TCONS_00000001 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000001
Unique NameTCONS_00000001
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2202

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000001 ID=TCONS_00000001|Name=TCONS_00000001|organism=Clytia hemisphaerica|type=transcript|length=2202bp
CTTACCATGCTTAAAACCAAAtcatttcttgacaaatttcCGAACAATGT
GTGACCGTAGAAATAGAAGCTGACTGTCACTGAAACAAAATGGAGGGAAA
CAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAAATTTCTTGATT
CTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTA
TATCCTACCACGATAGCTGAAGagCTTCTAGGGAAGATAAATTCTGATCA
AGCCAGCCCCAATGGTTCTGCTGGTTCCCACGATCATGTGAGAAGGCGGA
GGCGGACAAATAGTggacgaaaagaagaagaagcaaaAGCAGAAACCAAA
GAAAAGAATTACACACCTGAACAAGTAGAAGATGTTGAAAAaataaaaaa
atgtaaagattTTTACGAAGTACTTAGTGTTTCGAAATCACCATCAGAGG
CAGACCTGAAGAAATCGTACAGAAAATTAGCATTAAAATTTCATCCTGAT
AAAAATCAAGCACCTGGAGCTGCGGAGGCATTtaaaagaATTGCTGCAGC
ATTTGAAACACTAGGAGATCCAGAGAAAAAGCGAAAGTATGATACTTATG
GAGAAAATGCTGGACCAACCACTCGACGCACTCGTAGAAACTATCACGAG
GAAGAATTTGAAGATATTTCACCGGAAGATATTTTCAATATGTTTTTCGG
CGGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAAGAGGACGTAGAGGTC
AACAAACATATTTTCGTCAAAACACACATTCTCATAACAACAACCATCAT
CAAAACGAAaacGTATCTTCACTGTATCCTTTGGTGCAGATTCTACCTGT
TCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTATTCCCGAAC
CAATATTCAGCTTTCAACCTACATCACAATATCGATATCCAATGACAACA
TTCAAACTTGGTATAAAATACTATGTTAAGGACCGGCATGTACGGCAAAA
ACATGAAGATTACAATTCTATAGAACTTAAAATCGAACGTGAATTTATAG
AAACACTTCAAGTTAGATGTTATCGTGAAAGACAATACAAGGCAGAATTA
CGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTTGAAAAGGCGGA
TAATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATTACAAGGTCGTG
TTCATGAttaaaagagaagagaaaagtGGCGGGTAGATGATTCTCTTTAT
CAATTAAATTGAGATGTGAATTACCAAGTTATTGTCCTTCATTTTGGATT
GGAAGATTGAAAGTCTCTAAATTTTCCCAAAGGAAATATGGATGTAATGG
TTTTTCATTACCGCCAACCAGAGTATCAATCGATATGTCTTCAAGATAGA
AAAAagaatgttgttgttttttacaAGTTAATTAAGGTCACAGTTACATG
AAAATGGGCACTTGTAACTAAGAAATTTAAGTAGTTCCAAAATGGTTTGA
ATGACAATGACTAAATTTATGATGCTGCCTTGACAGTTACAATTGGAAAA
GTTTGGAAATTGTTTTTCCTGGatatttagaccatgttcacgtgttactg
ttccgtttcgttCCGATATGGTTTTCGTTatggatcgagtgtgttcatat
tggtttcggaacgtttcggtgtaagaaaacggagcagtcccattctgata
aaaaaagtggtgcgaaaccgtttcgatctgttttgctttgtaacgtcttg
tttttgacatttcaaattttgactttcaCACTTGTTTTGGaaccgtttcg
gaacggaacggaacggaacggaaccgtaacgtctgaacattgAAGACGAG
aagaaaatctggaaattttcatTACTGGCTTGTtttaaattatcaaaatt
tatatatataatGCTGAATTAACGTttatttttgatcttttttttttttt
tgtgtttagaAAGTGATTTTGTTTATAtgattttcttttagttttgtGCG
TATATTGTAttataatgaatttttttttaatacaacaTACAAATCGAATT
TGATATTATTCAGAATTCCAAAAATTAGAGATACTAttattaaaaattga
taaatgatCAATATTAGTCGAAAAAGATAGAAGATAGAAATTAGAAATTA
GATTCGAGACCTGTTCAAAACTATTGAATTTTTCAGCAATTAATAAATTT
AC
Run BLAST on NCBI

protein sequence of TCONS_00000001-protein

>TCONS_00000001-protein ID=TCONS_00000001-protein|Name=TCONS_00000001-protein|organism=Clytia hemisphaerica|type=polypeptide|length=373bp
MEGNKDEALKCFQFAIKFLDSGHVEKAKKFAEKSIRLYPTTIAEELLGKI
NSDQASPNGSAGSHDHVRRRRRTNSGRKEEEAKAETKEKNYTPEQVEDVE
KIKKCKDFYEVLSVSKSPSEADLKKSYRKLALKFHPDKNQAPGAAEAFKR
IAAAFETLGDPEKKRKYDTYGENAGPTTRRTRRNYHEEEFEDISPEDIFN
MFFGGGFPDGRVHVRRGRRGQQTYFRQNTHSHNNNHHQNENVSSLYPLVQ
ILPVLLIILFSMLSSFLIPEPIFSFQPTSQYRYPMTTFKLGIKYYVKDRH
VRQKHEDYNSIELKIEREFIETLQVRCYRERQYKAELRQQGHMWGSRELL
EKADNYHPESCDKLKELQGRVHD
Run BLAST on NCBI

transcript from alignment at sc0000001:16085..38286+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000001 ID=TCONS_00000001|Name=TCONS_00000001|organism=Clytia hemisphaerica|type=transcript|length=22202bp|location=Sequence derived from alignment at sc0000001:16085..38286+ (Clytia hemisphaerica)
CTTACCATGCTTAAAACCAAAtcatttcttgacaaatttcCGAACAATGT GTGACCGTAGAAATAGAAGCTGACTGTCACTGAAACAAAATGGAGGGAAA CAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAAATTTCTTGATT CTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTA TATCCTACCACGATAGCTGAAGGTATGTTCATTTATGGGtccaatcaaaa gatttttggacataattcttttgcttttttctcCTGATGATGATATGGTC TGCCtcatttttgtcgattttttgTTATCCAGTGCAGAATTTTGAATAAG TGTGGGACTAACAATCAtaaataaaatattcaaaacaaaagaaagttgTT CCATAAAATTCGGTTCGGTACCTACCGTCACTAAGCCAAATCCGATCAAT CGCATCGAActtcagtcaggcacatcctggcaaatgaatggggtgagcat ttgcatggggtattcgtcacccagtgtaaatgagataggacatctcaggc taaaagcgtgaaaatgaataaaaatgaacttcaaactgaaaaaggggaaa aaggaACTTGggaacttcattttttcattaaaagtttcttcaaacttcaa agacaaaattgacccatggaaaaaaaatttcatctatgcaattctttgaa atgaagcaaaatatttccaacccggttcaattaaactgggtattcggcgc tattacgtcactttcgttttcgaccccgttcatttgccaatggtcgcaag