAACGGagtaatccagggagaaagagttgCGA CATTTCCCATACCCTTTTGTAAAGGGTAACCCCCATACCCTTTTGAACAg atcataaattacgtcacgagcaataCTTACCTCGTTTTCGATATATTACT ACAGGTAATTGATTCCCAAAGAAGTACATTTAAGAAGTCGACTCTATTGA TAAAAGTAATACTCAAAGTCTCAAGGGATATAATCACCTtagtaatggtt tcaaaacgaggaagtcgttgcactcaaaataatttataaaaaggcCTATT AAGCTCTTCGCATTTGTTTCCCTGTTACGTTTAGAATTTGTTTCTATAAT TCTTACGTTTTAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACA TTCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAA GGTGTTTTTTATAACGTAAGTTTAGAAGAAATATTTCCCCAAGATCCCGC AGACGCAGAAGCTTTTAATTCCGTCTAGTTCTCTGCGATTTAAAGTTAGA CCTTTCCAATTTTTGATCAAACTGCCCTAAAGGGTTGAGAGAGGTCATAC TTTTCGCTCATTTTGTTTCAGAAATATGATAAAGACGAGAGTAAACAAGA CGGAACGGAAGTGAATTCAAACCTCAATCAAAAGGTATGCACTCTTTCTT TGAACATAGAATTTGTTTTATACTTATACCGGGTGTCGCAGAAAAAAGTC CCTCTCTTGTAAGtgaatttctcgagttctatgaacttttggtcatccgc gaaattaaattcccgtcaaaaCTTCTTCCTTTAGTGAAGTTTAATATTAT ACCTGATTATATGATTTTTTCACCTATAGCTATACTACCACAAACTGGGA ACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAA ATGGATGATGTAAGAttttttgtaatgtttttttccttctagcataccgt gttaaaagttcttccttCTCATGTAGATTTCcgttttccgtctcaaaatt ctacataattcaccaaaatttctaGAATATATGCTAATTTTTTCCTTGGG AGACGAAAATACCTTGGTTTGACCACTGAGCATAAAAAAGGATAACATTG TGTGTCTCTTATACAAGCAAATCATTGAAATCCCATGTATTTCAAAACGA GTAATAGTtcagggggggcacgcagttactacaagacagtatgacactta ctaccgtggtggtactgtattcagaagttatgaaaacagttactacacag tgtagtaactgctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNAATTTCGaggatgtttttgatgatatcactcaaaa acaggggtggtacctggaaatcttttctgaaaacagttactaccaaggtg tagtaactgcaaagggtgctggtcctgaaaaaaagtgttgaaaaagcact tactacacatgtcttgtagtaacagCTAACTATCTAATGTCTGTGTCAAC TTtgaatttttaccaattttagaCTTTACAATACAATGCATATCTTTTTG TAGTTTCTTTTACAAGGGAcacaattttatgattttgtcttAAAGTCGCC AAACCGGGGTAGGGGTAGTCTGAAAAGCAGACCTCTACAGATAAACTTTC CCCGTGGTCACAACCAAACATATATGGCTGGAATAACACTTTGTCTGAAG TTTCCTGATTTACTTGTTTACTGTTCAAGATTCCCTCTAcatgtaattta cagaccatcCCCCAGCTCTTGGACTAAATTTTCGTATATTATTGCTATTT GTCTAGCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGG CCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAA AAGTTAGATTACCAAATTACAGGTATGTTCCTATGCAaaactttttgtaa aataataaGGCTCGTATcttgaaaaatagaaatttaattgactttttata aaaaccaagctcgatataccttattacactaatattactaggcaagtatt caacggccttgaaatttggacgatctgaaattaacacgaattttatttgc tttttcaaggacaccacggctggttttaattaagggggtttttattaaca tgaaatttttcaattcgtacCGTCATTTCTCTGGATTAATGTGTCCACTA ATTAATGCGGATGTTAACAATTTCTGGTTTGTTTATTTCCTCTAATTATA GTGCGGGTAATAGGAAATTCAAATTCTGAATAATAATGTTTCCAAATGTA AAGGGATCATCTACGTTTTCTGGGCTGCTTCTTATTTTGTAGCGTATGGT AATTGGGAAAAGTCCGTCGGGGAAACGTCTGTCGGGGAAACGTCTGGTAA TTGTATTTGCATTATCTTTCTTTCAGGTCTACTGCCCTACGAGAAAATTG TGGATAATTTTGATGCATCTTACGAGGTATATGCTATTAAAGGTTTCTTC GATACAACGCTTGAATGATATGTACTGATAAAATGGGGTAGACCCGGTGA ACGGTGAAATTCGCCGGTCTAAAAATTACGTTCGCCGCCTCAAGTACGCC GCCTCGAGTACGCCGTCAAGCAAATCAACACACTGGGCTGCTAAAACTTC ATCAgtctaaaattctaaaattcgccggagttaatttttcattcgcctGC CTATCAAAAAAAACAAGGCAAAACCCTCCAAAACCTTCAAACTTTTCCTG CCAATCCTTTCGAGGAGAAATAGTCTAAATAAACAAAGGATGTTTTTTGG CTTTGAAAGACAATCTGGGCAACGATAATTACccgggggtactacccttg ccgatggctgaggttcgaaaaatggaccctacgtgggacttgttttttca aaaattttaccgccgaaatttgcgaaaaaagtgaccctgaatgggactga aattccaaaattttctcaaattttctactgcTTCCCCAAATTCccctgat ttttctattttggtgttttttgcgaccctacctgggactcgtatCCCCCG GGGATAATTAAGTTAGTTAGAAACAGAATGATATTCTAGATGTTGAGAGC TGGATAGAAAAAACTACCGagacatttttttcaaacagcCATGGGACCCT GGCAAAAATAAGgtaccgggtgcaccacaaaTAAGTTTCTCTCTTTCAAG TAGCTTTTTCCGAGTTCTGTGAAATTTAAATGAATCTGAAAGAATGAATG TCTTAAACTTCTGAAAGAGAATGATCAACAATTTTGATGGGTTATTTTAT TAAgtttggttcattagatcaaaagttatgcccgaaataaataaaaacgt tCACTTCCAGAAACTAAAACCCGGTACcgctttttgttaatttacccCGC CCCCGCTCCCGCCCAACCGTTTGAAGAACGTTtctattcttttgtttcag tttATAGCAAACGATGAGAATATTTTCACATTCCAAACGAACTTGAATGC ACCTCGTTATCGTTTAATCCGGATTGATATCAACAAACCGCAACAGGTAA AACAACTGATCTTTAtataccatagatttataaagtccgtccgaagggct agatgtcgtactttggctgaaaagtttACCGTAGCTCGGTAGGAAATCAT ACCTAGGTCACATGACAttacattacaatagaatttcagcacttgaccaa tcaaaagcttcgcgggtttttgaaaacaatagcagcaatttttttgcgat attcactttctTTTACCGGCCATCGCTGatagcacgacatctagcccttc gggttttacagaaatctgtggttGAATGTTCTTCTGTCTCTTCCGCCTCA GTGACCCAGATCCTCTACAATccttaatttttcgaaatttgaaatttcgc aCCCTTGCTATGTATGtaatatgtaatagtttatttcaaaacCCGGTCGG TCTATTTGGTTTACAGTGAGAATCGTTTCATCTTGAAGGGGACAGAAAAT AATGAATGTTTGAATAAGcgaccttttttataagaaactttatGAAAACA TGAGGCTTCGATTGTCAAATTATTAAGAATACTTGCAAGGCTCTGTAgac cctaaaacacccaatttcttggGAGATCGCACAAAAAAAAGCTTGAAGGG TAAAAAAAGCACAGAATATTGaaacctgattttttgaagaaaaaaagtgt tatAATTGCTCGACGACCacagtagactcccggttaATCGAATCTGTACT TATTCGAATGATTCGGTTATTCGAAGCTTTCGGTTATTCGAAGCGATTTC TATTCCCTTGGGGCCAATTTTAGGCTAAATCGGCCTCagttacactcttt ttttatgtaagaatacactttataagaatgtccctgatgaaaatggccaa aaaattaaaaataatgctaagaatatcatcatcatggaatttggctactc aagctaagaatgccatttttagagcattttcaattataaattgtcaattt acccccaagttaggctcactcctttcacaaaaatgccattttatgcttga gacgtacgtactaaatgttaaatatagtctgaattaggatcctaccCTTA GAATGCTGTaataatattttaggatgactacctcaaaaaagttaagaata tcaatgatgaaatggatttacaccattcttataaaaaaagtgtgtattag AATTTCTCTTATCGGGTGGTTTGCAAGCTTTTATCATACCTCTCCGGCTG TCGTTCCTAACCACGCTTCTCCATTTTCCTCCAGGAGAATTGGGAAAGTT TGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAAT AAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGGTGAGTTGTCT TTTTTTCATCTCCATAATGTTctggttttttataagaacagactatAGAA TATAAagttcgatggccaaaatatcaagaacaagctgaggacattttaag gcttggtaGACTCTACATTATCGTTTTCCTAGGAAGTCCATGGgaatatg gacaaaaatactcacaagaGGGTTAAAAGATGAACGTGGTAAGAAGgttt ttaggctcaaaactcaatcaaaaagttgagaacatccgcagatgttcgta taaaaaaacgtgtagggtTTCAAATGttagaatacacgtttttttttata agaacaaactatataagaacatgaggcttcgagggccgaaatgttaagaa caagttaagaacattttaaggctttggagacttaaaaacatgcattttct taagaaattacatcaaaacgctcaaaaaatgctgaaaataagaacatttt aaggctttggagacttaaaaacatgcagtAACTttagaaattacatcaaa acgctcaaaaaatgctgaaaataagaacattttaagaacatttttaggct tcaaatccaaaaaactaagaacatccgaaggcttcgaaattttttgacgt tcttataaaaaaaaaaatgtgtagatgCCTTTTTTCCAGCTTGAAAATTA ACTCTAAGAACAAATCTTTTATTTAAATTCCTTGGTAAGAACAGCCAATT tccaaaatcttgaaatttccagctagcttattggaactaattttcgtggg ttttaattttagcgtttttcgcggtttttcgtcaaaatcgcgaaaatttg atcccgcgaaaaattttgagagttgaaaaccgcgaaaattaattcccgcg aaatacaatattttcaaattttatcgaaaaatttgaaaaatccctaggaa aatgaaagaatttgtccaaaaaagggcaaaaccgtgaaaattaaaacccg cgaaatgcaattttccggatatttttttttcgaccgcgaaaattagttcc aataaggtagcaGATTTCTACTTGTGAACAGATCAACATTTTTGCGGTTG GGACAGGCTGGGAGCacagactagagtctacttctgactgaaatttgcct cctgataatttttgatgacactGAATCCAGAAGACAGGAGTATTTGCCAA AGTCggccattttgaaagaaaaacattaaaattacAGATAAGAAAAAAGG GACTTTGAAAGTGGACCAGCACGAGTGGGGATCGAACCTATCGGTCGTAA AAATGCTCAATAATATCATAGATTATACCGTCAGCTTCTTTGAGAAATTG AGTTTTTGGGGATCTTTATAAGATATCATTGGTCCGTGATCTTTAATAAT TTGGCTTCTAGCAGTGATAGATTTATGTATTCATAAAAAACCgatgggag aaaaaaaattatgcgctcccgggtgggcttgaaccaccaacctttcggtt aacagccgaacgcgctaaccaattgcgccacggaagCTTGAAATGATTAG AAGAGGAAATTCTATAATTTGTTAATCATCGTGTACTTATCATAACTGAT TGACATTTTTTATGCTGGATAAGAATACATGCAgccgtttagaaatcgag tgcccggGGAGGGGATTATTACTATGCTTCTGCTCATCTTCTAGCGAaaa gaatttttgtaaatacaaACTATTTAAAAGACCTTAAAGGCTTCCATGGC CAAAATGTTCTCGGACTCAAAAACAGCTAATTaagaaaaaatggacaaaa atagataaaagatgggaaaaataagaacatgtgaagaacatttttaggtt tgaaacccggggggggcactgggtttgcggactgacggtatgtgcgggcc aaaaattggcttttaaaattgcacccttacagtgcagcaaaaatcagtga aaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttccgaccc ttacagtgcattttaaacatgttggaaaaggtacccttaggacccgcaca tacccgtcggtccttttgcccagctgccccccccggggtttgaaacttta aaagttaagaacatacagatgatcttataaaaaaaatgggaagtatatct atagcgattcagactagggattcaaaaataaaaaatacggcTCTAGAGAG TAATATGATCCCATCGAGATTCAGGTCCtattattaatttcgcttagcga aagtattacgatagccttccgtGTATGTATGTAAGTATGTGGCGAGACAt ttttttggggcgcaaattatggcgtgggcgtttggctgcgggcgtactac gggcaatattctaaaggtggactcactcacaaagataaaaagtgataaaa AACAGGccttttcttaataaataaaatacgctaggctagtgcaagaagtg taaccaagtttttgtaaacattcatcgtgagaactttttaaatggctgct tgattattattgcacatgcttttgtgcttttgaaacttgctggtcctttg tagagtgtttaaagaggtttaatatttgtttactactaagtatttcatgt ttgtgtagttagtgaatgcaccaacaaattgatcatgctcagtaagtagt cgagttaattttccacaacaaacaacaacattattaaCCCTCCCTCTCTT CTCATCTTctccaaaactacaaacagcacaggtatgatctttttttcctt ttttcaccagatagttatgtgttaatagtgaaaccagttgtgacaaacag tcagttttagcaagtaccgTGAAGTCGCGTAACTTGCATCAATGGAGGCT AACTTATTGCATAgtcatcaaatgactgaccaatcaaagcagcaaaattt caaaacaatgaaCTATGCaactccgcttgcagctctagcctaccattttt gttttgatttaactttgtattttaatgaccaaaccTGTTTGTCATTCATT Tgaaggctatgcatgttagcctccactgatgcaagttacccgatctcacg gtatttcttagaaatcatgtcaatggaaattcagcaatcatttttgtata attgaAACGACCCTGCCTAGACATGTCGTACAGTGTCATTGTACCGTGAT TTACGGTGGGTAAGGTGGGGTGTACACATATATACAgtacagcagatttc aaattaatctattttcaccgccgtacatttagatccagccccaccgtaca ccaccgcacaatgtacagcggtcccttgttaatgatgacagttttttatc cgatgaagtttgattggtgttgatgagtttggttagtaaaagttccagct tttccttcccaatgggatgatagatattggctcgctctttaagctttagt gtgggcgtctgctaataagctgtcaaaatgtaaaaagaatgggcaacaag gtaataaatcaaactaatcaagcttcaatcaaacttcaccgatcttgata cacatcttgctaattaggattttcattttgaatcatggtaccgttgtttg tataagattcccatttccacactaagattcttgttacttttctggaatct ttcccctacAGTATTTATTTTTCACGGGATGAACGGCAAGAGATTGGaga gggtttgtttaatgggatgcagtttaaagcagttataaaggagtcaaagt attatttctttaaagcttaaagttggctagtttttaccctgcaatttaca tgggggtggaggatatagtgtctggagggggggggggggNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNccccccccccatattcaatttttttctggaaaagtccaat gatcTTGATGGTGGTGGGCCATCATTCATAttagaaagcgaagatagtat acaacagatttttctgactagccattcttctcaattttagataaattata ctgtttatagaaagaagtagatataaactttgcgcaagtgaaagaagtct ttaccacaagttccttcaaagcacaaaatgagggtcttcattttcaaaaa aaattaaattatttttctcaagtatattgcagttctctgaattctgaatt gaaagattttgtttacgctttatagaatggaattctttagtcacattttt ttaaggaatctttttttaatggattgagatcAATTTATGTACAatacatt gtgtatattttgtgtaacgctttattcaaaatgcataatgctgcaggagt cacgtttcacgcatcttcgtcgttgatgttcaagtattatgcgaaatttt cgactttaagtcgtcttgttcgAGTTATCTCAGTGAACACTTTTTCGCGA GACCCAGAAAGAgacccagcggcacccctaacgGTACCTAACGCAATCAT TCCGAGTTTTAAGGGTggacttttttgataaatacatTTTGTAAGGGTTG AAATTTCAGCACAACTAGGAAATATTGCAACTTTATGCCCGAAAATTCAG GTTAAAAATTGaggaaaatgcactgtaagggtatggatttcaccgatttt tgctgcactgtaataagggtgcgattctaaaagcaatatttttcgtcgca cataccgtcagttggtaaacccactgccccatTTTCAGCTTCATCCCTGA AAGCATTGAAAGTTGAGATGGTgagtaaaaagaaaatgaaggagaatgtt