Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00050004-protein ID=TCONS_00050004-protein|Name=TCONS_00050004-protein|organism=Clytia hemisphaerica|type=polypeptide|length=232bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00050004-protein vs. Swiss-Prot (Human)
Match: H33 (Histone H3.3 OS=Homo sapiens GN=H3F3A PE=1 SV=2) HSP 1 Score: 77.411 bits (189), Expect = 3.910e-18 Identity = 37/87 (42.53%), Postives = 59/87 (67.82%), Query Frame = 0 Query: 137 LKEIRFFRRTNHKLVPKLAFCRLVKEIVSRIPGIDETLRIQTLALEALHEAAESFLVRFFEESNLCAFHSRRVTVMRKDMKFLKVLK 223 L+EIR ++++ L+ KL F RLV+EI LR Q+ A+ AL EA+E++LV FE++NLCA H++RVT+M KD++ + ++ Sbjct: 49 LREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR 132 The following BLAST results are available for this feature:
BLAST of TCONS_00050004-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|