Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00051385-protein ID=TCONS_00051385-protein|Name=TCONS_00051385-protein|organism=Clytia hemisphaerica|type=polypeptide|length=211bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00051385-protein vs. Swiss-Prot (Human)
Match: HEM1 (5-aminolevulinate synthase, nonspecific, mitochondrial OS=Homo sapiens GN=ALAS1 PE=1 SV=2) HSP 1 Score: 83.1889 bits (204), Expect = 1.258e-18 Identity = 37/64 (57.81%), Postives = 47/64 (73.44%), Query Frame = 0 Query: 149 FKYEQHFNRMIEAKKTDHSYRIFRKVNRNTESFPMADDYTFSDRPHK-VTVWCSNDYLGMSGHP 211 F+Y++ F + I+ KK DH+YR+F+ VNR FPMADDY+ S K V+VWCSNDYLGMS HP Sbjct: 197 FQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHP 260 The following BLAST results are available for this feature:
BLAST of TCONS_00051385-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|