Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073399 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073399
Unique NameTCONS_00073399
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1525

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073399 ID=TCONS_00073399|Name=TCONS_00073399|organism=Clytia hemisphaerica|type=transcript|length=1525bp
AGTAAATTTCGTGTTTGGGCGTCGGCTCATGGGAAAGAGTTCCTGGTCTG
TTCATGCCAACCAGCATCCTCCAAATGGTGTTTGATACCTTCCTTGATTT
TACCATTGAATGGCATTAGCCAAGGAACATTGTTGGCCATATCTCTCCTT
GCATGGTAAGAccttattttgactttttattcgtttgattttcataaaaa
tggtcGGATCCCATCAAACATACTCATAACTTGGGTCTCGAATAACTTAG
ACGAGTTTTCTACCTTGGCCGTTCGAGTGACAAATATTCCACTGTGCATT
TCATCGTCTCGGAACTTATTAGGACCCCTtatcacttttttgaaaataca
tttaGACAATTAAAGATGATATTGTAATAGATTTCCTTTTAAAACTATAG
GTTACCTATCAACGAGGTGAAAGATTATTTTGAAGAAGAGACGGATGCCC
GCAAAGAGGATTATCAAGATGCCATTCTTCGCGAAGCATTACAGAAAGTA
CCATTCTATTCACAGAAGAAAGAAGTTCTTCAGAAGCTGGCGAAAGAAAA
GAGTTTAGATCACACCGGGACAAAGCTGGACATTGCCATGCGCATTTCAA
AGGCAGACAAGATTGAGGTGAAAACTAAGTCATTGTATAATGGTCGGAAA
CGCAGTATCCAGTCGTTCTCTTCTCAAGTTCATAAGCTTGgTATAGCAAG
TCTGAAGGCAATATTGTTCCACCATAACCTTCCAACACGTGGTACAAAGG
ACGAGATTGTGCTCAACGTTTGCCTTCTTAAGGAGGATTCGAGAGCACTG
TATCAGCAAAAACTACGTTTCTTCTCTCCTCGAGCTAATAAAAAAGACCA
GCACTCTCATTTGTCGGCAGAGACATTCTTGTGCAGTCCGTTCCAGAAAG
AGCCGAAAGTTTGCCACACCACAGGAACCAAGTATTTCGATCAAGAATCC
TAGAAAAAGCGCCAGTGAGGTATCGACATATAACAAAAGCAGAATTGATG
TCCCTTCTGGTATAGACGAGAGCAACATCGAAACGTTGTTCGAGCCCCTG
AGGCAAGATCTTTTGGCCATCTCAAGATTTGAAGAGGGTGACAACGAGCA
AAACGACAACGGGAACAATGAAGGGGACACGGTGGAAACACACATGGAGA
GGAATACgtatgaaagtttttttgaagttggaGTGAGGGTTGAAGTTCTA
CGAATGAAAGAGGAAACGAAAACTGGGAAACGCGGGGGGTGGCTTGTGGT
AGTTATCCAAGACTTTGATCTCGAAAATGATTGGGTCAGAGTGGAATTTT
TAAGTTACGAAGAAAAGCTTTTCAAGCTCTACGTCAGTGAACTTCTTCGT
GACGATAAGTTGAGACTTAAAAGCgctttgttttaaagtttattgTCGTT
TTTATGGTTCAGCTACGATGTTTTTACACGGGTGAAATTCGGGATAAAAA
AGAGAACCGCCATGTGCgttgaaaaattcactttttcctTACTAAAATTA
ACATTCAATTGTGACAGCAAAAtgt
Run BLAST on NCBI

protein sequence of TCONS_00073399-protein

>TCONS_00073399-protein ID=TCONS_00073399-protein|Name=TCONS_00073399-protein|organism=Clytia hemisphaerica|type=polypeptide|length=121bp
MRISKADKIEVKTKSLYNGRKRSIQSFSSQVHKLGIASLKAILFHHNLPT
RGTKDEIVLNVCLLKEDSRALYQQKLRFFSPRANKKDQHSHLSAETFLCS
PFQKEPKVCHTTGTKYFDQES
Run BLAST on NCBI

transcript from alignment at scaffold_91:200583..208526-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073399 ID=TCONS_00073399|Name=TCONS_00073399|organism=Clytia hemisphaerica|type=transcript|length=7944bp|location=Sequence derived from alignment at scaffold_91:200583..208526- (Clytia hemisphaerica)