tgaaaaataccccgttcatttgccaggatgtgcctgactgaacttgtcga aaccaatcgaacaatcgaactaatcgaactccatcaaacgattaaagttc gattaaaaaaattaatcgaacctaatcgaacattCAGCAATAGCAGTTCT AATAGTTcagtcagtaaaaagttcgattagtttgatgatattaaaatcct catatcttacctcgcttgcaaaaactttgtcatgctggcacgcgattgcc aaTTTCAACAGTTCcaggacttaacagcttgatgtttattgtacccggat atttgtctatccggaaaaaaagtccgtagcccctctaCTCTACGTAGCCC CCATACTACGCCCGCCCCAACAAACCGCTTCTTcttctggcgctaaaagg atacaggaaaagtctgtaatccgttatcggaagtaatttcccgatttaca ttccgaatttggctttgacagttacatcaaaatgcctcgaaaatgtcaat atgaaaattgcgtaatcagagaacgtatgtctcgctcattataaaaaggc cgagacaaactttcaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTGacctaaataattattttttgggcTGCCTTTATCAAGAAAAT TGTTTGATGGTGCGAGGAGTCCCATGAAAAGAGTTCTTcctgatattttt caatgatatatgttagattgtttttatatcattgctttttaaaattttca cttttttggaatacgtacctcaaaacccacatTTATATTATTGACAATAT CTTTAAGTCCACTTGGTCAATCAAGGTAAAAATTTGCACCTGTACATCTA GGTAAGTTTGTTGTAGAACTATTCATATATTGATAAATTAGTCTCAATAG AATTACCTATTACACCACAGAACCCACAATAgatgtacctcaaaacccac agGGAGTTTTGCAAATTAATTCTCCCCTCATTATATTTCTACCTGAAACT TTTTGacaattgattttgtatttcatataggtattttgtatgtaaaaatt aaGGCTTACATGTTTTTCTAATTgtgttgaaattatttttgaaactgCAT TGACTATTGTTAGCACTCAAGAAAGTTACAAAACATCCGTACATAGTTAT TTATTGCAAATGATAGAAACTTTTTTGCATTGTCTGGATAGGGAATCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNAATACGTCActcaaacaatagaaaaagtgacgtattgggtg gaacaaaaacagaaaatttgcataatttcgtgaagtcattgcagtggtgc atatcatgaattgaagccagttttaaaatgtatataatgtttcaagcaaa aattcaatctttttttgacagAACAAGTCTTGAGAATGGAAATGTGCTAT AAAGAATTGCTTAGTGAAATAggatttttattataatttatttcaactaa tttctaaattaaaggattgtgaattcatattctttgtttaatatatgaaa aataaaccagctgcgctggaaggtcagcctaaattgcttgatatgattag aaagatatgttgttaaaaattgatatgatttactaagacgagagtaaaaa aatcatcaaatttacgtTTGTACACAATATGGATTAACGAAAATATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTATTTACTATG AAAAGAAGACTTTGCAAAGCATTTGAGGTTGTTGAAATTACAGTGCAATT ACAGTTAAATCTCCACCATGAATATCGAAAAGCTTTTTTGATCCTGTAAA ACATAAATCGTGATGACTACCTTGGGAGAGATATGGTCTAAATGGGCAGA TAAAGATACATTAGTTTCATGTGCCAAGGGGGTTGGAATAACATCAAGTG GATTGAGCGTAAACTTCATGCAGCAAGATAAGTTTGACAGAGCAGTAGCA TGTATACAAGAAGAAATCCCTCCATCAACATCTACATCGACTCCAGACTC ACTCATCATGTCTCCTTCTGACAAAAGAAAAGCTTCTCGTGATTATTAGA AGGCTAAATTTGACCAGGCTCAGTCCCTAATAAGGGAGATGGCAGAAAGA AGCATCCAACCTGGCCTTCTGACAATAAAAAAGGTTAAGCcaaatgaaga aaagaaagCAACCACAACTACAAGGGTGACTCAGGTACACAACTCAATGA GGGCTAAAGATGTACAtgtagcaaccaaggtcaaagAAATCAGGCATgag aaactgaagaagaaaactgaaaaagaagaagcaaAGAAGAAGTGAGAGGA GATCAGAGAAACATTCATCAAATGCAAAAACTTAATGTATCTGTTTACAA CAAAAATGCTTGGCTTTGGGATTAAAGCAGTTCCCAGTATGTCTATGTNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAA TACGTCActcaaacaatagaaaaagtgacgtattgggtggaacaaaaaca gaaaatttgcataatttcgtgaagtcattgcagtggtgcatatcatgaat tgaagccagttttaaaatgtatataatgtttcaagcaaaaattcaatctt tttttgacagAACAAGTCTTGAGAATGGAAATGTGCTATAATAAAGAATT GCTTAGTGAAATAggatttttattataatttatttcAACTAATTTCTAAA TTAAAGGATTGTGAATTCATATTCTTTGTTTAATATATGAAAAANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTtgttttccccccc cccccccccgtttatttggaacctaagagtaatcaTTTATCTTGTCTGAT CCTGTGATGAGGAGTAAATACCCATTTATTCAtttgatataatttttatt aagTTACTTCAGCTGATTGTTAGATTTTGAGATGGTTTGGAATTCTAGAG CATACTTTATCGAAATTTTCTAACAGCAATGTTATTGTACAAgtatttta tctattttatcattttattattttatttatttatttatttattaaaaaga aacattcattgaaattacataGTTAAACTCAAACCCTATAACTTGAATCT CCTTAACCCAGATGATTTTTGATCCCTTCAGAACAAAATGttagtttaaa aaaatgataactttCCGAAAGCCtttaagattttaggaatgacaaaagca acagaaatattatgaatttgtttaaaaaatatatatttcagCCTGATTCC aatcttattttattttttctaacaatAATTGAAATCAATTTCGACTATCT TGACTATAACCCGAATCAAAAGCTTAGCAATTTTGTACATTGGCAAAGCA CGTGTTACACTGTTAAGCTtttcgtctttcaactttttcaaaattttaag ctcTTTAAGTATTGTTTATTCAGGcaaccttccagcgcagctggtttttt ttttttttaatttaaccttccagcgcagctgggttttttttttttttaat ttaaccttccagcgcagctgggttttttttttttttaatttaaccttcca gcgcagctggttttttttttacttagcaatcagagaagaaaaaatatttc gtctataagtgatcccaaccttcctattatttTAATCTCTAAAGAACATG CATAGccttcaaatgaatgacctggctggtcattaaaatacaaagttaaa tcaaaacaaaaatggtagagtagagctgcgagcagaacTGTGTAGTtcgt ttgttttttaattttgctgctttgattggtcagtcatttgatggctatgc aagtttccctccactgatgcaagttacctgacttcacgtTACGTACCAGA AGATCATTTTTGCCTGTGAAAATTTAGGCTATTCTCACCTATATCCCTAA TGttagtttaaaaaaatgataactttCTGAAAGCCTTTAAGATTTTAAGA ATGACAAAAGCAACAGAAATATTAtgaatttgtttaaaaaaatatatatt tcagCCTGATTCCaatcttattttattttttctaacaatAATTGAAATCA ATTTCGACCATCTTGACTATAACCCGAATCAAAAGCTTAGCGATTTTGTA CATTCGCAAAGCACGTGTTACACTGttattgcgcagaatgcctcacaata ggttaaattttcataaaaaaacactacatcttgaattttctggctttgcc ccaaaaatgactgttgacgccctaccctacCTAAGACAAGAGTAAGAGAA