Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001865 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001865
Unique NameTCONS_00001865
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2404

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001865 ID=TCONS_00001865|Name=TCONS_00001865|organism=Clytia hemisphaerica|type=transcript|length=2404bp
GTTTACTCTTCGATAGACATAAACGGAGGACAGCTTTGAAAGCTGCTCAA
ACGAGAAAACCAATATCTCTCGTACGAAGTAGTAATTGGACAGATCAACT
TAGATTATTATGGTGACTAGTGTTATAAATACGAATTCAAGTAATTGGTC
GAACGACTACAACAACGAAGAAGATATGGCTTCGAAAACATTACTCTACG
ACTCGAATCCTAACGATGATATGTGGCGGAAATTTTCACTACCTCTTACC
CCGCCAAGTTCTCCCCCGAGAACCTTTGGCGAAACTTCGGAATGTAATGA
CAACACTCAAGATATTGCTAATCGTTTACAAGACGTTTGTGATAGTTTAG
ACTCCGCGTTTGATATTACAAGTTGTGTATTACCGGACGCTAAATATTTA
CGCTCAAAGTTGATATCGGATTGTATGTGGTCGGGAAATCATGGATCAGA
CACGAAAGAGAAATCTCGTAATGTTACTTTTACTCAACCGAAACTTTCTA
TCGACTCTATCGACACAGAAGAAGACCTTTATCCGACTCCTTGTGCAAGC
CCCATCCCAAACGTTACGACAGAACATGGTGATTATCCGTCATCTACCGA
TTGTGTCGACCCTACCACCGTTTTCCCTCTCCCTTCGTCACAAGAAAATC
TACCCTCAATGCTCTCTGGACAATCTGACTCAGacGAAGAAATTGACGTT
GTGACAGTTGACGCAATTCCTTCCACTCCCATCACGATTGGAATCAAACG
CAAACAAGCTCCAAACACGATAATTTTGGCAAAACTTCAAACGTCAAACC
CACAAGTCTGTTTCAAAAGAACGAAAAGTGCACCCAGCCGAATTCAAAAT
GATAAACCAGACCGTGCTTCACGCCGATCAGCTACAAGTCCTTACGATTC
TGATCCTGAAACGAGGCGAGCCACTCATAACGTCCTCGAAAGAAAACGAA
GAATCgatttgaagaaaagttttgaaagattACGTGAATGTGTCccaaat
cttgagaaaattgataaaactCCGAAagttattgttttgaaaaaggcAGC
AAACCATATCGAGGACTTAAAACGTGAAGAAAAGGAGTTGGACGAACAGA
AACAAAAATTGCGACAACGTAACGAAGACTTGATGAGAAAATTAGAATTA
TTGAAGGCTGTATGTAATATTGATTGAAATTGTGGAGCTTAGCTAGCTGA
TGCTTTTTTAAGATGCACCCTAAAAGTATATATATGTCAGGAGGAATTGT
ATAATTTCTATCGCAAGAAAAAGGGTTGGTCTTGTTAGGAACTAAATAGT
CAAAACACTAAAACATAAACCCAaacttttttcttccaaaaaattatatt
ttaaaactgaaatgtttatatgtaaatattcaaaaaactatttaaaagat
attaaaGATCTCGTGTAAAAACTATATGCATTTATACTTGTAAGATTTTA
TTAGTTTATGACTTAAAACCAAGGCTTTTTTCGTTATCTAAACTCCCGAA
ATTATTTTAGGGAATGATAGCtaattttttaattacttttttcaattttt
ctttttagatagCCAGCTTATAAAATGCTgtatttgttcaaatttttcat
aaagtCATTTTCAGGAGGCTTTCTCTTTGTCGTGTTTTAATAAGATTTTG
ATAACACTGATAagtctttttttgtttgttaacGATTTCGACATCATTTT
TATGTGTTTTTGGGGTTTTCCACTATTTTTTATGTATTGCTCTTTTTACA
GTTCTTTTCCTTTGTCGAATTTTTTTACATCTATCATCATGTTAAATCAG
CTCAagaattttgattgaatttacaAGTATTTGAAATTTCGTCCATTCAA
TCCTTTACGGGGAGGGGTATGAAAAATTCGACATAGGAAAAGCGttgcaa
ttttcatatttttattaccttttTGTGTTCGgataaaaatgttgttttct
