Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070671-protein ID=TCONS_00070671-protein|Name=TCONS_00070671-protein|organism=Clytia hemisphaerica|type=polypeptide|length=319bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00070671-protein vs. Swiss-Prot (Human)
Match: SOX3 (Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2) HSP 1 Score: 117.087 bits (292), Expect = 1.203e-29 Identity = 48/78 (61.54%), Postives = 62/78 (79.49%), Query Frame = 0 Query: 106 DDDHVKRPMNAFMVWSRTERRKLALKFPNMLNCEISKLLGAEWSRMSDEDKSPYVQESKRLRTIHSQKYPDYSYKPRR 183 D D VKRPMNAFMVWSR +RRK+AL+ P M N EISK LGA+W ++D +K P++ E+KRLR +H ++YPDY Y+PRR Sbjct: 135 DQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRR 212 The following BLAST results are available for this feature:
BLAST of TCONS_00070671-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|