CCTTAATTTTACTTGGCCGATGGGAAAGATTAAATTTGACAATTTGCCCT TAAGTAGGAAATATTTCggaaaagaaaacaataatattaaaaacaaaatg taaaGACTAAAACAAAAGACCACTTGTAGCAAGACACAAAAATACCATAA GAGGATTATTTTTAGCATGAACTttatttggcaatttttgccaaatttct aaatgctcggaaaatatgacgaaaaatctgaactcaaaaaatatatccca tattgtactctgtACAGTGcaataactattacttattcctctgtgaccac taagcaaagaaaaactattttgacctttttatcaatttcagctgataaaa aaggtgtcagaattagatgagggatgtcgacattagactaaGTTTCTCTA CCCTGATTAAAAGTCAACTCAAAGAatgaattcaatttttcaaacatcTT TACAAGAAATTCTGACTAgcatgtgattttttttggttACAGATACATTA AAATACTAATAGTCACATTTTATTTACAATAACAATAACACAATCCAGCT AAAATTCCAAATGCTATAATGAAAATATGCTTTTATTTATGTATTGCCTG TAATGAAAGACTAAAGAACAACTTActttatttaaataaaaaagattgtT TGAAATTCTTGATAATTGTGTGGGTGTTTCTGATTGAtaggaaaaaatat ttaaacatgACTTAAAAATATATCAAGAATCAATACTTTTTTCATCATAC CATAAGGGAACAAATGTTCgtgggaagaaattttttgggcaaattttctg tttacaatggccttttttgccctaaaataccaattttagaggtgattttc aaaatctttacaATTTAATTTTGTGGATTTGTAAATAAACTGctaaatta aattttgcaaaaatttgttccgcaaaaatttgttcccttaTTAAGGTATA GATAGGGCCAATGGAATAAATATAATCTTAAGTTTACACGACACtttctt ctcacagacccactgggaaccatTCCCATTGGaaagattggccaaaatat tgtccccagtTAAAATtataatctaattttttttcccactgaaaaaaatc agataagcaaatcctcactgcaaaatgttGTGCTTTTCCATCTCCACTGA ACTTTCTGGCAAGAAAACAATGGAACTCATATCccaagccataaaaaaca tgggaatatcaatccgttttgagttttattccgttatttttacccccact agctgataaaatcccaccgggtctgtgagaagggggtgttacaTGACAGC ACCATGAAGGGTGAAGTTAAGGGTGTACATACattcaaatctttttgttt ttatttcagagCTTCTNtgagaagggggtgttacaTGACAGCACCATGAA GGGTGAAGTTAAGGGTGTACATACattcaaatctttttgtttttatttca gagCTTCTAGGGAAGATAAATTCTGATCAAGCCAGCCCCAATGGTTCTGC TGGTTCCCACGATCATGTGAGAAGGCGGAGGCGGACAAATAGTggacgaa aagaagaagaagcaaaAGCAGAAACCAAAGAAAAGAATTACACACCTGAA CAAGTAGAAGATGTTGAAAAGTATGCCAACAAATGAGTTTCTCACCTTGC TTGCCTTCCTTTCTTATTTTGTTAATGATATATAGTTTTGATATAGTTTG CCTTTTCCGTCAGCGGATGCAGACCTGATTTAGCAGGTtgaagacctgaa ttaacgtTCAAAGACCTGAATTAAAGGCCAGAGACCTGAATTAACGGCCA AAGGCCTGAATTAACGGCCAAAGACCTGgtttaacggccgaagacctgat ttagcaaGTCACTGGCCAAAGACCTGATAGATAAGTTAGGGTCAGTTAAA GTAGCTAGAACCACTCGGCGAGGCATCAGTTGCGATGGTCCAGTGGTTAG TGCAGTGGTATCGAAGACGAAAGATGTGTTTGAGAGTTTGAGTTATTGGT ATTATAGGATCCAGCCCCCCCTCGGAGATTTggggtacctaaaaaaaaaa gtgttaaaaaagccaggtacctggaagtattcttaaatttagggagtacc tgatatgtttggggtacctgcattttcattagtgggggcgggggctgttg tttttgtatgaagtcatcacccttgaattccttgaaacccttgaaacagT CAATATTATTTTGGGGACGCTTGAAATGCAAGATTTatacccttgaaacc cttgaaatgccaaattttgtggccattttcagccattttaactttcagaa atacaaaatttttcccattNTTCCCATTGCGTGGGATACAAACATCGCAG TgacttaaaaatgagaaaacatactTTTGGAACCCCTGAGACTCAAGGGG ATATTCAACGCTCATTCTTAGGGGGTTTACCTTTTAAACCCGTTAAGTGC CACTGGAATTATATGAGATTGGCAGGTCTGGGTGATAGAATGGGTGGttg taaaattatcaattatcagcCAATTTAAGGGCCCTCCTTTAcacaaaaat tgaatatttataAACCTTTCTCCTTTTGTCGACTGATTtccttgaaatct ttgaaaactagCAAAGATCAACTAAAAACCCTAGAAACCCTTGAAAGTTT GTGGTTTATAAAAATCTCTTGAAACCCTAGAAAATCATAGTCAAAAATGA CACccttgaatttgttgaaaagGAAGTGATGGCTGCCATGGAAGTATTTT CCCAGGAATgacaaaatagcaaaaaatccctttttgtatttttaacaata aaaaaattaaaaatggggTAACTCAAAGTTGGGGGGTTACTtttgaattc taaaaattttgggggtaccAAAATGATTAGGGGTACCTAAATTttttggg ggtacctgaaccctggaggaccctatggcattttcattctttttagttta aaatatttaaacttaatttgttttcaatactAATTCCTATTGAAACATCA tataaaaatcttgattgaatttataaaaaaggtttaaaaaataacaaatt tccaCAATTCATTATCTCCAGGTCTTCCGCCGATAAAAAAGGTATTCGAC CGCTGCATCAAGTCTTCAGTTTCTAATTCAGGTCTTCGACTGCTAATTCA GGTCTGCATCcgttgacggaaaaaaaatctgcgCCACGGAtacaaaatgt tgttttttaacaatttttgataatcTTTCAAGAGGTAAATCCTTCTAACG TTCCTAAAGTCATGATACcactatttcttttttttagaataaaaaaatgt aaagattTTTACGAAGTACTTAGTGTTTCGAAATCACCATCAGAGGCAGA CCTGAAGAAATCGTACAGAAAATTAGCATTAAAATTTCATCCTGATAAAA ATCAAGCACCTGGAGCTGCGGAGGCATTtaaaagtattattttttttcaa ggcaAATGTTTGCAATATCCATGGTTTATTGTTTAGTTAAAATGTTAAGG ATTATATGAACTTTTTAAGGATAATGATGAAATTTTAGTCATTATGTTGA CTATGTGTTATTTTTTGATAATTGATAATAAAATCGAcagatttttatga tattttttatacttatggaaagtgaaatttttgtcTCCTGTCGGTATTTT AGATtgaattaaatttaatttttcaaaggaATTGCTGCAGCATTTGAAAC ACTAGGAGATCCAGAGAAAAAGCGAAAGTATGATACTTATGGAGAAAATG CTGGACCAACCACTCGACGCACTCGTAGAAACTATCACGAGGAAGAATTT GAAGGTAACTCAACTATTTCTCCTTCTTtcaaaggccggtctccactttc gcgcgaaattgGCGACAGTTTTTTcataaccttttttgcctgaagaaaag attacgtcataaaaaagtttcgcgcgaaaaaaaaataaagttgaaggaag ttacTTTTTttatccgttacgtcaatttcaacCAATTGAGCAGAATGGAa tcgcttcatttttcaaccgaccaataaCCTTACGAAAACGTAAAAAGGTT TTCGCTcgtgtcgcgcgaaagtggagactgACCTTAACTTTTCATTGTTT ATCTATGAAAGTCTTTAAAAACAGCCTGAATCATCCGAGGCGTGCGATAG CACGTGCACGCCTCCACGCAACCAGAATTTTTTATTTGTGCGATCAGCCT TACCACACGCCataaatttcttgtaaaaatGGTGGTTAGCATTGTCTTAT CACATGTCTAGAATCTCAGATTTAGGTGATTGACCTCACACATGGAGTTT