Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072831-protein ID=TCONS_00072831-protein|Name=TCONS_00072831-protein|organism=Clytia hemisphaerica|type=polypeptide|length=116bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072831-protein vs. Swiss-Prot (Human)
Match: T170A (Transmembrane protein 170A OS=Homo sapiens GN=TMEM170A PE=1 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 1.493e-25 Identity = 47/108 (43.52%), Postives = 69/108 (63.89%), Query Frame = 0 Query: 9 TTTLTGFNEIWYKIFLYCLGSNVFIHVIAAFIALRALHKHKYGRYLPIAIIVFGFLYPISGGFITSCCIAWIYTAANYAMEVQMCAIYGVGQTFFLVVVSFIRLYGTL 116 +T+L F E+WY +FL+ L S++F HV A +AL L HKYGR++ ++I++ G + PI+ G +TS IA +Y AA M G GQTF ++VVSF+R+ TL Sbjct: 37 STSLCSFPEMWYGVFLWALVSSLFFHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRILATL 144 The following BLAST results are available for this feature:
BLAST of TCONS_00072831-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|