AGTAAATTTCGTGTTTGGGCGTCGGCTCATGGGAAAGAGTTCCTGGTCTG TTCATGCCAACCAGCATCCTCCAAATGGTGTTTGATACCTTCCTTGATTT TACCATTGAATGGCATTAGCCAAGGAACATTGTTGGCCATATCTCTCCTT GCATGGTAAGACCTTATTTTGACTTTTTATTCGTTTGATTTTCATAAAAA TGGTCGGATCCCATCAAACATACTCATAACTTGGGTCTCGAATAACTTAG ACGAGTTTTCTACCTTGGCCGTTCGAGTGACAAATATTCCACTGTGCATT TCATCGTCTCGGAACTTATTAGGACCCCTTATCACTTTTTTGAAAATACA TTTAGACAATTAAAGATGATATTGTAATAGATTTCCTTTTAAAACTATAG GTTACCTATCAACGAGGTGAAAGATTATTTTGAAGAAGAGACGGATGCCC GCAAAGAGGATTATCAAGATGCCATTCTTCGCGAAGCATTACAGAAAGTA CCATTCTATTCACAGAAGAAAGAAGTTCTTCAGAAGCTGGCGAAAGAAAA GAGTTTAGATCACACCGGGACAAAGCTGGACATTGCCATGCGCATTTCAA AGGCAGACAAGATTGAGGTGAAAACTAAGTCATTGTATAATGGTCGGAAA CGCAGTATCCAGTCGTTCTCTTCTCAAGTTCATAAGCTTGGTAAGAACTA AATCATTTTTTGAGTTTCATTATTTCAGTAAAACTCCCTGATATTGAATA TCTCAAATTTAAGAACCCAAGACCTCGAGAGGGAAAATATAAGCATATTG TAAGAACATTACATAAGGCTTTGCTCTAAATTATCTGATTTCTTAGGGAA TTGCTTCAAACCACTCGAAAATACTTAATTACTCTAGCAACGTTATTTGC AAACGAGGGCTGTAATGCTTTTATGCATCTCGAGAAGAGTGAATTTGTTT AAATAAACAAAAAGTATGTAGAATTTGGAATATACATCGAAAAATAGCTT TGAGCATAAAGTTCAAAATACCTTTTGGTGTTCAGACTTTGGCGGGCAGA GAGAGAGAGCTTTGATTTTTTTCTAAACTTTATGCCACACCTATTTCTCT CTATTCGAAGCTTTCTACTGACTCACTAGACAGACCTCATTAATCTTGCA CAAAGAGCAGAAAANGAAGCTTTCTACTCACTCAATAGACAGACCTCATT AATCTTGCACAAAGAGCAGAAAAATCTCAATTACAAAGAAAAAATGTAGT TTTGTTTATTTATTTTTTCTGGTGTTCTAATTTTCAGACCTATTGTTAAA AAATCTGTCTGAAAAGACAGGAAAATATTTTTCTGTGCAGGGTTCGAATT ATAGCTTCGCACTTCGCAAATTGCGAAGCAATTTCAGGTTTTGGCGAAGA AAAAAGTTTTTTGAGATAAAAATTGCGAAGCAAAAATTTTTAAGCGAAAC TTAAAAATTGAAATGCAAAGAGAAAAAAGAATCTAACACAGTCTGTATAT GTAATTTAATGAGTGGGATCACACGCCTGAATAAACACTTTTTTAAAGTC TTTCTATATTCACTTCATTATGTTTATCAAAAAAACATAATCTCTTTCTA GTACATAAAAATTACTTTTGTTTGCTGAAAGCTTAGTTATAAATAAACCT ATGAATGTTTTTGATAAACAATTAATAATACACTTATTGTATGCCCCAGA CTTTCTTTTTTGGTAGCAGACATGATATATGATAGAAGATGAAATAATCT TTTTCACATTCACACTTTTTAAATTAAACAGGTGTACCAGGAAGAAAATT GTCACGCAATGTTCTAGTTGTTTCACAATCTTTATGATGTAATAATATTT TTTCAATAGCTTTTTTGTTCGTTATGTATTATATTATATATTAGAACAGA AAGAGAGCGGTCACACCAAATGATTTACCTCCGCTTATATAGCTGTTGTC ATAACAACAAATATTTTTATCTATTTTTTGATGTGACCACTCGAAAAAAT GGAAGAAAAAATCCTGAATTCGAGGAATCACCTGTTTTAATAAGCGAAAG NTCTTATCGTAGTTTAAGAAGAATTCCTTTATGTTTAAATAAATAGGTCT ATTGAAAATGGCGATTTGTGTTTACTTTTCAAATTTTGAAAATTTTAAAA AGATGTGCACATATTTTTTTGCACACGCCATTACCATCCACACACAAGAG AAAAACAGAGTTGTGTCGAGGCTTTTTATTTCGAATGAATGAATGAATGA ATTTTTATCCACACAAATCTTTAGACTTATTAGAAATGTTGATTGAAGTT TTCCGACGCGCCGCTTAAAATAAGCAAAAATGGTGATTCCTTTTTAGCAT TAACTAAACTTATATTTTGGTGTGACCGCGCTCAAAGAGAGCAAAGATAA CCTACAAATAGAATTGACGTCATAAATGAAAATTTGAATAAAGTAAATAG