aagggaaagttagttctaagataaTATTTTGACTCGCTTTTTCACAACTA
GTAAAGAAATCTTGTATTTTCGAGCACTTTTGTTTACATTGGTTTGCAAa
ctaataaaagtttttttctcaaagcttttgttagaaattttatttcaaac
ataTTTGAATTTAGTTAACATTTGTATTaaaatgaattattttgaatttt
tctgatGCTTATACTCGGAGGAATACTTAAAAAGCTCCTAACTTGTAATT
CGATGTTTCACTAGACGACTCatgagaaaaaagaatttttataaaaagag
aaGTCGAATAACTTATGTATCGTCTTTGTCTGACTGTTTACCTTCCCCCT
AATGATTgtcaatttatgaaaaagtagCTTTTCGAAACAATATTCTTTGC
TTGGTAATATGAATCTGACACGAATAATATTGAATTGGATCAGAAAGTAA
ATAC
Run BLAST on NCBI

protein sequence of TCONS_00001865-protein

>TCONS_00001865-protein ID=TCONS_00001865-protein|Name=TCONS_00001865-protein|organism=Clytia hemisphaerica|type=polypeptide|length=355bp
MVTSVINTNSSNWSNDYNNEEDMASKTLLYDSNPNDDMWRKFSLPLTPPS
SPPRTFGETSECNDNTQDIANRLQDVCDSLDSAFDITSCVLPDAKYLRSK
LISDCMWSGNHGSDTKEKSRNVTFTQPKLSIDSIDTEEDLYPTPCASPIP
NVTTEHGDYPSSTDCVDPTTVFPLPSSQENLPSMLSGQSDSDEEIDVVTV
DAIPSTPITIGIKRKQAPNTIILAKLQTSNPQVCFKRTKSAPSRIQNDKP
DRASRRSATSPYDSDPETRRATHNVLERKRRIDLKKSFERLRECVPNLEK
IDKTPKVIVLKKAANHIEDLKREEKELDEQKQKLRQRNEDLMRKLELLKA
VCNID
Run BLAST on NCBI

transcript from alignment at sc0000012:58474..61516-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001865 ID=TCONS_00001865|Name=TCONS_00001865|organism=Clytia hemisphaerica|type=transcript|length=3043bp|location=Sequence derived from alignment at sc0000012:58474..61516- (Clytia hemisphaerica)
GTTTACTCTTCGATAGACATAAACGGAGGACAGCTTTGAAAGCTGCTCAA ACGAGAAAACCAATGTAAGTACTATGAAGTCTTTCACAATTTTCATTCGT TTTCCATCTAAAAGTTTGTTGTTAGTAAAGTTTTGTAACTTTGGCTTTTT CAGAAAGATTTGTACCTGCTGGGGCACGGCATCACTTGCCTCATGTTTTA GCAGAGCTTGCAATAAAAGTTTCTGTTTTTCAAAATTTTGTTTATTTTTT CCATAGATCTCTCGTACGAAGTAGTAATTGGACAGATCAACTTAGATTAT TGTAAGTATTACATTTATTTTATCTAGCCTTTGCGATAAAAATGGGTACA TACTTATGTGCTGTTGCTAGCAACCTTTCTGTTTGTGAATCACCACAGGG ACTCTAATTAGATGTGCTATGTCTCATTGCTCCTTTTTATTTTAAAAGCT TGTTGTATAAAGTTATGAATGAAAGCGTATTCATCAAAGTTCCTCTTATT TTTAGATGGTGACTAGTGTTATAAATACGAATTCAAGTAATTGGTCGAAC GACTACAACAACGAAGAAGATATGGCTTCGAAAACATTACTCTACGACTC GAATCCTAACGATGATATGTGGCGGAAATTTTCACTACCTCTTACCCCGC CAAGTTCTCCCCCGAGAACCTTTGGCGAAACTTCGGAATGTAATGACAAC ACTCAAGATATTGCTAATCGTTTACAAGACGTTTGTGATAGTTTAGACTC CGCGTTTGATATTACAAGTTGTGTATTACCGGACGCTAAATATTTACGCT CAAAGTTGATATCGGATTGTATGTGGTCGGGAAATCATGGATCAGACACG AAAGAGAAATCTCGTAATGTTACTTTTACTCAACCGAAACTTTCTATCGA CTCTATCGACACAGAAGAAGACCTTTATCCGACTCCTTGTGCAAGCCCCA TCCCAAACGTTACGACAGAACATGGTGATTATCCGTCATCTACCGATTGT