tgaaattttgattcgaATTATTTGTGAACTAGATACCGAGTGAGATTCGA ACTTGGGATCTCTCAGATATATTGAGTTGATCATAAGTTTGATTGGCAGG TTGTCAATCATCACGACAAGTtgtcgattagtttgattgatAGGCTGTCA ATCATCAGGACAAGTTGTCAATCATTTTAATGAGGATTTTAATGTTAAAA GTCAATAGTTCTGgttcgcagacctctatagatttACTTCCTATAAACAC GGACAGGGGAAATTTTAACAGCCTCAGTTTAAACACGCCAAGAAATTTTA ATTCAAGTgggtttttgaatttctttctctGTACCACCAGCAAAGAAGCG TAGCACCCATGCAAAGGCCAAAAAGTCATTTTACATAGTTTctttttata caaattatataAATCGAAAAGAGCCTtgttattcttaaaattttctcaat tttgttCCTTAGAATATTCTTAAGTTAAGTTTCAAGAGATTCTTGAATTT TAAAAGAAGGgcaacaaaactttttttagataccgggtgtcccagaaaaa agttatATTAGGccttttttcaatgtttttgcagaattttttaaaattgc ctttatattttttcagctCTTCATATCATTGTTTtacattttatgaaaat tatttattaaaacCATTATATTAACCAACCTATTGACGAAGTcgtaaaac tcttaaaaagagTGTCATTATCGAATTAATTGCTTAAAATTTGATACCCt cgtttttgaccatttttgacgATTTTCTGAAATCacataaaaagtttttt ctttgcaACCTTTTGAATATTGATCAGACTTTTTATgtatgatacatcaa aatttaagttagccttTCCTCTtatgcaaaaagattttttccaaaattcc cAATACTTTTCGAAAATATTCATCTCAAAAAGGGGGcctttttctgggac acccggtataaTATAATCGAGATAGATGGATATAATCGGCtcattttctt attcttttaaaaaaggatTCTTGTAAAGAGAAAGCTCAGTAAcggtcttc tttttttcttttttcagcatGAGATATACCTTCATCGACTGGATAGCGGT GAACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTC CGGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAG TACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccagaggta ttttcatttttcaatttttattcctTTTGCCTATAGATCATTTATGATCA CAGATTTCTCATACAatggactctcgctaattcgaacttcttttaCTCGA AtctctctataactcgaattcATTCTTGGttcccgtcaaggagaaaccct tataaaatactttctattattcgaatccttctctaattcgaacaaattag actCTCCactcgagttcgaattagcaagGGTTAAActgtataaaacacta gatcAGGCTACTCTGTCCCTAGCTGAAACAAAATAATGTGCCATCTTTGC TGAATACCGTTCTCTCGTCTCCTCGTTTCCCGCCAAGTCAGTTGTTTGTT CTGtttgaacaaattgccggtaccgaactgGTTTActcagcaaagatggc gcaCTGTTTTCACTGCTTCAATTGACGTAGCTTGAGAAAGACAGGGTAGC TCTAACTATCTTATGTTTTATATAAGGAAtggtaaaatattttgagaGGG AGATACCTGTGTATTTAACGTGTCTCCTTACATTTGCTtacataaaattt ttgaaacaaaagaatgaaCAACTTTTTCTCCCTTCTGGTTAAGGTTATAA AAACAATTTGTTCATTCTGCTTCGTCAGCATAATAGGCGCGCGCCTTCTT TCCATATCATTGAATAGtgagttttcttttattttgtagaTTTATTACGA AATTTAGAAAAAGACACACAGAgaagtagctctatctagtgttttatata agatatctttGCTTGTGATACTGTGTGCAAGGAAACGCTAAAATATGATG AAGAAGAGATATCTGTGTTAAATACTTGTGcgcgttttgttttgttttgt agaTTTATTACGAATTTTAGACAGaaacagagtagctctatctagtgttt tatataagatatttaTGCTTGTGATGCTGTGCAAGGAAGAAACGCTAAAA TATGATGAAGAAGAGAATATTTGTATATCTGTGTATTATTTTGTAGGTTT ATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAA CAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTT CtacaaaaaggtaaattttCAACTTCAGTCCAGGAGGTAGCTAGGCAAGT GaaggtacgggtatgtgccgtcCTTTTGGAACCTGGCAGTCCATGTAAGG Gttcgaaaaatcagaaaattaaatttcaatctcactaagggtcggaaaaa taggaaaaggtCATTTTTTGCCCCTTAAAACatggaaatttggtcaaatt agtcacCCCTCCCCCTTTAAAAGTCGTAAAATTCAccaattttctaattt gttaTCCTTTTATCCTTTTGAGGGTCGAACTCAAAAGCGGGGTGGCACCC CTCCCCCGTCATCCTTTTGTTTGGACTGAGTCGTTTATATTATGTGTAAT acagttctcaacttcagttgagctagaatctgacaatgtctgtatgtatg tatgtatgtccgttcgaaaactttggggcagcctggagacttcaaaaatt gttcgatttggctgaaattttgtacacttgttccttgggtgaatatctgg gaaagtttctttcatttttcaaaaattttgatttttggggtctggagacg agtttttcgccaaaacgaggctagaactttggggcagcctggagacttca aaaagttgtttgatttggctgaaattttgcacacttgttccttgggtgaa tatctgggggtctacaattgggcctatgaatagtttgaaggcactgaagt tgagcccagtgcgttgcgcacgttcgactataacTAAGTGTTATATGATA ATTCGATAATCATTCATTACTGGACAATATTAGTTTGTATaatcatggaa ttattatagacactggaaaaacaatgagctgatttttgccaatttctcat gtacaagccttgtccgcagtaatgacattattgttcacccNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttcaccctccttccacc attaaatgattttccgtattattttaattgcatttctcatcaaaatacac ttatccaattcccaaatgagactttaagttcctttccgagattcaaactc gtctagttaattactaattatacgtcgttctgacgttttaaatttcgaga aagatggaaaaacatgttatgtataagaaattgaatattgNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGCTATGA GACTCACAtctaatatatgtcaatctcagctcttctcggagaaatattgg aaagatattcccaattcaaaatttcgtgtcattataagcattttcttggT TTTACTCAACTGATGattttttctcacaccagatttcataaatgtatccg tttggtattctagcatttattttcaaacttttggccagcaaaagtacgat tagaaaaagtagaaatttagaaattagagtattaatcatttttcaaaatc agagtccttcgagccgtCATGACAGTTGTCCAaatgtcctttgcggacaa agctagaacatcaattgttttctaaaataatagaaagacaatacttctct ctccaccgtttcatttcctgagtctctataataaatccatggtaTAATAG AAGAGATTACTTAAAACATGAGACATAAACAGAATGAACATGAATATGCC CATGGTTGGCCCAACGctttgatttttggacctaccccggtggggtggag gtcctataaattaacttgaaaagaaatttacgcgcattttaacttttctc gactgtacgtctgaatgaaccacaatggcattcctttacttttcttttga ccaacaacatagaagattttgcttgagaagtgcaatcaNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATGTCcgtatattttg cctacaatctaagatgtctgcgacattattagaaaaggtctatttagtga ataataatcatgacatatatcgttataagaaagaaactaNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNttattttttaatgtttaatctt taaagcattaaagctttataagtgcatgacatgatctttatgtgggggca tttagtgaaagctatgactagtttaattttttttagatgaaaatgtcacg gtggagggcaatggtttgagttttctagaaacacttataattttttggct gaaaaacgaatctttatctataagaatcactatttataagcatagatcaa tgttcttagccaaattattattttgtgtcacggtagagcgcgatggtttg agtattctggaaaccttatttattaagctgtgcattaaattctgatagtg gattgtttttataaagaaaagcgtttcatagcttttttatttctttttca aaaatctttcaatagtgttgatagtttctcccaatagatatgttttcatt tttctttatttttttgtattttgaccagttatgtcttatgtgtttcattg tttcaatattAATTGATTAGtatgataaccaggtaggtaaaagtatcact tgttttcatccagatttgggaTGAATATCTAATGAGCTTTTAGAGCGCGT TGATTCGCCAAAGCAAAATGATCGCACCAAAATCAACTGTCAATCATATA CATGAACAATGCATAAACATTAGAACTCTTTAGAACGCTTTAACTTAAtt ttcacgcaaaaaaatttcgaatgttttggctgaacaaccaggtcagataA TCAAATTCGCCACATCCTCTTAGCACAAAACATGCgtagaatggatgatc tgttatgagattaaccctttaagtgccaatgtcgagtatattaagcaaaa gattttcgaatgttttggctgaacaaccaggtcagatcaTCAAATTAGCC ACATCCTCTTAGCAGAAAGCgtgcgcagaatggatgatctgttatgagat taacCCTTTAGTACCAATGTCGAGTatattaagcaaaaaactttcgaatg ttttggctgaacaaccaggtcagatcaTCAAATTAGCCACATCCTCTTAG CAGAAAGCgtgcgcagaatggatgatctgttatgagattaacCCTTTAGT ACCAATGTCGAGTatattaagcaaaaaactttcgaatgttttggctgaac aaccaggtcagatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgtgc gcagaatggatgatctgttatgagattaacCCTTTAGTACCAATGTCGAG Tatattaagcaaaaaactttcgaatgttttggctgaacaaccaggtcaga tcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgtgcgcagaatggatg atctgttatgagattaacCCTTTAGTACCAATGTCGAGTatattaagcaa aaaactttcgaatgttttggctgaacaaccaggtcagatcaTCAAATTAG CCACATCCTCTTAGCAGAAAGCgtgcgcagaatggatgatctgttatgag attaacCCTTTAGTACCAATGTCGAGTatattaagcaaaaaactttcgaa tgttttggctgaacaaccaggtcagatcaTCAAATTAGCCACATCCTCTT AGCAGAAAGCgtgcgcagaatggatgatctgttatgagattaacCCTTTA GTACCAATGTCGAGTatattaagcaaaaaactttcgaatgttttggctga acaaccaggtcagatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgt gcgcagaatggatgatctgttatgagattaacCCTTTAGTACCAATGTCG AGTatattaagcaaaaaactttcgaatgttttggctgaacaaccaggtca gatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgtgcgcagaatgga tgatctgttatgagattaacCCTTTAGTACCAATGTCGAGTatattaagc aaaaaactttcgaatgttttggctgaacaaccaggtcagatcaTCAAATT AGCCACATCCTCTTAGCAGAAAGCgtgcgcagaatggatgatctgttatg agattaacCCTTTAGTACCAATGTCGAGTatattaagcaaaaaactttcg aatgttttggctgaacaaccaggtcagatcaTCAAATTAGCCACATCCTC TTAGCAGAAAGCgtgcgcagaatggatgatctgttatgagattaacCCTT TAGTACCAATGTCGAGTatattaagcaaaaaactttcgaatgttttggct gaacaaccaggtcagatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGC gtgcgcagaatggatgatctgttatgagattaacCCTTTAGTACCAATGT CGAGTatattaagcaaaaaactttcgaatgttttggctgaacaaccaggt cagatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgtgcgcagaatg gatgatctgttatgagattaacCCTTTAGTACCAATGTCGAGTatattaa gcaaaaaactttcgaatgttttggctgaacaaccaggtcagatcaTCAAA TTAGCCACATCCTCTTAGCAGAAAGCgtgcgcagaatggatgatctgtta tgagattaacCCTTTAGTACCAATGTCGAGTatattaagcaaaaaacttt cgaatgttttggctgaacaaccaggtcagatcaTCAAATTAGCCACATCC TCTTAGCAGAAAGCgtgcgcagaatggatgatctgttatgagattaacCC TTTAGTACCAATGTCGAGTatattaagcaaaaaactttcgaatgttttgg ctgaacaaccaggtcagatcaTCAAATTAGCCACATCCTCTTAGCAGAAA GCgtgcgcagaatggatgatctgttatgagattaacCCTTTAGTACCAAT GTCGAGTatattaagcaaaaaactttcgaatgttttggctgaacaaccag gtcagatcaTCAAATTAGCCACATCCTCTTAGCAGAAAGCgtgcgcagaa tggatgatctgttatgagattaacCCTTTAGTACCAATGTCGAGTatatt aagcaaaaaactttcgaatgttttggctgaacaaccaggtcagatcaTCA AATTAGCCACATCCTCTTAGCAGAAAGCGTGcccagaatggatgatctgt tatgagattaacCCTTTAGTGCCAATGTCGAGTATATTaagcaaaaaatt ttcgaatgttttggctgaacaaccaggtcagataATCAAATTCGCCACAT CCTCTTAGCAGAAAGCgtgcgcagaatggatgatctgttatgaagTTACA AGCTAGCAAATTTGTACCTTTATGGGTTATAATTAATCGGGGAATAACTT CGTCGGAGAGAAAGTTGTCTTTCTTTAACAAAATGTTAAACTATTCCTCA TTTTCTCTCAAATGTTTTACTTCCAGGGCATAACTCTAGATGGTAACAAC CCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCG TTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATACG CTGTAGCCAATATCAGAGGTGGAGGGTgagtttttttgtgttttataGAG TTTCTTATTCTTTTGAGTCctacatcagttgaaactaactcgaatcgcat tttaacgaGAATTTTCCGTAAAATTAGTTTTACAAAATCAACGGATCAGC CTctgtctgttcttataaagttataaattgatgttttttgcttccaatga tggtacatcaaatgaaagccgctttgaatagatttatgaAAGATTTGaac gaccatttaggtcattaccgaggttttctctccatctttatctctttaac ttaatgTTTGTATTAAAACTACAATTTGTCATTTTCATTATTTGTTGCTT ATTTTTTACTACAGGCAGGCATATTTCCAGGGGTCTTCTGCTACCGGATA ACTGTAGCAGAAACTGAATCTTTAATTGAGTTTTGGAACTCAATCTATAT GAGAAATAAAATTAGCTATGGAAAAAGGTATAAATGAgtgaaaaatatct tcaaatattTGATATTATTGCACTTAATTCCGCAAAAAGGCATAAGTTTC TTGGGGCTTTAATATACCGTGGACCACTCCAGGACTGTCCTGGAACAGTT GGGCTGTTTACAAGGCCCCTGCCCTCCTGTCTGCTATTTTCGAGCCCAAG GCACATTCtgaaactcaattttttgattaaaaacggtAGCAGCTCCAAAT CCTGGAAATTTGcctgtacagggtgtccggaaaaaagtacCGAGTTCGAA CATtattctgagtagaaggttgttgcgtgtgtttaacaaataataagaaa atatataccaacacaataattgtctttacaacagtcattatgattaaaaa gaattaactttcttcacaattttcataacgttaaagttattgagaattgt tttttgtaattcaTAAAAGATTTCTCATGACAAGCaatatgacacagaga gaaattttgataaacactgcaaatttagtgaaacacacacaagaactttc tttctatagaagtggtaccactcgatactttttttccggacaccctgtat gtcTGAGTTTATcatctagcatgctagactaggGTACACTTTCATTAGTG CATAGTTTTTACTGTTATATGCTTTTTAATAAAACGAGAAActtatgctg aaaaatatttctcgaaatgttttttgaatcataattttcttcttcatttt cagtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAAC AAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCAAGAG AAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACGGTGG CCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCG TAGTCGCACATGTCAGGTTGGGAATCTTATAATTTTATTACACTTTAGAT CTTTATTCAGTGTTCAAAGTCTTTCGGCTTGGACGGATTTTCGTCTGAAT GAAGTTCGAACAAAGGCAAATCTCTATATACAGCTAAATTTTAAATAATC AAATATGAAGAAGTCCATTTTTCGTTTGACCAATCAAGATTGGGATAGAT