CAAAAAGTTTTTTCATGTATTTCATTTGTTTTATTCAAAGCTATTGAAGC TCACTATTGCGTCATTTTTAGCTTAAATGGAGTGGTTAATTTCATTCTTC GTTCATTTTCATACCAACATGGCTTCGTTAACAACTGTAAATAAGTGGCA AAGTTCTCTAAAATGCAAGCTAGATATATTGGAGATTGTCGATGGAAAGG TCAGAAAAATGAAGTGTATTGTTTGCTCTCAGTTTTCTGACAAGATTAAA GGAATGAAAGGATTCAGTCAGGCTTGGGTAGACGGTACAGAATCTATAAA GAAAGATAGTTTGGATAAACACATCAAAGGAGAGCCTCATAAACATGCAA AGGACCTTTCATTGAAAGTTTCCTTGGGTGCAAAATCTTATAACAAGGAA ATTGTTTCAAAAACACCGATTGGTAAAGGTTTAACAAAAATGCAAGAAGA AGATGAAAAGGTAATAAGTTTTTGTCATAATTTTGATTAACTACATAATC TGTATACTGTGTTTTCTCTTCTTTTGCAATGTATGTAATGATTAAATCAT GAAAATTTAGTTCCTTCTAAAAATTAATTACCCAGCTGGCACACAACGTT GTTTCAACGTACATCTAACGTTCATAACGTCCATAAAACGTTATATGAAC GTTAAAACGTTATATGAACGTTAAATCAGTTATATGAACGTTAAAACAAC GTTTTGTGCCAGCTGGAGAGTTGCGTTTTATTTTAAAGCTCAAATGCTAA TTTTCTAACATACTTAGACAAACCTTTTTCAGTCAGTAAACAAAACTTAT AAATGTCTTAAGTTTTTAAATTGAAGAGGGGTGTCTAGAAAAAAGTTTTT AATTGGTTTCACATGATTTTTGTATAGTTTTAAAGAGTAGTATTTCGAAT AGAGAATGGAGTGAAAAAAATAGAATCCCCCCTGTATTTATAATTTCAGA TCCTGCGCACCAGATTCAACACAGCATACTATCTATGCAAAAAGGAACGA CCGTACAGTGACTTTTCAGATCTACTGAGTTTGGAGGAGAAGAACGGTAT GAAAAAGAGTCACAGTTACAGGAATGACAGAGCTGCTGCTCAATTTATCG ATACGGTTGGTAAGGAGATGAAAGATTCTTTTGTGAATGATCTTTTGAAT GCCAACTACTATTCAGTATTAACCGATGGGAGTACCGATGCAAGCATCAC AGAACAAGAGGTAGTATATGTTCTCTATCTATCTGGTGGTGAGCCAAAAG TTAAGTTCTTAGGAATAGAGGCTCCGGATCAAGCAACTGCTGATGGATTG AAAGAAAATATTGAAAAGGCTTTTCACAATATCGGGATAACTCCTATGTA TGATTCCCTTGCCAATCTGTGTGTTGATGGAGCTTCTGTTAATACAGGCA TCCATAATGGTCTTGGTGCTAAGATGCAAGTTCATGCACAATGGCTAACC ATTATCCATTGTTTTAACCATAATCTGGAGCTAGCCGTTAGGCGAACCCG AAAAAATTTTTTGTTTCCGGTCCACCGGCCGGGTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTATAACTCACTCTAGCTCCTTGGATATTGAAAATAAGTTATGAAA ACGGGGTATAGGAAACTTTCTACACCTAATGCCGCTCAGAAAATGCAAAT ACATCTGTTACTTTAGAGGCTGGGTAAAAGATATAGCATCTTGAAGGTCA ACCAGTATTTTGGAGCCCAGAATCAGCATTGACAAAACCGAAAATTCTAA ATATGAGAAAAAGAAAAAAGTCTTGGAATTCTATTCCTATCACCTTGAGT TAGTAGTTTATAACAAAAAATTAACATTATATATAATNNCAAATTCTGTC ATTTTTTTGCAAAATATAGGAGAAAAATATCTTTAAAGCTTAATATTTTC AGTTTCAGTTATGCTTTTTTTCTAAAATTTTCACAACTTTTTCCATACAT GAATGGAACTATTTTCAAAAGAGATTTGTTTTCAAAAACTTAATAAAGAC GTTGTTAAATCAAAATTGTCATTTTGAAAATTTCTAAATTTTCAGTTTGG ACTTTGCAATATCGAAAATCTTGAAATATTTCATAAAAATCATAAATTTT ACATCCATCGGGTCGTAAATTTAAGGGAAAACACAAATATGCTCATAGTT TTCCCCCCTATTACAACTGGGCTTAATAATTTGATTTTAACTATACCTCC GTTTTGGGTGCCCCAAACCTGCATTTTGACAACCAGGGGTATACTGTAAA AATTTTATCAAATAAGTTTATGCCCAAAACCCTCTAAATCATATTTCAAA ACTATGGTCAAAATTTTGTATTCATATCTTAAAGATATCTCGAGAANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNATGTTGTAGATAGAACAATAGATCGTAAATAT