GTCGACCCTACCACCGTTTTCCCTCTCCCTTCGTCACAAGAAAATCTACC CTCAATGCTCTCTGGACAATCTGACTCAGGTAAACATTTAATTTTTGGCT TTTTCTATAGTTAGGAATCGACATTTTTAACAGTTTAGACGAATTAAAAA GAATTGAAAATGTAGAATGACCCTTAAAATCTTTCGAACATCATATTCGA ACGTTTTTCTCGCTTCTGATTGGTCGATGAAACGATTGCGAAATACACCC ATAATTTTCGAATGTTTATGTTTGCAATTTTTTCTTTCCTAAAAAAAATG TTCATTCATTTTTCTTCTTCAGACGAAGAAATTGACGTTGTGACAGTTGA CGCAATTCCTTCCACTCCCATCACGATTGGAATCAAACGCAAACAAGCTC CAAACACGATAATTTTGGCAAAACTTCAAACGTCAAACCCACAAGTCTGT TTCAAAAGAACGAAAAGTGCACCCAGCCGAATTCAAAATGATAAACCAGA CCGTGCTTCACGCCGATCAGCTACAAGTCCTTACGATTCTGATCCTGAAA CGAGGCGAGCCACTCATAACGTCCTCGAAAGAAAACGAAGAATCGATTTG AAGAAAAGTTTTGAAAGATTACGTGAATGTGTCCCAAATCTTGAGAAAAT TGATAAAACTCCGAAAGTTATTGTTTTGAAAAAGGCAGCAAACCATATCG AGGACTTAAAACGTGAAGAAAAGGAGTTGGACGAACAGAAACAAAAATTG CGACAACGTAACGAAGACTTGATGAGAAAATTAGAATTATTGAAGGCTGT ATGTAATATTGATTGAAATTGTGGAGCTTAGCTAGCTGATGCTTTTTTAA GATGCACCCTAAAAGTATATATATGTCAGGAGGAATTGTATAATTTCTAT CGCAAGAAAAAGGGTTGGTCTTGTTAGGAACTAAATAGTCAAAACACTAA AACATAAACCCAAACTTTTTTCTTCCAAAAAATTATATTTTAAAACTGAA ATGTTTATATGTAAATATTCAAAAAACTATTTAAAAGATATTAAAGATCT CGTGTAAAAACTATATGCATTTATACTTGTAAGATTTTATTAGTTTATGA CTTAAAACCAAGGCTTTTTTCGTTATCTAAACTCCCGAAATTATTTTAGG GAATGATAGCTAATTTTTTAATTACTTTTTTCAATTTTTCTTTTTAGATA GCCAGCTTATAAAATGCTGTATTTGTTCAAATTTTTCATAAAGTCATTTT CAGGAGGCTTTCTCTTTGTCGTGTTTTAATAAGATTTTGATAACACTGAT AAGTCTTTTTTTGTTTGTTAACGATTTCGACATCATTTTTATGTGTTTTT GGGGTTTTCCACTATTTTTTATGTATTGCTCTTTTTACAGTTCTTTTCCT TTGTCGAATTTTTTTACATCTATCATCATGTTAAATCAGCTCAAGAATTT TGATTGAATTTACAAGTATTTGAAATTTCGTCCATTCAATCCTTTACGGG GAGGGGTATGAAAAATTCGACATAGGAAAAGCGTTGCAATTTTCATATTT TTATTACCTTTTTGTGTTCGGATAAAAATGTTGTTTTCTAAGGGAAAGTT AGTTCTAAGATAATATTTTGACTCGCTTTTTCACAACTAGTAAAGAAATC TTGTATTTTCGAGCACTTTTGTTTACATTGGTTTGCAAACTAATAAAAGT TTTTTTCTCAAAGCTTTTGTTAGAAATTTTATTTCAAACATATTTGAATT TAGTTAACATTTGTATTAAAATGAATTATTTTGAATTTTTCTGATGCTTA TACTCGGAGGAATACTTAAAAAGCTCCTAACTTGTAATTCGATGTTTCAC TAGACGACTCATGAGAAAAAAGAATTTTTATAAAAAGAGAAGTCGAATAA CTTATGTATCGTCTTTGTCTGACTGTTTACCTTCCCCCTAATGATTGTCA ATTTATGAAAAAGTAGCTTTTCGAAACAATATTCTTTGCTTGGTAATATG AATCTGACACGAATAATATTGAATTGGATCAGAAAGTAAATAC

Coding sequence (CDS) from alignment at sc0000012:58474..61516-

>TCONS_00001865 ID=TCONS_00001865|Name=TCONS_00001865|organism=Clytia hemisphaerica|type=CDS|length=2136bp|location=Sequence derived from alignment at sc0000012:58474..61516- (Clytia hemisphaerica)
