Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00067255-protein ID=TCONS_00067255-protein|Name=TCONS_00067255-protein|organism=Clytia hemisphaerica|type=polypeptide|length=212bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 Expect = 1.9E-27 / Score = 94.9 Expect = 1.1E-6 / Score = 28.9 Sequence PF15867 PF13877
IPR Term IPR Description Source Source Term Source Description Alignment
IPR031733 Dynein attachment factor, N-terminal PFAM PF15867 Dynein_attach_N coord: 6..74 IPR025986 RNA-polymerase II-associated protein 3-like, C-terminal domain PFAM PF13877 RPAP3_C coord: 102..186
Blast
BLAST of TCONS_00067255-protein vs. Swiss-Prot (Human)
Match:
CC103 (Coiled-coil domain-containing protein 103 OS=Homo sapiens GN=CCDC103 PE=1 SV=1)
HSP 1 Score: 111.694 bits (278), Expect = 2.889e-30
Identity = 68/201 (33.83%), Postives = 101/201 (50.25%), Query Frame = 0
Query: 6 INFDKLQKEFYNAKKADQKYSRENDAKFRAVHQKVASYEEFRDIVTASHLQPLDRDDITGVKNVQQPWNTAYNTDQKDLKHNNIATSTLTEQTN-GIKTRDDFLKTW----STVENKVEYILSFDMDFLRSVFKCDIPFNFLETYVKSIKNDLSIDSLPKIINIFKVFTLCERFSLTLKFLGKKDKEELKSLLETIEKNGH 201
INF L+KE A AD+KY REN AK RAV Q+VASYEEFR IV ASHL+PL+R D G K PWN +T Q ++AT E+ +T DF + W + + + +L L +F+ D+ F L + ++ + + ++ I RF+L L L + ++E K L + ++ G+
Sbjct: 7 INFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT-VPWNC--HTIQGR-TFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVGFGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGN 203
The following BLAST results are available for this feature:
BLAST of TCONS_00067255-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M A E E G I N F D K L Q K E F Y N A K K A D Q K Y S R E N D A K F R A V H Q K V A S Y E E F R D I V T A S H L Q P L D R D D I T G V K N V Q Q P W N T A Y N T D Q K D L K H N N I A T S T L T E Q T N G I K T R D D F L K T W S T V E N K V E Y I L S F D M D F L R S V F K C D I P F N F L E T Y V K S I K N D L S I D S L P K I I N I F K V F T L C E R F S L T L K F L G K K D K E E L K S L L E T I E K N G H N I D E V K N L Y G L 20 40 60 80 100 120 140 160 180 200 Expect = 2.89e-30 / Id = 33.83 Sequence CC103
Match Name E-value Identity Description
CC103 2.889e-30 33.83 Coiled-coil domain-containing protein 103 OS=Homo ... [more]
back to top