AGATCGCATTTAATCGCAAATTACATCGCAAAACTCCAAAAGTGCTTCGC AAACATCTAAAAATTTTCACCTGCGGCGCTATCCCGCTCGCTTCGCTCGC ATTTTTTTAGCGAAGCTCCTCAAATTTATAATTCGAACCCTGCTGTGTAT CTCGTGAAAGAGTGTATTTCCTTTTATCCTGACCTAATAATAGGCCGATC AAAGAGCGAGAAAATGAATGAAATCTCTGTGAATAGCGGGAAACTTAAGA GGGAAAGAGCAAATTTTCATAATTTAACCTTTTTCTTAAGTAATCCTTTT TTCCTTTTTTCAAAAGGTATAGCAAGTCTGAAGGCAATATTGTTCCACCA TAACCTTCCAACACGTGGTACAAAGGACGAGATTGTGCTCAACGTTTGCC TTCTTAAGGAGGATTCGAGAGCACTGTATCAGCAAAAACTACGTTTCTTC TCTCCTCGAGCTAATAAAAAAGACCAGCACTCTCATTTGTCGGCAGAGAC ATTCTTGTGCAGTCCGTTCCAGAAAGAGCCGAAAGTTTGCCACACCACAG GTAGGGACCGCAATAACTTTTTAAAATCTTTTTAGCTTCTCAAAAGCTGG GCTATTCGAAAGAGTTTTAAAAAAGAGAAAAGACGAGGGGGCATTTGTTA AAACAAGTTTCTTGGTTAAAATCGGTTAAGCTGTTTATAAGATGCTGCAT TTCCCGGCTTAAAAATAAGCTTCATTGGATAGCTTTGGAGCATTTTTGGG GAATTCATGGATAAATCAAGTCAAACGCACTTTTATAGCTTTGCATGATG TAATTGTCTCCTTTATTGTGTAATAATTAAAACAGGTAAAACATCGTGTA TTGATTTTAAATATGGGCTCCGCTACCCCTAAGCTCGCTTATAAAGTAGA GTCGTCTGCCATTGTAATCCTTTGAAAAAAAATTTTTCAACGAAAAATAA AATTTAGATCAGCAGAATTTTGTCAAGACAGTTATTTTATGATACGAATT TCAGTCCATGATTTCGGGAGGTATAGATCACGAGATCCTGATTTTAGTGA AACTCCGATCATTTACCCCTGTCTTTTGCTGTCTCTACCACAGGAACCAA GTATTTCGATCAAGAATCCTAGAAAAAGCGCCAGTGAGGTATCGACATAT AACAAAAGCAGAATTGATGTCCCTTCTGGTATAGACGAGAGCAACATCGA AACGTTGTTCGAGCCCCTGAGGCAAGATCTTTTGGCCATCTCAAGATTTG AAGAGGGTGACAACGAGCAAAACGACAACGGGAACAATGAAGGGGACACG GTGGAAACACACATGGAGAGGAATACGTATGAAAGTTTTTTTGAAGTTGG AGTGAGGGTTGAAGTTCTACGAATGAAAGAGGAAACGAAAACTGGGAAAC GCGGGGGGTGGCTTGTGGTAGTTATCCAAGACTTTGATCTCGAAAATGAT TGGGTCAGAGTGGAATTTTTAAGTTACGAAGAAAAGCTTTTCAAGCTCTA CGTCAGTGAACTTCTTCGTGACGATAAGTTGAGACTTAAAAGCGCTTTGT TTTAAAGTTTATTGTCGTTTTTATGGTTCAGCTACGATGTTTTTACACGG GTGAAATTCGGGATAAAAAAGAGAACCGCCATGTGCGTTGAAAAATTCAC TTTTTCCTTACTAAAATTAACATTCAATTGTGACAGCAAAATGT

Coding sequence (CDS) from alignment at scaffold_91:200583..208526-

>TCONS_00073399 ID=TCONS_00073399|Name=TCONS_00073399|organism=Clytia hemisphaerica|type=CDS|length=1098bp|location=Sequence derived from alignment at scaffold_91:200583..208526- (Clytia hemisphaerica)
GAACCAAGTATTTCGATCAAGAATCCTAGGTATAGCAAGTCTGAAGGCAA
TATTGTTCCACCATAACCTTCCAACACGTGGTACAAAGGACGAGATTGTG
CTCAACGTTTGCCTTCTTAAGGAGGATTCGAGAGCACTGTATCAGCAAAA
ACTACGTTTCTTCTCTCCTCGAGCTAATAAAAAAGACCAGCACTCTCATT
TGTCGGCAGAGACATTCTTGTGCAGTCCGTTCCAGAAAGAGCCGAAAGTT
TGCCACACCACAGATGCGCATTTCAAAGGCAGACAAGATTGAGGTGAAAA
CTAAGTCATTGTATAATGGTCGGAAACGCAGTATCCAGTCGTTCTCTTCT
CAAGTTCATAAGCTTGGAACCAAGTATTTCGATCAAGAATCCTAGGTATA
GCAAGTCTGAAGGCAATATTGTTCCACCATAACCTTCCAACACGTGGTAC
AAAGGACGAGATTGTGCTCAACGTTTGCCTTCTTAAGGAGGATTCGAGAG
CACTGTATCAGCAAAAACTACGTTTCTTCTCTCCTCGAGCTAATAAAAAA
