Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001865-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001865-protein
Unique NameTCONS_00001865-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length355

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001865-protein ID=TCONS_00001865-protein|Name=TCONS_00001865-protein|organism=Clytia hemisphaerica|type=polypeptide|length=355bp
MVTSVINTNSSNWSNDYNNEEDMASKTLLYDSNPNDDMWRKFSLPLTPPS
SPPRTFGETSECNDNTQDIANRLQDVCDSLDSAFDITSCVLPDAKYLRSK
LISDCMWSGNHGSDTKEKSRNVTFTQPKLSIDSIDTEEDLYPTPCASPIP
NVTTEHGDYPSSTDCVDPTTVFPLPSSQENLPSMLSGQSDSDEEIDVVTV
DAIPSTPITIGIKRKQAPNTIILAKLQTSNPQVCFKRTKSAPSRIQNDKP
DRASRRSATSPYDSDPETRRATHNVLERKRRIDLKKSFERLRECVPNLEK
IDKTPKVIVLKKAANHIEDLKREEKELDEQKQKLRQRNEDLMRKLELLKA
VCNID
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000985XLOC_000985Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001865TCONS_00001865Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR002418Tscrpt_reg_Myc
IPR011598bHLH_dom
IPR012682Tscrpt_reg_Myc_N
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046983protein dimerization activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0046983 protein dimerization activity
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 310..351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..272
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..59
NoneNo IPR availableCDDcd14686bZIPcoord: 311..346
e-value: 0.00367086
score: 33.6729
IPR002418Transcription regulator MycPRINTSPR00044LEUZIPPRMYCcoord: 303..316
score: 53.49
coord: 34..52
score: 55.09
coord: 100..115
score: 42.08
coord: 261..277
score: 47.19
coord: 278..293
score: 54.58
IPR002418Transcription regulator MycPIRSFPIRSF001705Myc_proteincoord: 177..351
e-value: 1.1E-22
score: 78.5
coord: 10..191
e-value: 2.8E-13
score: 47.5
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 274..326
e-value: 4.9E-13
score: 59.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainGENE3D4.10.280.10coord: 265..347
e-value: 4.7E-16
score: 58.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 269..320
e-value: 8.6E-13
score: 47.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 268..320
score: 15.472
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 266..325
e-value: 6.75351E-16
score: 70.3207
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSUPERFAMILY47459HLH, helix-loop-helix DNA-binding domaincoord: 266..345
IPR012682Transcription regulator Myc, N-terminalPFAMPF01056Myc_Ncoord: 17..180
e-value: 5.5E-12
score: 46.1

Blast
BLAST of TCONS_00001865-protein vs. Swiss-Prot (Human)
Match: MYC (Myc proto-oncogene protein OS=Homo sapiens GN=MYC PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.404e-25
Identity = 106/408 (25.98%), Postives = 169/408 (41.42%), Query Frame = 0
Query:   34 PNDDMWRKFSLPLTPPSSPPRTFGETS---------------ECNDNTQDIANRLQDVCDSLDSAFDITS--CVLPDAKYLRSKLISDCMWSGNHGSDTKEKSRNVTFTQPKLSIDSIDTEEDLYPTPCASPIPNVTTEHGDY-----PSSTDCVDPTTVFPLPSSQENLPSMLSGQ-------------------SDSDEEIDVVTVDAIPSTPI-------------TIGIKRKQAPNT-------------------IILAKLQTSNPQVCFKRTKSAPSRIQNDKPDR--------------ASRRSATSPYDSDPE--TRRATHNVLERKRRIDLKKSFERLRECVPNLEKIDKTPKVIVLKKAANHIEDLKREEKELDEQKQKLRQRNEDLMRKLELLKAVC 352
            P++D+W+KF L  TPP SP R  G  S               +    +   A++L+ V + L       S  C   D  ++++ +I DCMWSG         S        KL+      ++   P P      +V +    Y      ++++C+DP+ VFP P +  + P   + Q                        E  V+  +  P+T                + ++++QAP                     ++L +   S  Q  +    +AP   + D P                ++ R  TSP  SD E   +R THNVLER+RR +LK+SF  LR+ +P LE  +K PKV++LKKA  +I  ++ EE++L  ++  LR+R E L  KLE L+  C
Sbjct:   45 PSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGF--------SAAAKLVSEKLASYQAARKDSGSPNPARGH--SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNY----AAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSC 438          
The following BLAST results are available for this feature:
BLAST of TCONS_00001865-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYC1.404e-2525.98Myc proto-oncogene protein OS=Homo sapiens GN=MYC ... [more]
back to top