Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007973-protein ID=TCONS_00007973-protein|Name=TCONS_00007973-protein|organism=Clytia hemisphaerica|type=polypeptide|length=202bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007973-protein vs. Swiss-Prot (Human)
Match: RSLBA (Ras-like protein family member 11A OS=Homo sapiens GN=RASL11A PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 3.629e-18 Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = 0 Query: 7 ISWTTAIVVVYSITDRNSFALARHILEIIDKIKPLSSRCTLLIGNKCDLMHLRQVPKSDAKKLADDFGVHFLECSAAENYDDIFSSFTRLLVEA 100 + W ++VYSITD +S+ R + + I K+ P S +++GNK DL+H RQV D +LA++ G FLE S +ENY+D+ F L E Sbjct: 103 VQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQHLCKEV 196 The following BLAST results are available for this feature:
BLAST of TCONS_00007973-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|