GACCAGCACTCTCATTTGTCGGCAGAGACATTCTTGTGCAGTCCGTTCCA
GAAAGAGCCGAAAGTTTGCCACACCACAGATGCGCATTTCAAAGGCAGAC
AAGATTGAGGTGAAAACTAAGTCATTGTATAATGGTCGGAAACGCAGTAT
CCAGTCGTTCTCTTCTCAAGTTCATAAGCTTGGAACCAAGTATTTCGATC
AAGAATCCTAGGTATAGCAAGTCTGAAGGCAATATTGTTCCACCATAACC
TTCCAACACGTGGTACAAAGGACGAGATTGTGCTCAACGTTTGCCTTCTT
AAGGAGGATTCGAGAGCACTGTATCAGCAAAAACTACGTTTCTTCTCTCC
TCGAGCTAATAAAAAAGACCAGCACTCTCATTTGTCGGCAGAGACATTCT
TGTGCAGTCCGTTCCAGAAAGAGCCGAAAGTTTGCCACACCACAGATGCG
CATTTCAAAGGCAGACAAGATTGAGGTGAAAACTAAGTCATTGTATAATG
GTCGGAAACGCAGTATCCAGTCGTTCTCTTCTCAAGTTCATAAGCTTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045550XLOC_045550Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073399-proteinTCONS_00073399-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073399-exon-scaffold_91-1575043694:207837..208526TCONS_00073399-exon-scaffold_91-1575043694:207837..208526Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1575043694:201727..201960TCONS_00073399-exon-scaffold_91-1575043694:201727..201960Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1575043694:200583..201183TCONS_00073399-exon-scaffold_91-1575043694:200583..201183Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1510915933:207837..208526TCONS_00073399-exon-scaffold_91-1510915933:207837..208526Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1510915933:201727..201960TCONS_00073399-exon-scaffold_91-1510915933:201727..201960Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1510915933:200583..201183TCONS_00073399-exon-scaffold_91-1510915933:200583..201183Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1491911889:207837..208526TCONS_00073399-exon-scaffold_91-1491911889:207837..208526Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1491911889:201727..201960TCONS_00073399-exon-scaffold_91-1491911889:201727..201960Clytia hemisphaericaexon
TCONS_00073399-exon-scaffold_91-1491911889:200583..201183TCONS_00073399-exon-scaffold_91-1491911889:200583..201183Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:200583..208526 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.000203654 8.08957e-05 0 0 0.888065 0.00172381 0.697479 0.00359761 0.000514112 0.00272674 0.819385 0.00444379 0 0.000493973 0.000270052 0.000171384 0 0.000137341 0.000411817 0.000327805 4.62003e-05 0.000226332 6.94512e-05 7.20539e-05 0.954921 3.12331 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003034SAP_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073399 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top