TCAAATGACAAAACCTGTAAAAGTATAATTATAGAACTAAAACCTGAATA ATATCTTTATTCGTAAGGTTTTTCATCACAGCTGAAGGCCGGTGAGATTG TTGACCAGTTGAAGCTAGTGTTTATGTATATCATTTCTATCCTCATCACC ACAACCTTCTTCTTCTGTTTTAGATATTTCACCGGAAGATATTTTCAATA TGTTTTTCGGCGGAGGGTTTCCCGATGGTAAGATAAACAAAGTTTTTGTC AACAACTTGcttttttttgtaataccaGGAAATTGTTTATCCTACGAATg tataatgaatgaaaaaatagtttttcaccACAATTTCCATATTCAAAATT AGATCAGTCCTGTCAGTAACAAGTAAATTTGCTTGATTTGTATATTATTT ACTTAAACCATACTATACAAGCtgaaacatgttggaaatttgCTTTTAAT GGTTTCTTGTCCGGAGCATCTTTCCAATACATGGAAAAAGACGCGCAAGC GATCTAAATATCGTTTTAAGAAAAATGTCTTCTGTTTAATTTTGATTTGG CTACACATCATTACAATgctttttatgtttcactttCCAATATATTGTAA TATATTGTATTTTACTTTTTGATCACATCCCGTTAGGCCGAGTTCATGTT CGAAGAGGACGTAGAGGTCAACAAACATATTTTCGTCAAAACACACATTC TCATAACAACAACCATCATCAAAACGAAGTAAGCATTGAAAATAAGTAAT GTCTTTGAAAACctaaataaatcaaaagatcTGCGAAATGATTAAAAGTT TTGTGTCCGctgtaaaatataattttgtcccggatttattttttgcaaaa aaactaATCCAGACATTggttaaaattaataaaaactttttgttttgtta gcgATAGAGGGCGAAAATCagcgatgaaaaatgaaaatgttttgtccTAC ATTGTTTGTTATTTTCTATcccaaaaaagaacaataaacTTTTAATTCCT CACATGTCTAAATTCTTCGTACAGGTATTGGCgctggaaattattttttt tctgcagACACCTAGTCATAACACACAGTCATACCAGTCTCTTTCTATCA TTTAGTGATAGTGGTTTGAGTCTGGCACAATGTTTCAAAATTCTGTAGAG TTAGGAGGAATTTCTGTGATATTTTATCTTAAGAGGGTGAATCTCTTTCT GGCGGGTGCTTGCCACTATGTTTTACAAAAGTAATTCATCcaatttctgt ttttttcttcagaacGTATCTTCACTGTATCCTTTGGTGCAGATTCTACC TGTTCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTATTCCCG AACCAATATTCAGCTTTCAACCTACATCGTAAGTATATTACAATACACAT TTTCGACTGTACCTGTCTATTCAGGGgagggggggtcggtagtaaaatat cagacatatatgagtaataaaaggatttttacgaatttttacataccacc acccagacttttggaagaggtattttactaccctggtagtaaaagttttt gggacaatttgtcataaagaccacctattttttggttgcttttcggactg attttacaaaaaaagctaaacaatgattatttctgtgacacatttttcac tttgtgcaaaaataaatgtttttccCTTAAAATTTAAGTCTTTTCTATAT TGACAAAATAtctcgagaattttttgtttgcagcaaacaactttccaaca gaagattttttcaagttattaaaattttcagattttttcagaaaagtcat ccaaaaaattaaaagaattacaaaaatagctaaaatttgctaattttacc agttttaactacccaggtagtaaaactttttcaacatttaacacataaat accacccattttagtatttaactaccctgggtagtaaatcttttttcgat ttttcgtcacaccaccaccgtagtaaacgtcattatgtgtgagattttac taccgaccccccccctggtcTATTGCTACCCTAAAACCgccccagtcttt ttttttgcgCTTAAAggaaatagaaaaaagtgtaaaaaaagattggatcg agtttagggtgtgaaattaaataataaagtggcacacgTCTGACTtgtgc gactacggtcgaaaagttgTATTCAGCAGTATTCAgaactttgtgaaata ttatGCTATAAGTATACTGAATGATAGTAAGAAGCaattcaataggtaaa agtgtgctattgagatttattaaccttGAGATGATGTAATATtgagttga atatacatcacccAGTGTTAATAAATCCAacaaccaacttttacctattt aTTTAATACCTGCCTATTATAATAAAATATAGAATTAAGGTCGAAACATT AAACTAGTAAAaataaacaatgaaataaatacATTTTCTGGTCATAGGAA AGTGTTTGCTCTCTCTATTTGAATTAGTTGCTTCCCCATTTAACTTTCAT TAACCCAGAAGTGTGTGGTACCTTGAATACTGAAGCCTGATCTCAACTGA ATCAAGATAAGAAGATCAGTAGAAAATAAGACTTTGTTAACCACATGTGc caatttaatttttatttccaaAGTAACATTTTTCTCTTCACAGACAATAT CGATATCCAATGACAACATTCAAACTTGGTATAAAATACTATGTTAAGGT GAGTATATTATTAATAACAATAGATTGTTTAACAGTTCTGACATTAGTCG TAGTATAAGTAGATGGTTTTGAATCGAACTCCAGATTTCAAGATCTtgaa gagagaaaaaattacatagtttctaccccccctACATTCAggggggtctt gggttttgatgaaccaaaagcaaaggggtgttaaaagtatgactttccta aggggggttgccagttaagggggaatcttccttgaattatgcgaaatttc aatttttttcttttccaataaAGTTAAAGggggtgtgaaattttaaatta atttcctaaaggggggttagcacttaaggTGGGGGTTCTCTTACCTAtgg gggggggtcttgacccctctagaagcTATGGTTGATTCGACCTTACAGCT TATCACAACAATACCATAAcaactaaaatttacaaaaattattttgtttc agGACCGGCATGTACGGCAAAAACATGAAGATTACAATTCTATAGAACTT AAAATCGAACGTGAATTTATAGAAACACTTCAAGTTAGATGTTATCGTGA AAGACAATACAGTAAGCTTTCATGTTCTTTCGTTTCGTAAATcctcaaag ttcttcttttcgcaCGGAATAACCATGCGGTTTTGAGccgtgacctttca attttgaaactcaaagCCCCGCAGCAAGTCAGGgcgggatgggtggagca aggaGTCAACTAAGGCGGAGGGAAAAATTGCCGACTTTCATCACGTGACC AGtcatttttctcataagcaattctgcataatttatcaaaattacAAGAA CATGCACTAATATGTACTAAAAAGTCCATTTTCCATCTCAGACGAAAAAC ATTGCTTTCACCACTAGTCTATTGTccacattttttcattttcctatgaa tttttcaacttttttgatgaaaaaggcCAAATTTGTAAACTCGAAAGCAA AAATTGGTtcccgcgaaaataagttccttTAAGGTATCACTAATTCTAAC TGATTGGTTGTACAGgatttccagatctggaaataTATACATTTTCATAG CCtaggaaatgaaatttttttccctgTGATGAAAGATATATCATTTGATC TGTTTACTAattcttctttcatttttcttcttattaCAGAGGCAGAATTA CGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTTGAAAAGGCGGA TAATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATTACAAGGTCGTG TTCATGAttaaaagagaagagaaaagtGGCGGGTAGATGATTCTCTTTAT CAATTAAATTGAGATGTGAATTACCAAGTTATTGTCCTTCATTTTGGATT GGAAGATTGAAAGTCTCTAAATTTTCCCAAAGGAAATATGGATGTAATGG TTTTTCATTACCGCCAACCAGAGTATCAATCGATATGTCTTCAAGATAGA AAAAagaatgttgttgttttttacaAGTTAATTAAGGTCACAGTTACATG AAAATGGGCACTTGTAACTAAGAAATTTAAGTAGTTCCAAAATGGTTTGA