Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00073399-protein ID=TCONS_00073399-protein|Name=TCONS_00073399-protein|organism=Clytia hemisphaerica|type=polypeptide|length=121bp MRISKADKIEVKTKSLYNGRKRSIQSFSSQVHKLGIASLKAILFHHNLPT RGTKDEIVLNVCLLKEDSRALYQQKLRFFSPRANKKDQHSHLSAETFLCS PFQKEPKVCHTTGTKYFDQES Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR003034 | SAP_dom |
Blast
The following BLAST results are available for this feature:
|