ACGAAGAAATTGACGTTGTGACAGTTGACGCAATTCCTTCCACTCCCATC
ACGATTGGAATCAAACGCAAACAAGCTCCAAACACGATAATTTTGGCAAA
ACTTCAAACGTCAAACCCACAAGTCTGTTTCAAAAGAACGAAAAGTGCAC
CCAGCCGAATTCAAAATGATAAACCAGACCGTGCTTCACGCCGATCAGCT
ACAAGTCCTTACGATTCTGATCCTGAAACGAGGCGAGCCACTCATAACGT
CCTCGAAAGAAAACGAAGAATCGATTTGAAGAAAAGTTTTGAAAGATTAC
GTGAATGTGTCCCAAATCTTGAGAAAATTGATAAAACTCCGAAAGTTATT
GTTTTGAAAAAGGCAGCAAACCATATCGAGGACTTAAAACGTGAAGAAAA
GGAGTTGGACGAACAGAAACAAAAATTGCGACAACGTAACGAAGACTTGA
TGAGAAAATTAGAATTATTGAAGGCTGTATGTAATATTGATTGAATGGTG
ACTAGTGTTATAAATACGAATTCAAGTAATTGGTCGAACGACTACAACAA
CGAAGAAGATATGGCTTCGAAAACATTACTCTACGACTCGAATCCTAACG
ATGATATGTGGCGGAAATTTTCACTACCTCTTACCCCGCCAAGTTCTCCC
CCGAGAACCTTTGGCGAAACTTCGGAATGTAATGACAACACTCAAGATAT
TGCTAATCGTTTACAAGACGTTTGTGATAGTTTAGACTCCGCGTTTGATA
TTACAAGTTGTGTATTACCGGACGCTAAATATTTACGCTCAAAGTTGATA
TCGGATTGTATGTGGTCGGGAAATCATGGATCAGACACGAAAGAGAAATC
TCGTAATGTTACTTTTACTCAACCGAAACTTTCTATCGACTCTATCGACA
CAGAAGAAGACCTTTATCCGACTCCTTGTGCAAGCCCCATCCCAAACGTT
ACGACAGAACATGGTGATTATCCGTCATCTACCGATTGTGTCGACCCTAC
CACCGTTTTCCCTCTCCCTTCGTCACAAGAAAATCTACCCTCAATGCTCT
CTGGACAATCTGACTCAGACGAAGAAATTGACGTTGTGACAGTTGACGCA
ATTCCTTCCACTCCCATCACGATTGGAATCAAACGCAAACAAGCTCCAAA
CACGATAATTTTGGCAAAACTTCAAACGTCAAACCCACAAGTCTGTTTCA
AAAGAACGAAAAGTGCACCCAGCCGAATTCAAAATGATAAACCAGACCGT
GCTTCACGCCGATCAGCTACAAGTCCTTACGATTCTGATCCTGAAACGAG
GCGAGCCACTCATAACGTCCTCGAAAGAAAACGAAGAATCGATTTGAAGA
AAAGTTTTGAAAGATTACGTGAATGTGTCCCAAATCTTGAGAAAATTGAT
AAAACTCCGAAAGTTATTGTTTTGAAAAAGGCAGCAAACCATATCGAGGA
CTTAAAACGTGAAGAAAAGGAGTTGGACGAACAGAAACAAAAATTGCGAC
AACGTAACGAAGACTTGATGAGAAAATTAGAATTATTGAAGGCTGTATGT
AATATTGATTGAATGGTGACTAGTGTTATAAATACGAATTCAAGTAATTG
GTCGAACGACTACAACAACGAAGAAGATATGGCTTCGAAAACATTACTCT
ACGACTCGAATCCTAACGATGATATGTGGCGGAAATTTTCACTACCTCTT
ACCCCGCCAAGTTCTCCCCCGAGAACCTTTGGCGAAACTTCGGAATGTAA
TGACAACACTCAAGATATTGCTAATCGTTTACAAGACGTTTGTGATAGTT
TAGACTCCGCGTTTGATATTACAAGTTGTGTATTACCGGACGCTAAATAT
TTACGCTCAAAGTTGATATCGGATTGTATGTGGTCGGGAAATCATGGATC
AGACACGAAAGAGAAATCTCGTAATGTTACTTTTACTCAACCGAAACTTT
CTATCGACTCTATCGACACAGAAGAAGACCTTTATCCGACTCCTTGTGCA
AGCCCCATCCCAAACGTTACGACAGAACATGGTGATTATCCGTCATCTAC
CGATTGTGTCGACCCTACCACCGTTTTCCCTCTCCCTTCGTCACAAGAAA