ATGACAATGACTAAATTTATGATGCTGCCTTGACAGTTACAATTGGAAAA GTTTGGAAATTGTTTTTCCTGGatatttagaccatgttcacgtgttactg ttccgtttcgttCCGATATGGTTTTCGTTatggatcgagtgtgttcatat tggtttcggaacgtttcggtgtaagaaaacggagcagtcccattctgata aaaaaagtggtgcgaaaccgtttcgatctgttttgctttgtaacgtcttg tttttgacatttcaaattttgactttcaCACTTGTTTTGGaaccgtttcg gaacggaacggaacggaacggaaccgtaacgtctgaacattgAAGACGAG aagaaaatctggaaattttcatTACTGGCTTGTtttaaattatcaaaatt tatatatataatGCTGAATTAACGTttatttttgatcttttttttttttt tgtgtttagaAAGTGATTTTGTTTATAtgattttcttttagttttgtGCG TATATTGTAttataatgaatttttttttaatacaacaTACAAATCGAATT TGATATTATTCAGAATTCCAAAAATTAGAGATACTAttattaaaaattga taaatgatCAATATTAGTCGAAAAAGATAGAAGATAGAAATTAGAAATTA GATTCGAGACCTGTTCAAAACTATTGAATTTTTCAGCAATTAATAAATTT AC

Coding sequence (CDS) from alignment at sc0000001:16085..38286+

>TCONS_00000001 ID=TCONS_00000001|Name=TCONS_00000001|organism=Clytia hemisphaerica|type=CDS|length=11220bp|location=Sequence derived from alignment at sc0000001:16085..38286+ (Clytia hemisphaerica)
ATGGAGGGAAACAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAA
ATTTCTTGATTCTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGT
CCATAAGGCTATATCCTACCACGATAGCTGAAGagCTTCTAGGGAAGATA
AATTCTGATCAAGCCAGCCCCAATGGTTCTGCTGGTTCCCACGATCATGT
GAGAAGGCGGAGGCGGACAAATAGTggacgaaaagaagaagaagcaaaAG
CAGAAACCAAAGAAAAGAATTACACACCTGAACAAGTAGAAGATGTTGAA
AAaataaaaaaatgtaaagattTTTACGAAGTACTTAGTGTTTCGAAATC
ACCATCAGAGGCAGACCTGAAGAAATCGTACAGAAAATTAGCATTAAAAT
TTCATCCTGATAAAAATCAAGCACCTGGAGCTGCGGAGGCATTtaaaaga
ATTGCTGCAGCATTTGAAACACTAGGAGATCCAGAGAAAAAGCGAAAGTA
TGATACTTATGGAGAAAATGCTGGACCAACCACTCGACGCACTCGTAGAA
ACTATCACGAGGAAGAATTTGAAGATATTTCACCGGAAGATATTTTCAAT
ATGTTTTTCGGCGGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAAGAGG
ACGTAGAGGTCAACAAACATATTTTCGTCAAAACACACATTCTCATAACA
ACAACCATCATCAAAACGAAaacGTATCTTCACTGTATCCTTTGGTGCAG
ATTCTACCTGTTCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCT
TATTCCCGAACCAATATTCAGCTTTCAACCTACATCACAATATCGATATC
CAATGACAACATTCAAACTTGGTATAAAATACTATGTTAAGGACCGGCAT
GTACGGCAAAAACATGAAGATTACAATTCTATAGAACTTAAAATCGAACG
TGAATTTATAGAAACACTTCAAGTTAGATGTTATCGTGAAAGACAATACA
AGGCAGAATTACGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTT
GAAAAGGCGGATAATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATT
ACAAGGTCGTGTTCATGAttaaATGGAGGGAAACAAAGATGAAGCACTGA
AATGTTTCCAGTTTGCAATCAAATTTCTTGATTCTGGTCATGTTGAAAAG
GCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTATATCCTACCACGATAGC
TGAAGagCTTCTAGGGAAGATAAATTCTGATCAAGCCAGCCCCAATGGTT
CTGCTGGTTCCCACGATCATGTGAGAAGGCGGAGGCGGACAAATAGTgga
cgaaaagaagaagaagcaaaAGCAGAAACCAAAGAAAAGAATTACACACC
TGAACAAGTAGAAGATGTTGAAAAaataaaaaaatgtaaagattTTTACG
AAGTACTTAGTGTTTCGAAATCACCATCAGAGGCAGACCTGAAGAAATCG
TACAGAAAATTAGCATTAAAATTTCATCCTGATAAAAATCAAGCACCTGG
AGCTGCGGAGGCATTtaaaagaATTGCTGCAGCATTTGAAACACTAGGAG
ATCCAGAGAAAAAGCGAAAGTATGATACTTATGGAGAAAATGCTGGACCA
ACCACTCGACGCACTCGTAGAAACTATCACGAGGAAGAATTTGAAGATAT
TTCACCGGAAGATATTTTCAATATGTTTTTCGGCGGAGGGTTTCCCGATG
GCCGAGTTCATGTTCGAAGAGGACGTAGAGGTCAACAAACATATTTTCGT
CAAAACACACATTCTCATAACAACAACCATCATCAAAACGAAaacGTATC
TTCACTGTATCCTTTGGTGCAGATTCTACCTGTTCTTCTTATCATCCTCT
TCTCGATGCTCAGTAGTTTCCTTATTCCCGAACCAATATTCAGCTTTCAA
CCTACATCACAATATCGATATCCAATGACAACATTCAAACTTGGTATAAA
ATACTATGTTAAGGACCGGCATGTACGGCAAAAACATGAAGATTACAATT
CTATAGAACTTAAAATCGAACGTGAATTTATAGAAACACTTCAAGTTAGA
TGTTATCGTGAAAGACAATACAAGGCAGAATTACGGCAGCAAGGCCACAT
GTGGGGAAGTCGTGAACTACTTGAAAAGGCGGATAATTATCATCCTGAGT
CATGTGACAAGCTGAAAGAATTACAAGGTCGTGTTCATGAttaaATGGAG
GGAAACAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAAATTTCT
TGATTCTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCCATAA
GGCTATATCCTACCACGATAGCTGAAGagCTTCTAGGGAAGATAAATTCT
GATCAAGCCAGCCCCAATGGTTCTGCTGGTTCCCACGATCATGTGAGAAG
GCGGAGGCGGACAAATAGTggacgaaaagaagaagaagcaaaAGCAGAAA
CCAAAGAAAAGAATTACACACCTGAACAAGTAGAAGATGTTGAAAAaata
aaaaaatgtaaagattTTTACGAAGTACTTAGTGTTTCGAAATCACCATC
AGAGGCAGACCTGAAGAAATCGTACAGAAAATTAGCATTAAAATTTCATC
CTGATAAAAATCAAGCACCTGGAGCTGCGGAGGCATTtaaaagaATTGCT
GCAGCATTTGAAACACTAGGAGATCCAGAGAAAAAGCGAAAGTATGATAC
TTATGGAGAAAATGCTGGACCAACCACTCGACGCACTCGTAGAAACTATC
ACGAGGAAGAATTTGAAGATATTTCACCGGAAGATATTTTCAATATGTTT
TTCGGCGGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAAGAGGACGTAG
AGGTCAACAAACATATTTTCGTCAAAACACACATTCTCATAACAACAACC
ATCATCAAAACGAAaacGTATCTTCACTGTATCCTTTGGTGCAGATTCTA
CCTGTTCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTATTCC
CGAACCAATATTCAGCTTTCAACCTACATCACAATATCGATATCCAATGA
CAACATTCAAACTTGGTATAAAATACTATGTTAAGGACCGGCATGTACGG
