Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00046191-protein ID=TCONS_00046191-protein|Name=TCONS_00046191-protein|organism=Clytia hemisphaerica|type=polypeptide|length=474bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00046191-protein vs. Swiss-Prot (Human)
Match: DMTA2 (Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens GN=DMRTA2 PE=2 SV=2) HSP 1 Score: 109.768 bits (273), Expect = 1.213e-25 Identity = 45/60 (75.00%), Postives = 51/60 (85.00%), Query Frame = 0 Query: 9 RSPKCARCRNHGFDSSLKGHKGYCRWRDCMCPKCVLIVERQRVLAAQVALRRQQMQESKQ 68 R+PKCARCRNHG S+LKGHK YCRW+DC+C KC LI ERQRV+AAQVALRRQQ QE + Sbjct: 66 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENE 125 The following BLAST results are available for this feature:
BLAST of TCONS_00046191-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|