TTGACAGCACGGCTGCACTTATATAAAGACCAACACAAAGGAATTCCATC GAACATATTTTATTGAGAGTTCTTAATCCCTTTAATCCCTCTTAAAAATT CCgttacaacccccccccccccaacccccTTCCCTGCTACCTCTTTTAAC TGCGTGAACTTTGAATTTTCAGTGTGTGCGACATGTTGAAGTTCCACAAA TTCACCATCGGGCATGCGTGGTAAGGGtatttttcttcttatttttcatc TCTTTTTCGAAATGTCTCGTCATATTGGTACATGTAATTCATACATTAAT GTGAGAAATTTTTGCGATTTAGGGAATTTCAGCGAATCCGCGAAATTAAT TGGATCTGGAAGTCTGTTCTCGATAACAAAATAGAGCTCCAAACCTTTCA AAAACTCTAATTGAACCAATCCTTCTTTATGGGTCCGAAACCTGGAGTAC AGCTTGACCTATTCTCTACCAGTCTCATCCAGTAGTTTGAAAGCATATTC TGAATATATTCTGTTTCTCATCTTTCGACAGGATCACGGATTTCGGATGC GCCGACAAGAAGGAAGATTTTGAATACCTTATCAAGTAAGTAAAATACTC TAGAATCAAACTTCAGTAACTCAAAAAAGGCTGTGGTTGAAATTTCCTTA TGGGTTCAAGAACCACAAAAAAAGCTTCAGttgatttgaaactttttttt tcacctttttaaaaatttaaaatcaccTAATcgcttttcaaacatttttc aaaaacttcaagAATCGCGAGACTCACTACGATTTATGTGATTATCATTT AGATATCTGAAAGTTGTATGCTCCTTATATTCCATGAGTGgagggcaaat ttttttaacTCTGAATCTGATTTTACCATGACGAGGGcgtctaattccga catccATCTTTAGGGCAAACTATATTGCTTTGCTTAGCTtcagaaagaaa gaaatcgTTTCTCCAATCAGCGATATCGactttcctattattcctatctc taaagaagggtgtcggaattagatgaggaatgtcgacattagacgAACAT ACggttttctttatctttaagaTACTCTCCCCTGCACACGATCAAATCGC ACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGAC GATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAATA TACAGTCGGCAAAAATGAACATCAGGTATCTggatttttcataatttata agaaatttttcgatttccagACCACTATTCTTTTAACACAAAACGTAGGA GCAATCCTGcctcaaattcaaaaagaagaaaaaagccgTACGGGAAGTTT GAATAGTGAATACTAATTCAAACACTCGAAAGGTAAACAAAATTCTAGGT AGGCTTTTTCTACTACTGTAAACGAActtttgagtaaaactgatgTTTTA GTAGTCTAGCTCTAGACTAAGAATCTTACGGTTGGCTGAAGTGGTCGAGA CTCAGATCAAGGGTGTTGAATGCACCAGTGAAATCAGTGAAAGTCATTCA TTTGAACAGATCTGGAAAAcgagttttctttttcaaaaacgtTAAAGAAA TCTTTGAGTGTGCAGTTCTGAACGAAAAATGTATATagacttttgcaaaa aattccACCCGGTTCGATTTTTAATTGACCTAGCTTTTGGGGGTATGTAC CAAACTCAATAACTTGATTTGGTAAAAATGGGTTTTAAAAGTTTACTTAT acctttttcattgattttttaaaagtatatCTTTTTGTCCAGGACCATGC CAAGTATTTTCCATGATCTTTTTATCTAAAGATGATTATAATATAAGAGC TCTGAGTATAGTGAATTTTCATACTTTCTATTTACAAGGTGTAAATTTCC GCTCGATCtctcgaacaaataagattccgcCGTTCGAGTTCGATTAAGCG AGATTTTACTGTATGGTTTTTCGTATCTTTATGAATCTTACTTACTTTAT GAGTTTCGAAACATCAGAGTTGCAACTTTTCCGTCTGTAGTTGAGATTCT TCACTAGGATTATTTTCCGACCTCGGTTATGGATcttgaaagaagaaatt ttgcgTCTGGTTTTTGTACGTGCTGTCTAAATCACAAAATTTGGTTGTAA CACCGTATCATTTTagagtttataaaaaaaattgaaagcagTTGTTTGTT AAAAGTGCAAATGAACATTTGTTAAAGGCTTTGATAATCAATCTTCTCGC TTTTGTTAAAgctcgaaaaaaaatctggttACTTAGAGAAATGGTGAAAA ATATTCGTCggtgaaaaatgaagaaatcttTTGCCGGCAATCTTTTTTTC ACCGGTAAATTTTCTACCGATAAGTTGttttagttttgtttgttttgcaa AAACTTTATTCTGACACTTtcgtgtttttattttcagaccAATCCATTGT TACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCT AAAATTGTAAGTACAATTCAATTCTATTTGCGATTGACCTGATGTCATta tcactgacctttatgtACCCAGGGCCCAGTTTTTTTATCCCGACCataca aaatctttgatcgatgtcttttttgaaagtggctactcgatagacctttt cataaattacgtcacgaacatcacttgcctcgtattcaaacaattaccat ggtgattatgtcccttgagacaataaatgattttttaatgaatggaaagt agttttaataaaatccgcttggagttaatcaccatgacaataattccaaa acgaggcaagtgatgttcatgacgtaatttatgaaaaggtctattgctgG TGAAAAAATTTAAACGTAAAGTTTcattgaattaaaaattgacCCACATC GAGTAGTGCCTTTTCAAAAAGCTcagatcaaagatggcggatatagcttg gtctagggtatataaaggtcaaatGCCTTGTAGCAAGAATTCAAATTAGT ATTTCTTCGAATGACCAAAAATATGTGATAATTTTCTGCCCAACAATTTC AACAACTCCGACTCAGTAAccagtaagttttttttttggtaatttgggaa aaatcaaaGTGTTAAATGTCATTTTGGATAGAGAATCTCTCGTCATTTCT TTCGTTTAcaaacccctgtctcacagccccgttaaaaattttcccacagC AGGGATGAAAATGTCCATCTAAATCTCAATTGGGACGATAGCAATTTTAT TATTCCTAAGTCGAAAAATCAAGTGGGATGATTTcaaatgggaataaaat caaagtcaattgtGGGGGCTCAAAGTGGGGCATAAACTGTAGGGTAATTT TCCCAACAGAaacaaaattttggtcaaattttccagtggggttggAGTTC CAGCGGGTCTGTAACACAGGGGTGTGTTTACAAGTACGAATTAGATTTCC AGGAATTCTAATGTCATTTCAAATGAGAAGAAATTTCAGGGTATATTTTG CTTTATAATTtagatttatcaaaaaattttgatgttttagtTCTGCGGCA TAGTATTAGAATTTCGTTTCGTTTTTCATCATTTGCTTTTacagtaattt ttttatttcttttttaaaaattgacagATTTCGGAAAATGCTGACGTATT CGGTTTCATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAATCAT GTTGAAGTTGAGTTTTTCCAAAAAGAATCGGTTACTCTCTTTTGAGAAGA TGTTTCATACCCAACCAATCCACTAGGAATTCAAGACACTTTTAGCTTCA AAAACCCCTTCAGACTTCTGATT

Coding sequence (CDS) from alignment at sc0000001:144882..172204+

>TCONS_00000009 ID=TCONS_00000009|Name=TCONS_00000009|organism=Clytia hemisphaerica|type=CDS|length=40356bp|location=Sequence derived from alignment at sc0000001:144882..172204+ (Clytia hemisphaerica)
ATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGA
CGATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATC
CTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACT
AAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgAT
GACAAAGTTATACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTA
ATCGGTATTTTTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTT
TACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAA
TGCAATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAG
AAGATGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGG
AACACTATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACAT
TCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAG
GTGTTTTTTATAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACG
GAAGTGAATTCAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAAC
AGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAAT
GGATGATCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACG
GCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACA
AAAGTTAGATTACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGG
ATAATTTTGATGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTC
ACATTCCAAACGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGA
TATCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATG
AATTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTC
ATGTGTTATCTTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGA
TAGCGGTGAACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTG
GTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCG
TTCTTAGTACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaacc
agagGTTTATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACG
AAACTAAACAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATG
TTCATCTTCtacaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTAT
TTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTA
TCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCC
AATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATC
CCTGAGCAAGAAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAAT
ATCTTATCCAAGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGT
GGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGA
TCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGT
TCCACAAATTCACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCC
GACAAGAAGGAAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACAC
GATCAAATCGCACGATAACACACAATATCCTTGCATGATGTTGCTGACTG
CCGACCACGACGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCA
CAGTTACAATATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTT
ACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTA
AAATTATTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATG
AACGCTAAATGGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGT
GTGTCGAGACAATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCA
ACCCCTATCTATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTT
GTTGAAAAACAGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAAC
GAGAGATAAGTTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAAC
ATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACT
GGATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGA
TTCCAAAGTGTTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTG
CCATCTCGAGAGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGT
ATCAGCAAGAAGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGG
AGACCAACAAGAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCA
TTACATGGACGCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAA
GACGAGAGTAAACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAA
GCTATACTACCACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTG
CTGAAGCCCCTGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGAC
GAGGGCCGCTACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAA
CAGATTGTATATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTC
TACTGCCCTACGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGttt
ATAGCAAACGATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACC
TCGTTATCGTTTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATT
GGGAAAGTTTGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACG
GTGGTCAATAAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGca
tGAGATATACCTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTG
ATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACG
GAAATGTTTTACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCG
atatgatttcaaaacaaatgaaccagagGTTTATTACGAGACAAAGATCG
AAGGATTCGATGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGT
AAAGATGGAACGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAAC
TCTAGATGGTAACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACA
TTTCAGAGACGCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAAC
TACGACGGAGTATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGG
TGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTG
ATGACTTCATTTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCC
AAAGACAAACTTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTAC
ATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATG
TCAGTGTGTGCGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCG
TGGATCACGGATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCT
TATCAAaTACTCTCCCCTGCACACGATCAAATCGCACGATAACACACAAT
ATCCTTGCATGATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCT
TTACATTCCTTGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAA
TGAACATCAGaccAATCCATTGTTACTGCGAATTGATACTGAGAGTGGAC
ACGGTGCTGGAAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTA
TTCGGTTTCATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAAT
GACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACG
ATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCT
GACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAA
GTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGA
CAAAGTTATACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAAT
CGGTATTTTTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTA
CGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATG
CAATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAA
GATGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAA
CACTATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTC
TGGAGAACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGT
GTTTTTTATAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGA
AGTGAATTCAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAG
AACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGG
ATGATCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGC
CAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAA
AGTTAGATTACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGAT
AATTTTGATGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTCAC
ATTCCAAACGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATA
TCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAA
TTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCAT
GTGTTATCTTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGATA
GCGGTGAACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGT
TTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTT
CTTAGTACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccag
agGTTTATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAA
ACTAAACAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTT
CATCTTCtacaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTT
TGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATC
ACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAA
TATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCC
TGAGCAAGAAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATAT
CTTATCCAAGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGG
CTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATC
TCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTC
CACAAATTCACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGA
CAAGAAGGAAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGA
TCAAATCGCACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCC
GACCACGACGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACA
GTTACAATATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTAC
TGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAA
ATTATTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAA
CGCTAAATGGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGT
GTCGAGACAATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAAC
CCCTATCTATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGT
TGAAAAACAGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGA
GAGATAAGTTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAACAT
GGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGG
ATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATT
CCAAAGTGTTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCC
ATCTCGAGAGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTAT
CAGCAAGAAGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAG
ACCAACAAGAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATT
ACATGGACGCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGA
CGAGAGTAAACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGC
TATACTACCACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCT
GAAGCCCCTGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGA
GGGCCGCTACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACA
GATTGTATATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTA
CTGCCCTACGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttAT
AGCAAACGATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTC
GTTATCGTTTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGG
GAAAGTTTGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGT
GGTCAATAAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatG
AGATATACCTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGAT
TTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGA
AATGTTTTACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGat
atgatttcaaaacaaatgaaccagagGTTTATTACGAGACAAAGATCGAA
GGATTCGATGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAA
AGATGGAACGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTC
TAGATGGTAACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATT
TCAGAGACGCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTA
CGACGGAGTATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTG
AGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGAT
GACTTCATTTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAA
AGACAAACTTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACAT
CAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTC
AGTGTGTGCGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTG
GATCACGGATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTA
TCAAaTACTCTCCCCTGCACACGATCAAATCGCACGATAACACACAATAT
CCTTGCATGATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTT
ACATTCCTTGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAATG
AACATCAGaccAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACAC
GGTGCTGGAAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATT
CGGTTTCATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGA
CCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGAT
TTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGA
CTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGT
CAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACA
AAGTTATACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCG
GTATTTTTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACG
TGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCA
ATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGA
TGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACA
CTATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTG
GAGAACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGT
TTTTTATAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAG
TGAATTCAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAA
CAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGAT
GATCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCA
GCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAG
TTAGATTACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAA
TTTTGATGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTCACAT
TCCAAACGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATC
AACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATT
GGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGT
GTTATCTTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGC
GGTGAACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTT
CTCCGGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCT
TAGTACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccagag
GTTTATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAAC
TAAACAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCA
TCTTCtacaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTG
TATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCAC
TAGAACCATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATA
TCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTG
AGCAAGAAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCT
TATCCAAGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCT
CCAACGGTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTC
TTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCA
CAAATTCACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACA
AGAAGGAAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATC
AAATCGCACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGA
CCACGACGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGT
TACAATATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTG
CGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAAT
TATTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACG
CTAAATGGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGT
CGAGACAATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCC
CTATCTATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTG
AAAAACAGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGA
GATAAGTTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGG
CTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGAT
TGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCC
AAAGTGTTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCAT
CTCGAGAGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCA
GCAAGAAGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGAC
CAACAAGAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTAC
ATGGACGCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACG
AGAGTAAACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTA
TACTACCACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGA
AGCCCCTGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGG
GCCGCTACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGA
TTGTATATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACT
GCCCTACGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAG
CAAACGATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGT
TATCGTTTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGA
AAGTTTGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGG
TCAATAAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAG
ATATACCTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTT
GGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAA
TGTTTTACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatat
gatttcaaaacaaatgaaccagagGTTTATTACGAGACAAAGATCGAAGG
ATTCGATGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAG
ATGGAACGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTA
GATGGTAACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTC
AGAGACGCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACG
ACGGAGTATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAG
AAGTGGCACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGA
CTTCATTTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAG
ACAAACTTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCA
GTGGCCAATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAG
TGTGTGCGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGA
TCACGGATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATC
AAaTACTCTCCCCTGCACACGATCAAATCGCACGATAACACACAATATCC
TTGCATGATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTAC
ATTCCTTGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAA
CATCAGaccAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGG
TGCTGGAAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCG
GTTTCATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACC
AAACTAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTT
CCATGGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACT
CAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCA
GTACTCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAA
GTTATACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGT
ATTTTTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTG
CAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAAT
GGATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATG
GGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACT
ATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGA
GAACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTT
TTTATAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTG
AATTCAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACA
AAACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGA
TCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGC
GAAGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTT
AGATTACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATT
TTGATGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTCACATTC
CAAACGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAA
CAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGG
ATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGT
TATCTTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGG
TGAACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCT
CCGGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTA
GTACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccagagGT
TTATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTA
AACAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATC
TTCtacaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTA
TGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTA
GAACCATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATC
AGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAG
CAAGAAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTA
TCCAAGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCC
AACGGTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTT
CAAATGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACA
AATTCACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAG
AAGGAAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAA
ATCGCACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACC
ACGACGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTA
CAATATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCG
AATTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTA
TTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCT
AAATGGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCG
AGACAATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCT
ATCTATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAA
AAACAGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGA
TAAGTTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCT
GTCCGTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTG
CAAAACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAA
AGTGTTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCT
CGAGAGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGC
AAGAAGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCA
ACAAGAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACAT
GGACGCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAG
AGTAAACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATA
CTACCACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAG
CCCCTGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGC
CGCTACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATT
GTATATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGC
CCTACGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCA
AACGATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTA
TCGTTTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAA
GTTTGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTC
AATAAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGAT
ATACCTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGG
ATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATG
TTTTACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatga
tttcaaaacaaatgaaccagagGTTTATTACGAGACAAAGATCGAAGGAT
TCGATGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGAT
GGAACGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGA
TGGTAACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAG
AGACGCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGAC
GGAGTATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAA
GTGGCACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACT
TCATTTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGAC
AAACTTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGT
GGCCAATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTG
TGTGCGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATC
ACGGATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAA
aTACTCTCCCCTGCACACGATCAAATCGCACGATAACACACAATATCCTT
GCATGATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACAT
TCCTTGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACA
TCAGaccAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTG
CTGGAAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGT
TTCATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAA
ACTAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCC
ATGGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCA
GCAGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGT
ACTCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGT
TATACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTAT
TTTTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCA
AGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGG
ATTCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGG
GAATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTAT
TAAGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGA
ACGTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTT
TATAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAA
TTCAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAA
ACGAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATC
CATGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGA
AGGTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAG
ATTACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTT
GATGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCA
AACGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACA
AACCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGAT
GTCTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTA
TCTTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTG
AACGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCC
GGTCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGT
ACCTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccagagGTTT
ATTACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAA
CAAATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTT
CtacaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATG
GTTACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGA
ACCATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAG
AGGTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCA
AGAAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATC
CAAGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAA
CGGTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCA
AATGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAA
TTCACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAA
GGAAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAAT
CGCACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCAC
GACGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACA
ATATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAA
TTGATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATT
TCGGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAA
ATGGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAG
ACAATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTAT
CTATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAA
ACAGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATA
AGTTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGT
CCGTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCA
AAACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAG
TGTTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCG
AGAGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAA
GAAGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAAC
AAGAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGG
ACGCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAG
TAAACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACT
ACCACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCC
CCTGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCG
CTACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGT
ATATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCC
TACGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAA
CGATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATC
GTTTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGT
TTGGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAA
TAAGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATAT
ACCTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGAT
GTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTT
TTACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatt
tcaaaacaaatgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTC
GATGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGG
AACGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATG
GTAACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAG
ACGCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGG
AGTATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGT
GGCACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTC
ATTTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAA
ACTTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGG
CCAATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTG
TGCGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCAC
GGATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaT
ACTCTCCCCTGCACACGATCAAATCGCACGATAACACACAATATCCTTGC
ATGATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTC
CTTGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATC
AGaccAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCT
GGAAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTT
CATTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAAAC
TAACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCCAT
GGAAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCAGC
AGAAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGTAC
TCGAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGTTA
TACGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTT
TTATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCAAG
AAAAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGGAT
TCGAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGGGA
ATTATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTATTA
AGTTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGAAC
GTCAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTTTA
TAACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAATT
CAAACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAAAC
GAAGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATCCA
TGCGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGAAG
GTTGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAGAT
TACCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTTGA
TGCATCTTACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCAAA
CGAACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACAAA
CCGCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGATGT
CTTGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTATC
TTCATGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTGAA
CGGTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGG
TCGCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGTAC
CTGGTGTTATTTATCGatatgatttcaaaacaaatgaaccagagGTTTAT
TACGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAACA
AATCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTTCt
acaaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATGGT
TACGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGAAC
CATCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAGAG
GTGGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAG
AAACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCA
AGAGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACG
GTGGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAA
TGCGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAATT
CACCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAAGG
AAGATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAATCG
CACGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGA
CGATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAAT
ATACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAATT
GATACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATTTC
GGAAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAAAT
GGAAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGAC
AATGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCT
ATGGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAAC
AGAACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAG
TTCAATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGTCC
GTTTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCAAA
ACCAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTG
TTTCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCGAG
AGTATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAAGA
AGGGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAACAA
GAACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGGAC
GCACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAGTA
AACAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACTAC
CACAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCC
TGACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCGCT
ACGTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTAT
ATCTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCCTA
CGAGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAACG
ATGAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATCGT
TTAATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGTTT
GGTTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAATA
AGAATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATATAC
CTTCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGATGT
GGGTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTT
ACACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatttc
aaaacaaatgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTCGA
TGCATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGGAA
CGCGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATGGT
AACAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGAC
GCCTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAG
TATACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGG
CACAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTCAT
TTCTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAAAC
TTTGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCC
AATCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTG
CGACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCACGG
ATTTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaTAC
TCTCCCCTGCACACGATCAAATCGCACGATAACACACAATATCCTTGCAT
GATGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTCCT
TGAAATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATCAG
accAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCTGG
AAAACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTTCA
TTGGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAAACTA
ACTTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCCATGG
AAACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCAGCAG
AAACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGTACTC
GAAACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGTTATA
CGATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTT
ATTACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAA
AAACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGGATTC
GAAAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGGGAAT
TATGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTATTAAG
TTCATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGAACGT
CAAATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTTTATA
ACAAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAATTCA
AACCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAAACGA
AGATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATCCATG
CGGAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGAAGGT
TGCGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAGATTA
CCAAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTTGATG
CATCTTACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCAAACG
AACTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACAAACC
GCAACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGATGTCT
TGGAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTATCTT
CATGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTGAACG
GTACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTC
GCCGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGTACCT
GGTGTTATTTATCGatatgatttcaaaacaaatgaaccagagGTTTATTA
CGAGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAACAAA
TCTTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTTCtac
aaaaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATGGTTA
CGGAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGAACCA
TCTTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAGAGGT
GGAGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAA
ACAAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCAAG
AGAAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACGGT
GGCCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATG
CGTAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAATTCA
CCATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAAGGAA
GATTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAATCGCA
CGATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGACG
ATCGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAATAT
ACAGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAATTGA
TACTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATTTCGG
AAAATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAAATGG
AAAGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAA
TGAGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCTAT
GGTTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAG
AACGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTT
CAATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGTCCGT
TTCGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCAAAAC
CAAAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTT
TCTAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCGAGAG
TATCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAAGAAG
GGCTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAACAAGA
ACTGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGC
ACGATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAGTAAA
CAAGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACTACCA
CAAACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTG
ACAATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCGCTAC
GTTATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATAT
CTGTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCCTACG
AGAAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAACGAT
GAGAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATCGTTT
AATCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGG
TTGCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAG
AATATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATATACCT
TCATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGATGTGG
GTGCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTAC
ACTTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatttcaa
aacaaatgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTCGATG
CATCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGGAACG
CGAATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATGGTAA
CAACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGC
CTCGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTA
TACGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCA
CAAAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTCATTT
CTGCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAAACTT
TGTATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAA
TCAGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCG
ACATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCACGGAT
TTCGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaTACTC
TCCCCTGCACACGATCAAATCGCACGATAACACACAATATCCTTGCATGA
TGTTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTCCTTG
AAATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATCAGac
cAATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAA
AACCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTTCATT
GGAAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAAACTAAC
TTATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCCATGGAA
ACAAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCAGCAGAA
ACTAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGTACTCGA
AACGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGTTATACG
ATTATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTAT
TACCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAA
ACTTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGGATTCGA
AAGGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGGGAATTA
TGTGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTATTAAGTT
CATGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGAACGTCA
AATTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTTTATAAC
AAATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAATTCAAA
CCTCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAAACGAAG
ATATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATCCATGCG
GAGATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGAAGGTTG
CGATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAGATTACC
AAATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTTGATGCA
TCTTACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCAAACGAA
CTTGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACAAACCGC
AACAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGATGTCTTG
GAATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTATCTTCA
TGATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTGAACGGT
ACAAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGC
CGAGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGTACCTGG
TGTTATTTATCGatatgatttcaaaacaaatgaaccagagGTTTATTACG
AGACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAACAAATC
TTCTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTTCtacaa
aaagGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATGGTTACG
GAGGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGAACCATC
TTTGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAGAGGTGG
AGGtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAAC
AAAATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCAAGAG
AAATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACGGTGG
CCTATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCG
TAGTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAATTCACC
ATCGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAAGGAAGA
TTTTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAATCGCACG
ATAACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGACGAT
CGGGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAATATAC
AGTCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAATTGATA
CTGAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATTTCGGAA
AATGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAAATGGAA
AGAAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATG
AGGCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGG
TTGGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAA
CGACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCA
ATAAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGTCCGTTT
CGCAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCAAAACCA
AAGCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTC
TAGATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTA
TCTTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGG
CTCGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAACAAGAAC
TGCCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGCAC
GATCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAGTAAACA
AGACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACTACCACA
AACTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGAC
AATCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCGCTACGT
TATTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCT
GTGATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCCTACGAG
AAAATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAACGATGA
GAATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATCGTTTAA
TCCGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTT
GCAGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAA
TATTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATATACCTTC
ATCGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGATGTGGGT
GCGATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTACAC
TTTTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatttcaaaa
caaatgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTCGATGCA
TCACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGGAACGCG
AATACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATGGTAACA
ACCCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCT
CGTTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATA
CGCTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACA
AAGACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTCATTTCT
GCCGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAAACTTTG
TATTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAATC
AGCGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGAC
ATGTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCACGGATTT
CGGATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaTACTCTC
CCCTGCACACGATCAAATCGCACGATAACACACAATATCCTTGCATGATG
TTGCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTCCTTGAA
ATACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATCAGaccA
ATCCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAA
CCAACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTTCATTGG
AAAGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAAACTAACTT
ATCCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCCATGGAAAC
AAAATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCAGCAGAAAC
TAAAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGTACTCGAAA
CGTGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGTTATACGAT
TATCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTA
CCACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAAAC
TTGGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGGATTCGAAA
GGATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGGGAATTATG
TGCCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTATTAAGTTCA
TGAAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGAACGTCAAA
TTTAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTTTATAACAA
ATATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAATTCAAACC
TCAATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAAACGAAGAT
ATATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATCCATGCGGA
GATCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGAAGGTTGCG
ATCCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAGATTACCAA
ATTACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTTGATGCATC
TTACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCAAACGAACT
TGAATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACAAACCGCAA
CAGGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGATGTCTTGGA
ATGGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTATCTTCATG
ATGTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTGAACGGTAC
AAACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCG
AGAGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGTACCTGGTG
TTATTTATCGatatgatttcaaaacaaatgaaccagagGTTTATTACGAG
ACAAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAACAAATCTT
CTTCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTTCtacaaaa
agGGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATGGTTACGGA
GGGTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGAACCATCTT
TGTCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAGAGGTGGAG
GtgAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAACAA
AATTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCAAGAGAA
ATACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACGGTGGCC
TATTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCGTA
GTCGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAATTCACCAT
CGGGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAAGGAAGATT
TTGAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAATCGCACGAT
AACACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGACGATCG
GGTCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAATATACAG
TCGGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAATTGATACT
GAGAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATTTCGGAAAA
TGCTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAAATGGAAAG
AAATTTAAATGACCAAACTAACTTATCCTGAAGTGTGTCGAGACAATGAG
GCTATTGACGATTTCCATGGAAACAAAATCCCCAACCCCTATCTATGGTT
GGAAGATCCTGACTCAGCAGAAACTAAAGAGTTTGTTGAAAAACAGAACG
ACTTAACTAAGTCAGTACTCGAAACGTGTGAAACGAGAGATAAGTTCAAT
AAAAGgATGACAAAGTTATACGATTATCCAAAACATGGCTGTCCGTTTCG
CAGAGGTAATCGGTATTTTTATTACCACAACACTGGATTGCAAAACCAAA
GCCCCCTTTACGTGCAAGAAAAACTTGGTGGGGATTCCAAAGTGTTTCTA
GATGCCAATGCAATGGATTCGAAAGGATTGATTGCCATCTCGAGAGTATC
TTTCTCAGAAGATGGGGAATTATGTGCCTACAGTATCAGCAAGAAGGGCT
CGGACTGGAACACTATTAAGTTCATGAAAGTAGGAGACCAACAAGAACTG
CCAGACATTCTGGAGAACGTCAAATTTAGTTGCATTACATGGACGCACGA
TCATAAAGGTGTTTTTTATAACAAATATGATAAAGACGAGAGTAAACAAG
ACGGAACGGAAGTGAATTCAAACCTCAATCAAAAGCTATACTACCACAAA
CTGGGAACAGAACAAAACGAAGATATATTGGTTGCTGAAGCCCCTGACAA
TCCCAAATGGATGATCCATGCGGAGATCAGTGACGAGGGCCGCTACGTTA
TTCTGACGGCCAGCGAAGGTTGCGATCCAGTCAACAGATTGTATATCTGT
GATTTACAAAAGTTAGATTACCAAATTACAGGTCTACTGCCCTACGAGAA
AATTGTGGATAATTTTGATGCATCTTACGAGtttATAGCAAACGATGAGA
ATATTTTCACATTCCAAACGAACTTGAATGCACCTCGTTATCGTTTAATC
CGGATTGATATCAACAAACCGCAACAGGAGAATTGGGAAAGTTTGGTTGC
AGAACATGAATTGGATGTCTTGGAATGGTGTACGGTGGTCAATAAGAATA
TTCTTGTCATGTGTTATCTTCATGATGTCAAGcatGAGATATACCTTCAT
CGACTGGATAGCGGTGAACGGTACAAACGTATTGATTTGGATGTGGGTGC
GATTGGTGGTTTCTCCGGTCGCCGAGAGCACACGGAAATGTTTTACACTT
TTGCTTCGTTCTTAGTACCTGGTGTTATTTATCGatatgatttcaaaaca
aatgaaccagagGTTTATTACGAGACAAAGATCGAAGGATTCGATGCATC
ACTGTACGAAACTAAACAAATCTTCTTCGACAGTAAAGATGGAACGCGAA
TACCCATGTTCATCTTCtacaaaaagGGCATAACTCTAGATGGTAACAAC
CCTTGTATTTTGTATGGTTACGGAGGGTTCAACATTTCAGAGACGCCTCG
TTTCAGTATCACTAGAACCATCTTTGTCAGCAACTACGACGGAGTATACG
CTGTAGCCAATATCAGAGGTGGAGGtgAATACGGTGAGAAGTGGCACAAA
GACGGATCCCTGAGCAAGAAACAAAATTGCTTTGATGACTTCATTTCTGC
CGGGGAATATCTTATCCAAGAGAAATACACTTCCAAAGACAAACTTTGTA
TTACTGGTGGCTCCAACGGTGGCCTATTGGTTACATCAGTGGCCAATCAG
CGTCCTGATCTCTTCAAATGCGTAGTCGCACATGTCAGTGTGTGCGACAT
GTTGAAGTTCCACAAATTCACCATCGGGCATGCGTGGATCACGGATTTCG
GATGCGCCGACAAGAAGGAAGATTTTGAATACCTTATCAAaTACTCTCCC
CTGCACACGATCAAATCGCACGATAACACACAATATCCTTGCATGATGTT
GCTGACTGCCGACCACGACGATCGGGTCGTCCCTTTACATTCCTTGAAAT
ACATGGCACAGTTACAATATACAGTCGGCAAAAATGAACATCAGaccAAT
CCATTGTTACTGCGAATTGATACTGAGAGTGGACACGGTGCTGGAAAACC
AACCTCTAAAATTATTTCGGAAAATGCTGACGTATTCGGTTTCATTGGAA
AGATGATGAACGCTAAATGGAAAGAAATTTAAATGACCAAACTAACTTAT
CCTGAAGTGTGTCGAGACAATGAGGCTATTGACGATTTCCATGGAAACAA
AATCCCCAACCCCTATCTATGGTTGGAAGATCCTGACTCAGCAGAAACTA
AAGAGTTTGTTGAAAAACAGAACGACTTAACTAAGTCAGTACTCGAAACG
TGTGAAACGAGAGATAAGTTCAATAAAAGgATGACAAAGTTATACGATTA
TCCAAAACATGGCTGTCCGTTTCGCAGAGGTAATCGGTATTTTTATTACC
ACAACACTGGATTGCAAAACCAAAGCCCCCTTTACGTGCAAGAAAAACTT
GGTGGGGATTCCAAAGTGTTTCTAGATGCCAATGCAATGGATTCGAAAGG
ATTGATTGCCATCTCGAGAGTATCTTTCTCAGAAGATGGGGAATTATGTG
CCTACAGTATCAGCAAGAAGGGCTCGGACTGGAACACTATTAAGTTCATG
AAAGTAGGAGACCAACAAGAACTGCCAGACATTCTGGAGAACGTCAAATT
TAGTTGCATTACATGGACGCACGATCATAAAGGTGTTTTTTATAACAAAT
ATGATAAAGACGAGAGTAAACAAGACGGAACGGAAGTGAATTCAAACCTC
AATCAAAAGCTATACTACCACAAACTGGGAACAGAACAAAACGAAGATAT
ATTGGTTGCTGAAGCCCCTGACAATCCCAAATGGATGATCCATGCGGAGA
TCAGTGACGAGGGCCGCTACGTTATTCTGACGGCCAGCGAAGGTTGCGAT
CCAGTCAACAGATTGTATATCTGTGATTTACAAAAGTTAGATTACCAAAT
TACAGGTCTACTGCCCTACGAGAAAATTGTGGATAATTTTGATGCATCTT
ACGAGtttATAGCAAACGATGAGAATATTTTCACATTCCAAACGAACTTG
AATGCACCTCGTTATCGTTTAATCCGGATTGATATCAACAAACCGCAACA
GGAGAATTGGGAAAGTTTGGTTGCAGAACATGAATTGGATGTCTTGGAAT
GGTGTACGGTGGTCAATAAGAATATTCTTGTCATGTGTTATCTTCATGAT
GTCAAGcatGAGATATACCTTCATCGACTGGATAGCGGTGAACGGTACAA
ACGTATTGATTTGGATGTGGGTGCGATTGGTGGTTTCTCCGGTCGCCGAG
AGCACACGGAAATGTTTTACACTTTTGCTTCGTTCTTAGTACCTGGTGTT
ATTTATCGatatgatttcaaaacaaatgaaccagagGTTTATTACGAGAC
AAAGATCGAAGGATTCGATGCATCACTGTACGAAACTAAACAAATCTTCT
TCGACAGTAAAGATGGAACGCGAATACCCATGTTCATCTTCtacaaaaag
GGCATAACTCTAGATGGTAACAACCCTTGTATTTTGTATGGTTACGGAGG
GTTCAACATTTCAGAGACGCCTCGTTTCAGTATCACTAGAACCATCTTTG
TCAGCAACTACGACGGAGTATACGCTGTAGCCAATATCAGAGGTGGAGGt
gAATACGGTGAGAAGTGGCACAAAGACGGATCCCTGAGCAAGAAACAAAA
TTGCTTTGATGACTTCATTTCTGCCGGGGAATATCTTATCCAAGAGAAAT
ACACTTCCAAAGACAAACTTTGTATTACTGGTGGCTCCAACGGTGGCCTA
TTGGTTACATCAGTGGCCAATCAGCGTCCTGATCTCTTCAAATGCGTAGT
CGCACATGTCAGTGTGTGCGACATGTTGAAGTTCCACAAATTCACCATCG
GGCATGCGTGGATCACGGATTTCGGATGCGCCGACAAGAAGGAAGATTTT
GAATACCTTATCAAaTACTCTCCCCTGCACACGATCAAATCGCACGATAA
CACACAATATCCTTGCATGATGTTGCTGACTGCCGACCACGACGATCGGG
TCGTCCCTTTACATTCCTTGAAATACATGGCACAGTTACAATATACAGTC
GGCAAAAATGAACATCAGaccAATCCATTGTTACTGCGAATTGATACTGA
GAGTGGACACGGTGCTGGAAAACCAACCTCTAAAATTATTTCGGAAAATG
CTGACGTATTCGGTTTCATTGGAAAGATGATGAACGCTAAATGGAAAGAA
ATTTAA
Relationships
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000006XLOC_000006Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000009-proteinTCONS_00000009-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000009-exon-sc0000001-1491911889:144882..145135TCONS_00000009-exon-sc0000001-1491911889:144882..145135Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:144882..145135TCONS_00000009-exon-sc0000001-1510915933:144882..145135Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:146212..146307TCONS_00000009-exon-sc0000001-1491911889:146212..146307Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:146212..146307TCONS_00000009-exon-sc0000001-1510915933:146212..146307Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:147369..147537TCONS_00000009-exon-sc0000001-1491911889:147369..147537Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:147369..147537TCONS_00000009-exon-sc0000001-1510915933:147369..147537Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:148295..148396TCONS_00000009-exon-sc0000001-1491911889:148295..148396Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:148295..148396TCONS_00000009-exon-sc0000001-1510915933:148295..148396Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:148553..148615TCONS_00000009-exon-sc0000001-1491911889:148553..148615Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:148553..148615TCONS_00000009-exon-sc0000001-1510915933:148553..148615Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:148811..148890TCONS_00000009-exon-sc0000001-1491911889:148811..148890Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:148811..148890TCONS_00000009-exon-sc0000001-1510915933:148811..148890Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:149938..150053TCONS_00000009-exon-sc0000001-1491911889:149938..150053Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:149938..150053TCONS_00000009-exon-sc0000001-1510915933:149938..150053Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:150558..150607TCONS_00000009-exon-sc0000001-1491911889:150558..150607Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:150558..150607TCONS_00000009-exon-sc0000001-1510915933:150558..150607Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:151582..151677TCONS_00000009-exon-sc0000001-1491911889:151582..151677Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:151582..151677TCONS_00000009-exon-sc0000001-1510915933:151582..151677Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:152916..153020TCONS_00000009-exon-sc0000001-1491911889:152916..153020Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:152916..153020TCONS_00000009-exon-sc0000001-1510915933:152916..153020Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:159049..159228TCONS_00000009-exon-sc0000001-1491911889:159049..159228Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:159049..159228TCONS_00000009-exon-sc0000001-1510915933:159049..159228Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:160228..160341TCONS_00000009-exon-sc0000001-1491911889:160228..160341Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:160228..160341TCONS_00000009-exon-sc0000001-1510915933:160228..160341Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:166658..166806TCONS_00000009-exon-sc0000001-1491911889:166658..166806Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:166658..166806TCONS_00000009-exon-sc0000001-1510915933:166658..166806Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:167985..168197TCONS_00000009-exon-sc0000001-1491911889:167985..168197Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:167985..168197TCONS_00000009-exon-sc0000001-1510915933:167985..168197Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:168554..168601TCONS_00000009-exon-sc0000001-1491911889:168554..168601Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:168554..168601TCONS_00000009-exon-sc0000001-1510915933:168554..168601Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:168913..168966TCONS_00000009-exon-sc0000001-1491911889:168913..168966Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:168913..168966TCONS_00000009-exon-sc0000001-1510915933:168913..168966Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:169453..169606TCONS_00000009-exon-sc0000001-1491911889:169453..169606Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:169453..169606TCONS_00000009-exon-sc0000001-1510915933:169453..169606Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:170819..170887TCONS_00000009-exon-sc0000001-1491911889:170819..170887Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:170819..170887TCONS_00000009-exon-sc0000001-1510915933:170819..170887Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1491911889:172009..172204TCONS_00000009-exon-sc0000001-1491911889:172009..172204Clytia hemisphaericaexon
TCONS_00000009-exon-sc0000001-1510915933:172009..172204TCONS_00000009-exon-sc0000001-1510915933:172009..172204Clytia hemisphaericaexon
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002470Peptidase_S9A
IPR023302Pept_S9A_N
IPR029058AB_hydrolase
IPR001375Peptidase_S9
IPR002471Pept_S9_AS
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0070008serine-type exopeptidase activity
GO:0008236serine-type peptidase activity
Genome Browser
External references for this transcript
DatabaseAccession
JBrowse for ClytiaTCONS_00000009