CAAAAACATGAAGATTACAATTCTATAGAACTTAAAATCGAACGTGAATT
TATAGAAACACTTCAAGTTAGATGTTATCGTGAAAGACAATACAAGGCAG
AATTACGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTTGAAAAG
GCGGATAATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATTACAAGG
TCGTGTTCATGAttaaATGGAGGGAAACAAAGATGAAGCACTGAAATGTT
TCCAGTTTGCAATCAAATTTCTTGATTCTGGTCATGTTGAAAAGGCTAAA
AAGTTCGCGGAAAAGTCCATAAGGCTATATCCTACCACGATAGCTGAAGa
gCTTCTAGGGAAGATAAATTCTGATCAAGCCAGCCCCAATGGTTCTGCTG
GTTCCCACGATCATGTGAGAAGGCGGAGGCGGACAAATAGTggacgaaaa
gaagaagaagcaaaAGCAGAAACCAAAGAAAAGAATTACACACCTGAACA
AGTAGAAGATGTTGAAAAaataaaaaaatgtaaagattTTTACGAAGTAC
TTAGTGTTTCGAAATCACCATCAGAGGCAGACCTGAAGAAATCGTACAGA
AAATTAGCATTAAAATTTCATCCTGATAAAAATCAAGCACCTGGAGCTGC
GGAGGCATTtaaaagaATTGCTGCAGCATTTGAAACACTAGGAGATCCAG
AGAAAAAGCGAAAGTATGATACTTATGGAGAAAATGCTGGACCAACCACT
CGACGCACTCGTAGAAACTATCACGAGGAAGAATTTGAAGATATTTCACC
GGAAGATATTTTCAATATGTTTTTCGGCGGAGGGTTTCCCGATGGCCGAG
TTCATGTTCGAAGAGGACGTAGAGGTCAACAAACATATTTTCGTCAAAAC
ACACATTCTCATAACAACAACCATCATCAAAACGAAaacGTATCTTCACT
GTATCCTTTGGTGCAGATTCTACCTGTTCTTCTTATCATCCTCTTCTCGA
TGCTCAGTAGTTTCCTTATTCCCGAACCAATATTCAGCTTTCAACCTACA
TCACAATATCGATATCCAATGACAACATTCAAACTTGGTATAAAATACTA
TGTTAAGGACCGGCATGTACGGCAAAAACATGAAGATTACAATTCTATAG
AACTTAAAATCGAACGTGAATTTATAGAAACACTTCAAGTTAGATGTTAT
CGTGAAAGACAATACAAGGCAGAATTACGGCAGCAAGGCCACATGTGGGG
AAGTCGTGAACTACTTGAAAAGGCGGATAATTATCATCCTGAGTCATGTG
ACAAGCTGAAAGAATTACAAGGTCGTGTTCATGAttaaATGGAGGGAAAC
AAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAAATTTCTTGATTC
TGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTAT
ATCCTACCACGATAGCTGAAGagCTTCTAGGGAAGATAAATTCTGATCAA
GCCAGCCCCAATGGTTCTGCTGGTTCCCACGATCATGTGAGAAGGCGGAG
GCGGACAAATAGTggacgaaaagaagaagaagcaaaAGCAGAAACCAAAG
AAAAGAATTACACACCTGAACAAGTAGAAGATGTTGAAAAaataaaaaaa
tgtaaagattTTTACGAAGTACTTAGTGTTTCGAAATCACCATCAGAGGC
AGACCTGAAGAAATCGTACAGAAAATTAGCATTAAAATTTCATCCTGATA
AAAATCAAGCACCTGGAGCTGCGGAGGCATTtaaaagaATTGCTGCAGCA
TTTGAAACACTAGGAGATCCAGAGAAAAAGCGAAAGTATGATACTTATGG
AGAAAATGCTGGACCAACCACTCGACGCACTCGTAGAAACTATCACGAGG
AAGAATTTGAAGATATTTCACCGGAAGATATTTTCAATATGTTTTTCGGC
GGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAAGAGGACGTAGAGGTCA
ACAAACATATTTTCGTCAAAACACACATTCTCATAACAACAACCATCATC
AAAACGAAaacGTATCTTCACTGTATCCTTTGGTGCAGATTCTACCTGTT
CTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTATTCCCGAACC
AATATTCAGCTTTCAACCTACATCACAATATCGATATCCAATGACAACAT
TCAAACTTGGTATAAAATACTATGTTAAGGACCGGCATGTACGGCAAAAA
CATGAAGATTACAATTCTATAGAACTTAAAATCGAACGTGAATTTATAGA
AACACTTCAAGTTAGATGTTATCGTGAAAGACAATACAAGGCAGAATTAC
GGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTTGAAAAGGCGGAT
AATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATTACAAGGTCGTGT
TCATGAttaaATGGAGGGAAACAAAGATGAAGCACTGAAATGTTTCCAGT
TTGCAATCAAATTTCTTGATTCTGGTCATGTTGAAAAGGCTAAAAAGTTC
GCGGAAAAGTCCATAAGGCTATATCCTACCACGATAGCTGAAGagCTTCT
AGGGAAGATAAATTCTGATCAAGCCAGCCCCAATGGTTCTGCTGGTTCCC
ACGATCATGTGAGAAGGCGGAGGCGGACAAATAGTggacgaaaagaagaa
gaagcaaaAGCAGAAACCAAAGAAAAGAATTACACACCTGAACAAGTAGA
AGATGTTGAAAAaataaaaaaatgtaaagattTTTACGAAGTACTTAGTG
TTTCGAAATCACCATCAGAGGCAGACCTGAAGAAATCGTACAGAAAATTA
GCATTAAAATTTCATCCTGATAAAAATCAAGCACCTGGAGCTGCGGAGGC
ATTtaaaagaATTGCTGCAGCATTTGAAACACTAGGAGATCCAGAGAAAA
AGCGAAAGTATGATACTTATGGAGAAAATGCTGGACCAACCACTCGACGC
ACTCGTAGAAACTATCACGAGGAAGAATTTGAAGATATTTCACCGGAAGA
TATTTTCAATATGTTTTTCGGCGGAGGGTTTCCCGATGGCCGAGTTCATG
TTCGAAGAGGACGTAGAGGTCAACAAACATATTTTCGTCAAAACACACAT
TCTCATAACAACAACCATCATCAAAACGAAaacGTATCTTCACTGTATCC
TTTGGTGCAGATTCTACCTGTTCTTCTTATCATCCTCTTCTCGATGCTCA
GTAGTTTCCTTATTCCCGAACCAATATTCAGCTTTCAACCTACATCACAA
TATCGATATCCAATGACAACATTCAAACTTGGTATAAAATACTATGTTAA
GGACCGGCATGTACGGCAAAAACATGAAGATTACAATTCTATAGAACTTA
AAATCGAACGTGAATTTATAGAAACACTTCAAGTTAGATGTTATCGTGAA
AGACAATACAAGGCAGAATTACGGCAGCAAGGCCACATGTGGGGAAGTCG
TGAACTACTTGAAAAGGCGGATAATTATCATCCTGAGTCATGTGACAAGC
TGAAAGAATTACAAGGTCGTGTTCATGAttaaATGGAGGGAAACAAAGAT
GAAGCACTGAAATGTTTCCAGTTTGCAATCAAATTTCTTGATTCTGGTCA
TGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTATATCCTA
CCACGATAGCTGAAGagCTTCTAGGGAAGATAAATTCTGATCAAGCCAGC
CCCAATGGTTCTGCTGGTTCCCACGATCATGTGAGAAGGCGGAGGCGGAC
AAATAGTggacgaaaagaagaagaagcaaaAGCAGAAACCAAAGAAAAGA
ATTACACACCTGAACAAGTAGAAGATGTTGAAAAaataaaaaaatgtaaa
gattTTTACGAAGTACTTAGTGTTTCGAAATCACCATCAGAGGCAGACCT
GAAGAAATCGTACAGAAAATTAGCATTAAAATTTCATCCTGATAAAAATC
AAGCACCTGGAGCTGCGGAGGCATTtaaaagaATTGCTGCAGCATTTGAA
ACACTAGGAGATCCAGAGAAAAAGCGAAAGTATGATACTTATGGAGAAAA
TGCTGGACCAACCACTCGACGCACTCGTAGAAACTATCACGAGGAAGAAT
TTGAAGATATTTCACCGGAAGATATTTTCAATATGTTTTTCGGCGGAGGG
