Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070035-protein ID=TCONS_00070035-protein|Name=TCONS_00070035-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00070035-protein vs. Swiss-Prot (Human)
Match: VIR (Protein virilizer homolog OS=Homo sapiens GN=KIAA1429 PE=1 SV=2) HSP 1 Score: 83.5741 bits (205), Expect = 2.660e-20 Identity = 45/98 (45.92%), Postives = 63/98 (64.29%), Query Frame = 0 Query: 7 LLFCDTFVHESHDEI-QLDLIGFARPVAISEIRVIPKGCKVHPEI--NDRLGETKPSSFKLELFIKNLSQPRAAVFEKLGILDYEEGKSIQLISNSKV 101 LLF DTF H S ++ +D++ F V I+E+RVIP G + H + N GET P +F+L+LF N+S+P A VF++LG L+Y+E SI NSKV Sbjct: 9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKV 106 The following BLAST results are available for this feature:
BLAST of TCONS_00070035-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|