ATCTACCCTCAATGCTCTCTGGACAATCTGACTCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000985XLOC_000985Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001865-proteinTCONS_00001865-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001865-exon-sc0000012-1575043694:61453..61516TCONS_00001865-exon-sc0000012-1575043694:61453..61516Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1575043694:61216..61260TCONS_00001865-exon-sc0000012-1575043694:61216..61260Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1575043694:60438..61011TCONS_00001865-exon-sc0000012-1575043694:60438..61011Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1575043694:58474..60194TCONS_00001865-exon-sc0000012-1575043694:58474..60194Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1510915933:61453..61516TCONS_00001865-exon-sc0000012-1510915933:61453..61516Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1510915933:61216..61260TCONS_00001865-exon-sc0000012-1510915933:61216..61260Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1510915933:60438..61011TCONS_00001865-exon-sc0000012-1510915933:60438..61011Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1510915933:58474..60194TCONS_00001865-exon-sc0000012-1510915933:58474..60194Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1491911889:61453..61516TCONS_00001865-exon-sc0000012-1491911889:61453..61516Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1491911889:61216..61260TCONS_00001865-exon-sc0000012-1491911889:61216..61260Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1491911889:60438..61011TCONS_00001865-exon-sc0000012-1491911889:60438..61011Clytia hemisphaericaexon
TCONS_00001865-exon-sc0000012-1491911889:58474..60194TCONS_00001865-exon-sc0000012-1491911889:58474..60194Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:58474..61516 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
31.7118 28.2445 20.2953 17.3492 234.772 174.118 83.0787 90.2473 22.6777 26.1161 17.1285 15.2748 19.3598 17.4485 22.7887 38.8849 35.5875 34.9339 12.5426 16.9725 29.7075 30.6422 29.6514 31.0011 37.7438 42.7612 94.0361 90.2583 23.5548 22.2256
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002418Tscrpt_reg_Myc
IPR011598bHLH_dom
IPR012682Tscrpt_reg_Myc_N
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046983protein dimerization activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0046983 protein dimerization activity
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001865 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top