TTTCCCGATGGCCGAGTTCATGTTCGAAGAGGACGTAGAGGTCAACAAAC
ATATTTTCGTCAAAACACACATTCTCATAACAACAACCATCATCAAAACG
AAaacGTATCTTCACTGTATCCTTTGGTGCAGATTCTACCTGTTCTTCTT
ATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTATTCCCGAACCAATATT
CAGCTTTCAACCTACATCACAATATCGATATCCAATGACAACATTCAAAC
TTGGTATAAAATACTATGTTAAGGACCGGCATGTACGGCAAAAACATGAA
GATTACAATTCTATAGAACTTAAAATCGAACGTGAATTTATAGAAACACT
TCAAGTTAGATGTTATCGTGAAAGACAATACAAGGCAGAATTACGGCAGC
AAGGCCACATGTGGGGAAGTCGTGAACTACTTGAAAAGGCGGATAATTAT
CATCCTGAGTCATGTGACAAGCTGAAAGAATTACAAGGTCGTGTTCATGA
ttaaATGGAGGGAAACAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAA
TCAAATTTCTTGATTCTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAA
AAGTCCATAAGGCTATATCCTACCACGATAGCTGAAGagCTTCTAGGGAA
GATAAATTCTGATCAAGCCAGCCCCAATGGTTCTGCTGGTTCCCACGATC
ATGTGAGAAGGCGGAGGCGGACAAATAGTggacgaaaagaagaagaagca
aaAGCAGAAACCAAAGAAAAGAATTACACACCTGAACAAGTAGAAGATGT
TGAAAAaataaaaaaatgtaaagattTTTACGAAGTACTTAGTGTTTCGA
AATCACCATCAGAGGCAGACCTGAAGAAATCGTACAGAAAATTAGCATTA
AAATTTCATCCTGATAAAAATCAAGCACCTGGAGCTGCGGAGGCATTtaa
aagaATTGCTGCAGCATTTGAAACACTAGGAGATCCAGAGAAAAAGCGAA
AGTATGATACTTATGGAGAAAATGCTGGACCAACCACTCGACGCACTCGT
AGAAACTATCACGAGGAAGAATTTGAAGATATTTCACCGGAAGATATTTT
CAATATGTTTTTCGGCGGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAA
GAGGACGTAGAGGTCAACAAACATATTTTCGTCAAAACACACATTCTCAT
AACAACAACCATCATCAAAACGAAaacGTATCTTCACTGTATCCTTTGGT
GCAGATTCTACCTGTTCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTT
TCCTTATTCCCGAACCAATATTCAGCTTTCAACCTACATCACAATATCGA
TATCCAATGACAACATTCAAACTTGGTATAAAATACTATGTTAAGGACCG
GCATGTACGGCAAAAACATGAAGATTACAATTCTATAGAACTTAAAATCG
AACGTGAATTTATAGAAACACTTCAAGTTAGATGTTATCGTGAAAGACAA
TACAAGGCAGAATTACGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACT
ACTTGAAAAGGCGGATAATTATCATCCTGAGTCATGTGACAAGCTGAAAG
AATTACAAGGTCGTGTTCATGAttaaATGGAGGGAAACAAAGATGAAGCA
CTGAAATGTTTCCAGTTTGCAATCAAATTTCTTGATTCTGGTCATGTTGA
AAAGGCTAAAAAGTTCGCGGAAAAGTCCATAAGGCTATATCCTACCACGA
TAGCTGAAGagCTTCTAGGGAAGATAAATTCTGATCAAGCCAGCCCCAAT
GGTTCTGCTGGTTCCCACGATCATGTGAGAAGGCGGAGGCGGACAAATAG
TggacgaaaagaagaagaagcaaaAGCAGAAACCAAAGAAAAGAATTACA
CACCTGAACAAGTAGAAGATGTTGAAAAaataaaaaaatgtaaagattTT
TACGAAGTACTTAGTGTTTCGAAATCACCATCAGAGGCAGACCTGAAGAA
ATCGTACAGAAAATTAGCATTAAAATTTCATCCTGATAAAAATCAAGCAC
CTGGAGCTGCGGAGGCATTtaaaagaATTGCTGCAGCATTTGAAACACTA
GGAGATCCAGAGAAAAAGCGAAAGTATGATACTTATGGAGAAAATGCTGG
ACCAACCACTCGACGCACTCGTAGAAACTATCACGAGGAAGAATTTGAAG
ATATTTCACCGGAAGATATTTTCAATATGTTTTTCGGCGGAGGGTTTCCC
GATGGCCGAGTTCATGTTCGAAGAGGACGTAGAGGTCAACAAACATATTT
TCGTCAAAACACACATTCTCATAACAACAACCATCATCAAAACGAAaacG
TATCTTCACTGTATCCTTTGGTGCAGATTCTACCTGTTCTTCTTATCATC
CTCTTCTCGATGCTCAGTAGTTTCCTTATTCCCGAACCAATATTCAGCTT
TCAACCTACATCACAATATCGATATCCAATGACAACATTCAAACTTGGTA
TAAAATACTATGTTAAGGACCGGCATGTACGGCAAAAACATGAAGATTAC
AATTCTATAGAACTTAAAATCGAACGTGAATTTATAGAAACACTTCAAGT
TAGATGTTATCGTGAAAGACAATACAAGGCAGAATTACGGCAGCAAGGCC
ACATGTGGGGAAGTCGTGAACTACTTGAAAAGGCGGATAATTATCATCCT
GAGTCATGTGACAAGCTGAAAGAATTACAAGGTCGTGTTCATGAttaaAT
GGAGGGAAACAAAGATGAAGCACTGAAATGTTTCCAGTTTGCAATCAAAT
TTCTTGATTCTGGTCATGTTGAAAAGGCTAAAAAGTTCGCGGAAAAGTCC
ATAAGGCTATATCCTACCACGATAGCTGAAGagCTTCTAGGGAAGATAAA
TTCTGATCAAGCCAGCCCCAATGGTTCTGCTGGTTCCCACGATCATGTGA
GAAGGCGGAGGCGGACAAATAGTggacgaaaagaagaagaagcaaaAGCA
GAAACCAAAGAAAAGAATTACACACCTGAACAAGTAGAAGATGTTGAAAA
aataaaaaaatgtaaagattTTTACGAAGTACTTAGTGTTTCGAAATCAC
CATCAGAGGCAGACCTGAAGAAATCGTACAGAAAATTAGCATTAAAATTT
CATCCTGATAAAAATCAAGCACCTGGAGCTGCGGAGGCATTtaaaagaAT
TGCTGCAGCATTTGAAACACTAGGAGATCCAGAGAAAAAGCGAAAGTATG
ATACTTATGGAGAAAATGCTGGACCAACCACTCGACGCACTCGTAGAAAC
TATCACGAGGAAGAATTTGAAGATATTTCACCGGAAGATATTTTCAATAT
GTTTTTCGGCGGAGGGTTTCCCGATGGCCGAGTTCATGTTCGAAGAGGAC
GTAGAGGTCAACAAACATATTTTCGTCAAAACACACATTCTCATAACAAC
AACCATCATCAAAACGAAaacGTATCTTCACTGTATCCTTTGGTGCAGAT
TCTACCTGTTCTTCTTATCATCCTCTTCTCGATGCTCAGTAGTTTCCTTA
TTCCCGAACCAATATTCAGCTTTCAACCTACATCACAATATCGATATCCA
ATGACAACATTCAAACTTGGTATAAAATACTATGTTAAGGACCGGCATGT
ACGGCAAAAACATGAAGATTACAATTCTATAGAACTTAAAATCGAACGTG
AATTTATAGAAACACTTCAAGTTAGATGTTATCGTGAAAGACAATACAAG
GCAGAATTACGGCAGCAAGGCCACATGTGGGGAAGTCGTGAACTACTTGA
AAAGGCGGATAATTATCATCCTGAGTCATGTGACAAGCTGAAAGAATTAC
AAGGTCGTGTTCATGAttaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000001XLOC_000001Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000001-exon-sc0000001-1491911889:16085..16306TCONS_00000001-exon-sc0000001-1491911889:16085..16306Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:16085..16306TCONS_00000001-exon-sc0000001-1510915933:16085..16306Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:30486..30654TCONS_00000001-exon-sc0000001-1491911889:30486..30654Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:30486..30654TCONS_00000001-exon-sc0000001-1510915933:30486..30654Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:32322..32467TCONS_00000001-exon-sc0000001-1491911889:32322..32467Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:32322..32467TCONS_00000001-exon-sc0000001-1510915933:32322..32467Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:32713..32838TCONS_00000001-exon-sc0000001-1491911889:32713..32838Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:32713..32838TCONS_00000001-exon-sc0000001-1510915933:32713..32838Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:33508..33561TCONS_00000001-exon-sc0000001-1491911889:33508..33561Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:33508..33561TCONS_00000001-exon-sc0000001-1510915933:33508..33561Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:33971..34062TCONS_00000001-exon-sc0000001-1491911889:33971..34062Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:33971..34062TCONS_00000001-exon-sc0000001-1510915933:33971..34062Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:34597..34712TCONS_00000001-exon-sc0000001-1491911889:34597..34712Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:34597..34712TCONS_00000001-exon-sc0000001-1510915933:34597..34712Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:35978..36032TCONS_00000001-exon-sc0000001-1491911889:35978..36032Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:35978..36032TCONS_00000001-exon-sc0000001-1510915933:35978..36032Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:36487..36595TCONS_00000001-exon-sc0000001-1491911889:36487..36595Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:36487..36595TCONS_00000001-exon-sc0000001-1510915933:36487..36595Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1491911889:37174..38286TCONS_00000001-exon-sc0000001-1491911889:37174..38286Clytia hemisphaericaexon
TCONS_00000001-exon-sc0000001-1510915933:37174..38286TCONS_00000001-exon-sc0000001-1510915933:37174..38286Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000001-proteinTCONS_00000001-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:16085..38286 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
25.4417 25.7811 9.93408 8.41889 23.7743 18.9398 21.2597 21.3738 12.644 14.592 11.3849 8.42201 9.56389 9.6632 7.71092 7.48137 10.8745 10.3093 7.8547 9.47455 7.39103 7.188 15.8264 16.3388 11.3638 14.7927 8.51155 6.47867 12.0539 13.4716
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001623DnaJ_domain
IPR011990TPR-like_helical_dom
IPR015399DUF1977_DnaJ-like
IPR018253DnaJ_domain_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000001 vs. Swiss-Prot (Human)
Match: DJB12 (DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4)

HSP 1 Score: 183.341 bits (464), Expect = 5.574e-51
Identity = 132/382 (34.55%), Postives = 200/382 (52.36%), Query Frame = 3
Query:   90 MEGNKDEALKCFQFAIKFLDSGHVEKAKKFAEKSIRLYPTTIAEELLGKIN------SDQASPNGSAGSHDHVRRRRRTNSGRXXXXXXXXXXXXNYTPEQVEDVEKIKKCKDFYEVLSVSKSPSEADLKKSYRKLALKFHPDKNQAPGXXXXXXXXXXXXXTLGDPEKKRKYDTYGENAGPTTR--RTRRNYHEEEFEDISPEDIFNMFFGGGFPDXXXXXXXXXXXQQTY-FRQXXXXXXXXXXXXXXVSSXXXXXXXXXXXXXXXXXXXXXXXXPEPIFSFQPTSQYRYPMTTFKLGIKYYVKDRHVRQ-KHEDYNSIELKIEREFIETLQVRCYRERQYKAELRQQGHMWGSRELLEKADNYHPESCDKLKELQGRVH 1205
            ME NKDEA +C   A+K + S   ++A +F EK+ RLYPT     L+  +N       DQ  P  +  +H   R+   T++             K YT EQV  V+++K+CKD+YE+L VS+  S+ DLKK+YR+LALKFHPDKN APGA EAFK I  A+  L +PEK+++YD +G++     R      ++H     DISPED+FNMFFGGGFP   VHV    R + TY  RQ+   +  +      V      +  + +L+++          P    S +P+  + +   T  LG+ YYV D    +       ++E  +E ++I  L+  C++E+Q    L  +   +G  ++  +A      SC +L E+Q  +H
Sbjct:    1 MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDT--THATHRKAGGTDA-PSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFV-----QLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQSEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLH 374          
The following BLAST results are available for this feature:
BLAST of TCONS_00000001 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DJB125.574e-5134.55DnaJ homolog subfamily B member 12 OS=Homo sapiens... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php